1AQCA

X11 ptb domain-10mer peptide complex
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
166
structure length
130
Chain Sequence
MEDLIDGIIFAANYLGSTQLLSDKTPSKNVRMMQAQEAVSRIKMAQKLMTEVDLFILTQRIKVLNADTQETMMDHPLRTISYIADIGNIVVLMARRRYKMICHVFESEDAQLIAQSIGQAFSVAYQEFLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Sequence-specific recognition of the internalization motif of the Alzheimer's amyloid precursor protein by the X11 PTB domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Complex (peptide binding module/peptide)
molecule keywords X11
total genus 30
structure length 130
sequence length 166
chains with identical sequence B
ec nomenclature
pdb deposition date 1997-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00640 PID Phosphotyrosine interaction domain (PTB/PID)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1aqcA00
3ODWA 2RSGA 4HAYB 1UEFA 2DYNA 2IYBA 1ZC4B 1P5TA 5D3XA 4GMVA 3T06A 3DXEA 1FHXA 2M38A 2YT1A 1WJMA 4HAXB 2LOXA 2XQNM 1FHWA 3P7ZA 1XX0A 3NSUA 4PNKA 2DHIA 2P8VA 2LYDA 3LJUX 2NZ8B 5CLLB 1BTKA 3BJIA 3V5WA 5EFXA 4EJNA 1P6SA 1X86A 3ZVRA 4A5KA 3UZTA 3KZ1A 1KI1B 1DDWA 3WA0A 5CLQB 2ROZB 1GC6A 1P3RA 3D8EA 2UZRA 5JP4A 4WVFB 4WSFA 4HDOA 1LB1A 1BAKA 5C6RA 2ROVA 4A6FA 1NU2A 1X1GA 4Y94A 2DKQA 2E2XA 4F7HA 3OANA 3KSYA 2EC1A 2VRWB 3TFMA 4ZRIA 2Z0PA 1XCGA 4K81A 1ZSQA 2DKPA 1FB8A 2UZSA 4KAXB 4KHBB 5DHAB 1N3HA 1OY2A 1Q67A 3U7DA 4K2PA 1MPHA 1WJ1A 4A6FB 1BTNA 1W1GA 4CYEA 4F7GA 1FGZA 1W1DA 1SGHA 2ADZA 1EF1A 1XKEA 1EVHA 5FI0A 1FAOA 1WGQA 1ZC3B 2GCJA 5L81A 1DYNA 1WG7A 2DHKA 1V88A 4Z2NA 2YS3A 5KCVA 2AL6A 3FM8C 5HE3A 2FJLA 2DHJA 1H4RA 5HE2A 1V5PA 2HTHB 4GXBA 2J59M 2KUPA 2QKLA 4D0NB 4A6KA 1Y19B 1PLSA 5J3QA 2ELBA 4K2OA 2I5FA 2IFSA 2K00A 2P0HA 3PEGA 5C79A 1MAIA 2DX5A 2VKIA 2M14A 5JLJB 2R0DA 2W2WA 3F5RA 1PFJA 3A98B 1IRSA 1U5GA 3QWMA 4CHMA 1TQZA 1BWNA 4PQ0A 4ZRKA 2NMBA 5JHHA 3KRWA 5KQ1A 1U5FA 5HE0A 2DX1A 2CY4A 1KZGA 3ODXA 3MPXA 3ULCA 2RVBB 1MK7B 5C5BB 3AU4A 2VSZA 1RRPB 4B6HA 5KQ4A 2UVMA 3BINA 4K17A 2Z0OA 1J19A 3AJ4A 2RGNB 3MDBC 3QIJA 5J3TA 4CHJA 1U5EA 1AWEA 5DH9B 5DI9B 1LW3A 5LOPB 4GPTB 2KCJA 3HK0A 3TVVA 3FEHA 1EGXA 2P0DA 3ULBA 2QKMA 1UNQA 1U2BA 3TCAA 4IAPA 1DBHA 1DROA 1MIXA 4H8SA 5GOWB 4DXAB 2DN6A 2GJYA 2DLWA 3QBVB 1PMSA 1UPQA 1X11A 5DIFB 2D11A 2I5CA 2X18A 2EMSA 2YVCA 2Y8GA 2COCA 2CAYA 4GN1A 3CXBB 3A8QA 5D27A 4TYZA 1V5MA 3DXDA 2P0FA 4HB3B 2D9VA 2L1CA 1DDMA 3A8PA 3PVUA 4NY0A 3PVWA 2MFQA 2LOZA 5C5BA 1MIZB 3O96A 5DHFB 2BCJA 1X05A 1U5DA 2YS5A 2D9XA 2CRFA 2D10A 2YS1A 2DYQA 4EKUA 2RNRB 5HE1A 1ISNA 3ZDTA 4DX90 4Z2MB 2GCLA 4BBKA 4C0AA 1FOEA 1XR0B 2LULA 1SHCA 2AEHA 3TW1A 4HHVA 3KRXA 4ZRJA 2J0MA 1UNPA 5D3WA 4HDQA 2RLOA 4HATB 4IFSA 1WGUA 2D9WA 3PG7A 5JHGA 3N7CA 2MDXA 2H7EA 4NSWA 5C16A 2Y8FA 1M7EA 4L6EA 1J0WA 1WVHA 1XODA 3PVLA 2COAA 1GG3A 3VIAA 2I1KA 4YL8A 1GC7A 3VOQA 1NI2A 2RUKB 2J0KA 1NTVA 2LG1A 4HAZB 2OQBA 1Z87A 4HAVB 1U27A 3SUZA 2MWNB 1UPRA 1OMWA 4F7UP 2V76A 3D8DA 3D8FA 3AU5A 2L2IA 3IVFA 2D4QA 1I2HA 3X23A 1K5GB 2R09A 3SNHA 2YF0A 4GMXB 1XD4A 3TO1A 3F0WA 2PZ1A 2K2JA 3KY9A 3SYXA 4HAWB 4DBBA 4P7IA 2DTCA 3GYPA 1B55A 4WJ7A 5D3YA 2H7DA 2DFKA 1W1HA 1E5WA 2HE7A 2G35A 5J3YA 1WI1A 4IOYX 4MT7A 1V61A 4HB2B 1MK9B 4HAUB 3P6AA 1EAZA 1DDVA 4GZUA 1TJ6A 4MK0A 4MY6A 2MKRA 2YSZA 2ZPYA 4HB4B 1KZ7A 1V5UA 2Z0QA 3FSSA 2W2XC 2LKOA 4DX8A 1RJ2A 1FHOA 2CY5A 1X1FA 4KVGB 2ELAA 2W2XD 3G9WA 1AQCA 3WYFB 3ODOA 2Q13A 2D9ZA 3DXCA 1M7RA 2D9YA 1OQNA 1QC6A 1H10A 4A6HA 2D2QA 2I1JA 5FI1A 3SO6A 3M1IB 3HQCA 3PZDA 4EMOA 2GS0A 2KGXB 3HW2B 3GYOA 2EMTA 4KHOA 1ZVRA 1Y5OA 1U29A 3SV1A 5LONB 2CODA 3PP2A 2EJ8A 2COFA 2K2UA 4YONA 4XWXA 2YRYA 3U8ZA 2N0YA 2OTXA 1NTYA 3PSCA 3ML4A 2J0JA 1V89A 1I7AA 3RCPA 1QQGA 4TKNA 1FGYA 1TXDA 2DA0A 1UNRA 1ZM0A 3CIKA 2N23A 5D3VA 2YT0A 2Y7BA 1K5DB 1MKEA 4KHAA 4HB0B 2JP2A
chains in the Genus database with same CATH superfamily
3ODWA 2RSGA 4HAYB 1UEFA 2DYNA 2IYBA 1ZC4B 1P5TA 5D3XA 4GMVA 3T06A 3DXEA 1FHXA 2M38A 2YT1A 1WJMA 4HAXB 2KR0A 2LOXA 2XQNM 1FHWA 3P7ZA 1XX0A 3NSUA 4PNKA 2DHIA 2P8VA 2LYDA 3OHMB 3LJUX 2NZ8B 5CLLB 1BTKA 3BJIA 3V5WA 5EFXA 4EJNA 1P6SA 1X86A 3ZVRA 4A5KA 3UZTA 3KZ1A 1KI1B 1DDWA 3WA0A 5CLQB 2ROZB 1GC6A 1P3RA 3D8EA 2UZRA 5JP4A 4WVFB 4WSFA 4HDOA 3FVCA 1LB1A 1BAKA 5C6RA 2ROVA 4A6FA 1NU2A 1X1GA 4Y94A 2DKQA 2E2XA 4F7HA 3OANA 3KSYA 2EC1A 2VRWB 3TFMA 4ZRIA 2Z0PA 1XCGA 1ZSQA 2DKPA 4K81A 1FB8A 2UZSA 4KAXB 4KHBB 5DHAB 1N3HA 1OY2A 1Q67A 3U7DA 4K2PA 1MPHA 1WJ1A 4A6FB 1BTNA 1W1GA 4CYEA 4F7GA 1FGZA 1W1DA 1SGHA 2ADZA 1EF1A 1XKEA 1EVHA 5FI0A 1FAOA 1WGQA 4L1RA 1ZC3B 2GCJA 5L81A 3NWDA 1DYNA 1T77A 1WG7A 2DHKA 2ZKMX 1V88A 3A58A 4Z2NA 2YS3A 3DCXA 5KCVA 2AL6A 3FM8C 5HE3A 2FJLA 2DHJA 1H4RA 5HE2A 1V5PA 2HTHB 4GXBA 2J59M 2KUPA 2QKLA 4D0NB 4A6KA 1Y19B 1PLSA 5J3QA 2ELBA 4K2OA 1ZYIA 2I5FA 3HSAA 2IFSA 5LG4B 2K00A 2P0HA 3PEGA 5C79A 1MAIA 2DX5A 2VKIA 2M14A 5JLJB 2R0DA 2W2WA 3F5RA 1PFJA 3A98B 2YT2A 2Z13A 1IRSA 1U5GA 3QWMA 4CHMA 1TQZA 2NBVA 1BWNA 4PQ0A 4ZRKA 2NMBA 5JHHA 3KRWA 5KQ1A 1U5FA 5HE0A 2DX1A 4GNKB 2CY4A 1KZGA 3ODXA 3MPXA 3ULCA 4GOUA 2RVBB 1MK7B 5C5BB 3AU4A 2RRFA 2VSZA 1RRPB 4B6HA 5KQ4A 2UVMA 3BINA 4K17A 2Z0OA 3AJ4A 1J19A 2RGNB 1MI1A 3MDBC 3QIJA 4OT1A 5J3TA 2KUQA 4CHJA 1U5EA 1AWEA 2Z14A 5DH9B 1LW3A 5DI9B 5LOPB 4GPTB 2KCJA 3HK0A 3TVVA 3FEHA 1EGXA 4QJ5B 2P0DA 3ULBA 2QKMA 4DIXA 1UNQA 1U2BA 3TCAA 4IAPA 5IRSA 1DBHA 1DROA 1MIXA 4H8SA 5GOWB 4DXAB 2DN6A 2GJYA 2DLWA 3QBVB 1PMSA 1UPQA 1X11A 5DIFB 2D11A 2I5CA 2X18A 2EMSA 2YVCA 2Y8GA 2COCA 2CAYA 4GN1A 3CXBB 3A8QA 5D27A 4TYZA 1V5MA 3DXDA 2P0FA 4HB3B 2D9VA 2L1CA 1DDMA 4QXAB 3A8PA 3PVUA 4NY0A 3NWFA 2Z4DA 3PVWA 2MFQA 2LOZA 5C5BA 1MIZB 3O96A 5DHFB 2BCJA 1X05A 1U5DA 2YS5A 2D9XA 2CRFA 3U12A 2D10A 2YS1A 2DYQA 4EKUA 2RNRB 5HE1A 1ISNA 3ZDTA 4DX90 4Z2MB 2KIGA 2GCLA 4BBKA 2Z59A 4C0AA 4QJ4B 1FOEA 1XR0B 2LULA 1SHCA 2AEHA 3TW1A 4HHVA 3KRXA 4ZRJA 2J0MA 1UNPA 5D3WA 4HDQA 2K49A 2RLOA 3HIEA 4HATB 4IFSA 1WGUA 2D9WA 3PG7A 5JHGA 3N7CA 2MDXA 2H7EA 4NSWA 5C16A 2Y8FA 1M7EA 4L6EA 1J0WA 1WVHA 1XODA 3PVLA 2COAA 1GG3A 3VIAA 2I1KA 4YL8A 1GC7A 3VOQA 1NI2A 2KIEA 2RUKB 2J0KA 1NTVA 2LG1A 4HAZB 2OQBA 1Z87A 4HAVB 1U27A 3SUZA 2MWNB 4CSQA 1UPRA 1OMWA 4F7UP 2V76A 2FJUB 3D8DA 3D8FA 3AU5A 2L2IA 5M4YB 4HSIA 3IVFA 2D4QA 1I2HA 3X23A 1K5GB 2R09A 3SNHA 2YF0A 4GMXB 1XD4A 3TO1A 3F0WA 2PZ1A 2K2JA 3KY9A 3SYXA 4HAWB 4DBBA 4P7IA 2DTCA 3GYPA 2R2YA 1B55A 3NWAA 4WJ7A 5D3YA 2H7DA 2DFKA 1W1HA 1E5WA 2HE7A 2G35A 4QJ3B 5J3YA 1WI1A 4IOYX 4MT7A 1V61A 4HB2B 1MK9B 4HAUB 3P6AA 1EAZA 1DDVA 4GZUA 1TJ6A 4MK0A 5I2MA 4MY6A 2MKRA 2YSZA 2ZPYA 4HB4B 1KZ7A 1V5UA 2Z0QA 3FSSA 5I2SA 2W2XC 2LKOA 3B77A 4DX8A 1RJ2A 1FHOA 2CY5A 1X1FA 4KVGB 2ELAA 2W2XD 3G9WA 1AQCA 3WYFB 3ODOA 2Q13A 2D9ZA 3DXCA 1M7RA 2D9YA 2GUMA 4KHBA 1OQNA 1QC6A 1H10A 4A6HA 2D2QA 2K8EA 2I1JA 5FI1A 3SO6A 3M1IB 4OSNA 3HQCA 3PZDA 4EMOA 2GS0A 2KGXB 3HW2B 3GYOA 2EMTA 4KHOA 4D6WA 1ZVRA 1Y5OA 1U29A 3SV1A 5LONB 3NW8A 2CODA 3PP2A 2EJ8A 2COFA 2K2UA 4YONA 4XWXA 2YRYA 3U8ZA 2N0YA 2OTXA 1NTYA 3PSCA 3ML4A 2J0JA 1V89A 1I7AA 3RCPA 1QQGA 4TKNA 1FGYA 1TXDA 2DA0A 1UNRA 1ZM0A 3CIKA 2N23A 5D3VA 2YT0A 2Y7BA 1K5DB 1MKEA 4KHAA 4HB0B 2JP2A
chains in the Genus database with same CATH topology
3ODWA 2RSGA 4HAYB 1UEFA 2DYNA 2IYBA 1ZC4B 1P5TA 5D3XA 4GMVA 3T06A 3DXEA 1FHXA 2M38A 2YT1A 1WJMA 4HAXB 2LOXA 2XQNM 1FHWA 3P7ZA 1XX0A 3NSUA 4PNKA 2DHIA 2P8VA 2LYDA 3LJUX 2NZ8B 5CLLB 1BTKA 3BJIA 3V5WA 5EFXA 4EJNA 1P6SA 1X86A 3ZVRA 4A5KA 3UZTA 3KZ1A 1KI1B 1DDWA 3WA0A 5CLQB 2ROZB 1GC6A 1P3RA 3D8EA 2UZRA 5JP4A 4WVFB 4WSFA 4HDOA 1LB1A 1BAKA 5C6RA 2ROVA 4A6FA 1NU2A 1X1GA 4Y94A 2DKQA 2E2XA 4F7HA 3OANA 3KSYA 2EC1A 2VRWB 3TFMA 4ZRIA 2Z0PA 1XCGA 4K81A 1ZSQA 2DKPA 1FB8A 2UZSA 4KAXB 4KHBB 5DHAB 1N3HA 1OY2A 1Q67A 3U7DA 4K2PA 1MPHA 1WJ1A 4A6FB 1BTNA 1W1GA 4CYEA 4F7GA 1FGZA 1W1DA 1SGHA 2ADZA 1EF1A 1XKEA 1EVHA 5FI0A 1FAOA 1WGQA 1ZC3B 2GCJA 5L81A 1DYNA 1WG7A 2DHKA 1V88A 4Z2NA 2YS3A 5KCVA 2AL6A 3FM8C 5HE3A 2FJLA 2DHJA 1H4RA 5HE2A 1V5PA 2HTHB 4GXBA 2J59M 2KUPA 2QKLA 4D0NB 4A6KA 1Y19B 1PLSA 5J3QA 2ELBA 4K2OA 2I5FA 2IFSA 2K00A 2P0HA 3PEGA 5C79A 1MAIA 2DX5A 2VKIA 2M14A 5JLJB 2R0DA 2W2WA 3F5RA 1PFJA 3A98B 1IRSA 1U5GA 3QWMA 4CHMA 1TQZA 1BWNA 4PQ0A 4ZRKA 2NMBA 5JHHA 3KRWA 5KQ1A 1U5FA 5HE0A 2DX1A 2CY4A 1KZGA 3ODXA 3MPXA 3ULCA 2RVBB 1MK7B 5C5BB 3AU4A 2VSZA 1RRPB 4B6HA 5KQ4A 2UVMA 3BINA 4K17A 2Z0OA 1J19A 3AJ4A 2RGNB 3MDBC 3QIJA 5J3TA 4CHJA 1U5EA 1AWEA 5DH9B 5DI9B 1LW3A 5LOPB 4GPTB 2KCJA 3HK0A 3TVVA 3FEHA 1EGXA 2P0DA 3ULBA 2QKMA 1UNQA 1U2BA 3TCAA 4IAPA 1DBHA 1DROA 1MIXA 4H8SA 5GOWB 4DXAB 2DN6A 2GJYA 2DLWA 3QBVB 1PMSA 1UPQA 1X11A 5DIFB 2D11A 2I5CA 2X18A 2EMSA 2YVCA 2Y8GA 2COCA 2CAYA 4GN1A 3CXBB 3A8QA 5D27A 4TYZA 1V5MA 3DXDA 2P0FA 4HB3B 2D9VA 2L1CA 1DDMA 3A8PA 3PVUA 4NY0A 3PVWA 2MFQA 2LOZA 5C5BA 1MIZB 3O96A 5DHFB 2BCJA 1X05A 1U5DA 2YS5A 2D9XA 2CRFA 2D10A 2YS1A 2DYQA 4EKUA 2RNRB 5HE1A 1ISNA 3ZDTA 4DX90 4Z2MB 2GCLA 4BBKA 4C0AA 1FOEA 1XR0B 2LULA 1SHCA 2AEHA 3TW1A 4HHVA 3KRXA 4ZRJA 2J0MA 1UNPA 5D3WA 4HDQA 2RLOA 4HATB 4IFSA 1WGUA 2D9WA 3PG7A 5JHGA 3N7CA 2MDXA 2H7EA 4NSWA 5C16A 2Y8FA 1M7EA 4L6EA 1J0WA 1WVHA 1XODA 3PVLA 2COAA 1GG3A 3VIAA 2I1KA 4YL8A 1GC7A 3VOQA 1NI2A 2RUKB 2J0KA 1NTVA 2LG1A 4HAZB 2OQBA 1Z87A 4HAVB 1U27A 3SUZA 2MWNB 1UPRA 1OMWA 4F7UP 2V76A 3D8DA 3D8FA 3AU5A 2L2IA 3IVFA 2D4QA 1I2HA 3X23A 1K5GB 2R09A 3SNHA 2YF0A 4GMXB 1XD4A 3TO1A 3F0WA 2PZ1A 2K2JA 3KY9A 3SYXA 4HAWB 4DBBA 4P7IA 2DTCA 3GYPA 1B55A 4WJ7A 5D3YA 2H7DA 2DFKA 1W1HA 1E5WA 2HE7A 2G35A 5J3YA 1WI1A 4IOYX 4MT7A 1V61A 4HB2B 1MK9B 4HAUB 3P6AA 1EAZA 1DDVA 4GZUA 1TJ6A 4MK0A 4MY6A 2MKRA 2YSZA 2ZPYA 4HB4B 1KZ7A 1V5UA 2Z0QA 3FSSA 2W2XC 2LKOA 4DX8A 1RJ2A 1FHOA 2CY5A 1X1FA 4KVGB 2ELAA 2W2XD 3G9WA 1AQCA 3WYFB 3ODOA 2Q13A 2D9ZA 3DXCA 1M7RA 2D9YA 1OQNA 1QC6A 1H10A 4A6HA 2D2QA 2I1JA 5FI1A 3SO6A 3M1IB 3HQCA 3PZDA 4EMOA 2GS0A 2KGXB 3HW2B 3GYOA 2EMTA 4KHOA 1ZVRA 1Y5OA 1U29A 3SV1A 5LONB 2CODA 3PP2A 2EJ8A 2COFA 2K2UA 4YONA 4XWXA 2YRYA 3U8ZA 2N0YA 2OTXA 1NTYA 3PSCA 3ML4A 2J0JA 1V89A 1I7AA 3RCPA 1QQGA 4TKNA 1FGYA 1TXDA 2DA0A 1UNRA 1ZM0A 3CIKA 2N23A 5D3VA 2YT0A 2Y7BA 1K5DB 1MKEA 4KHAA 4HB0B 2JP2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ODW A;  2RSG A;  4HAY B;  1UEF A;  2DYN A;  2IYB A;  1ZC4 B;  1P5T A;  5D3X A;  4GMV A;  3T06 A;  3DXE A;  1FHX A;  2M38 A;  2YT1 A;  1WJM A;  4HAX B;  2LOX A;  2XQN M;  1FHW A;  3P7Z A;  1XX0 A;  3NSU A;  4PNK A;  2DHI A;  2P8V A;  2LYD A;  3LJU X;  2NZ8 B;  5CLL B;  1BTK A;  3BJI A;  3V5W A;  5EFX A;  4EJN A;  1P6S A;  1X86 A;  3ZVR A;  4A5K A;  3UZT A;  3KZ1 A;  1KI1 B;  1DDW A;  3WA0 A;  5CLQ B;  2ROZ B;  1GC6 A;  1P3R A;  3D8E A;  2UZR A;  5JP4 A;  4WVF B;  4WSF A;  4HDO A;  1LB1 A;  1BAK A;  5C6R A;  2ROV A;  4A6F A;  1NU2 A;  1X1G A;  4Y94 A;  2DKQ A;  2E2X A;  4F7H A;  3OAN A;  3KSY A;  2EC1 A;  2VRW B;  3TFM A;  4ZRI A;  2Z0P A;  1XCG A;  4K81 A;  1ZSQ A;  2DKP A;  1FB8 A;  2UZS A;  4KAX B;  4KHB B;  5DHA B;  1N3H A;  1OY2 A;  1Q67 A;  3U7D A;  4K2P A;  1MPH A;  1WJ1 A;  4A6F B;  1BTN A;  1W1G A;  4CYE A;  4F7G A;  1FGZ A;  1W1D A;  1SGH A;  2ADZ A;  1EF1 A;  1XKE A;  1EVH A;  5FI0 A;  1FAO A;  1WGQ A;  1ZC3 B;  2GCJ A;  5L81 A;  1DYN A;  1WG7 A;  2DHK A;  1V88 A;  4Z2N A;  2YS3 A;  5KCV A;  2AL6 A;  3FM8 C;  5HE3 A;  2FJL A;  2DHJ A;  1H4R A;  5HE2 A;  1V5P A;  2HTH B;  4GXB A;  2J59 M;  2KUP A;  2QKL A;  4D0N B;  4A6K A;  1Y19 B;  1PLS A;  5J3Q A;  2ELB A;  4K2O A;  2I5F A;  2IFS A;  2K00 A;  2P0H A;  3PEG A;  5C79 A;  1MAI A;  2DX5 A;  2VKI A;  2M14 A;  5JLJ B;  2R0D A;  2W2W A;  3F5R A;  1PFJ A;  3A98 B;  1IRS A;  1U5G A;  3QWM A;  4CHM A;  1TQZ A;  1BWN A;  4PQ0 A;  4ZRK A;  2NMB A;  5JHH A;  3KRW A;  5KQ1 A;  1U5F A;  5HE0 A;  2DX1 A;  2CY4 A;  1KZG A;  3ODX A;  3MPX A;  3ULC A;  2RVB B;  1MK7 B;  5C5B B;  3AU4 A;  2VSZ A;  1RRP B;  4B6H A;  5KQ4 A;  2UVM A;  3BIN A;  4K17 A;  2Z0O A;  1J19 A;  3AJ4 A;  2RGN B;  3MDB C;  3QIJ A;  5J3T A;  4CHJ A;  1U5E A;  1AWE A;  5DH9 B;  5DI9 B;  1LW3 A;  5LOP B;  4GPT B;  2KCJ A;  3HK0 A;  3TVV A;  3FEH A;  1EGX A;  2P0D A;  3ULB A;  2QKM A;  1UNQ A;  1U2B A;  3TCA A;  4IAP A;  1DBH A;  1DRO A;  1MIX A;  4H8S A;  5GOW B;  4DXA B;  2DN6 A;  2GJY A;  2DLW A;  3QBV B;  1PMS A;  1UPQ A;  1X11 A;  5DIF B;  2D11 A;  2I5C A;  2X18 A;  2EMS A;  2YVC A;  2Y8G A;  2COC A;  2CAY A;  4GN1 A;  3CXB B;  3A8Q A;  5D27 A;  4TYZ A;  1V5M A;  3DXD A;  2P0F A;  4HB3 B;  2D9V A;  2L1C A;  1DDM A;  3A8P A;  3PVU A;  4NY0 A;  3PVW A;  2MFQ A;  2LOZ A;  5C5B A;  1MIZ B;  3O96 A;  5DHF B;  2BCJ A;  1X05 A;  1U5D A;  2YS5 A;  2D9X A;  2CRF A;  2D10 A;  2YS1 A;  2DYQ A;  4EKU A;  2RNR B;  5HE1 A;  1ISN A;  3ZDT A;  4DX9 0;  4Z2M B;  2GCL A;  4BBK A;  4C0A A;  1FOE A;  1XR0 B;  2LUL A;  1SHC A;  2AEH A;  3TW1 A;  4HHV A;  3KRX A;  4ZRJ A;  2J0M A;  1UNP A;  5D3W A;  4HDQ A;  2RLO A;  4HAT B;  4IFS A;  1WGU A;  2D9W A;  3PG7 A;  5JHG A;  3N7C A;  2MDX A;  2H7E A;  4NSW A;  5C16 A;  2Y8F A;  1M7E A;  4L6E A;  1J0W A;  1WVH A;  1XOD A;  3PVL A;  2COA A;  1GG3 A;  3VIA A;  2I1K A;  4YL8 A;  1GC7 A;  3VOQ A;  1NI2 A;  2RUK B;  2J0K A;  1NTV A;  2LG1 A;  4HAZ B;  2OQB A;  1Z87 A;  4HAV B;  1U27 A;  3SUZ A;  2MWN B;  1UPR A;  1OMW A;  4F7U P;  2V76 A;  3D8D A;  3D8F A;  3AU5 A;  2L2I A;  3IVF A;  2D4Q A;  1I2H A;  3X23 A;  1K5G B;  2R09 A;  3SNH A;  2YF0 A;  4GMX B;  1XD4 A;  3TO1 A;  3F0W A;  2PZ1 A;  2K2J A;  3KY9 A;  3SYX A;  4HAW B;  4DBB A;  4P7I A;  2DTC A;  3GYP A;  1B55 A;  4WJ7 A;  5D3Y A;  2H7D A;  2DFK A;  1W1H A;  1E5W A;  2HE7 A;  2G35 A;  5J3Y A;  1WI1 A;  4IOY X;  4MT7 A;  1V61 A;  4HB2 B;  1MK9 B;  4HAU B;  3P6A A;  1EAZ A;  1DDV A;  4GZU A;  1TJ6 A;  4MK0 A;  4MY6 A;  2MKR A;  2YSZ A;  2ZPY A;  4HB4 B;  1KZ7 A;  1V5U A;  2Z0Q A;  3FSS A;  2W2X C;  2LKO A;  4DX8 A;  1RJ2 A;  1FHO A;  2CY5 A;  1X1F A;  4KVG B;  2ELA A;  2W2X D;  3G9W A;  1AQC A;  3WYF B;  3ODO A;  2Q13 A;  2D9Z A;  3DXC A;  1M7R A;  2D9Y A;  1OQN A;  1QC6 A;  1H10 A;  4A6H A;  2D2Q A;  2I1J A;  5FI1 A;  3SO6 A;  3M1I B;  3HQC A;  3PZD A;  4EMO A;  2GS0 A;  2KGX B;  3HW2 B;  3GYO A;  2EMT A;  4KHO A;  1ZVR A;  1Y5O A;  1U29 A;  3SV1 A;  5LON B;  2COD A;  3PP2 A;  2EJ8 A;  2COF A;  2K2U A;  4YON A;  4XWX A;  2YRY A;  3U8Z A;  2N0Y A;  2OTX A;  1NTY A;  3PSC A;  3ML4 A;  2J0J A;  1V89 A;  1I7A A;  3RCP A;  1QQG A;  4TKN A;  1FGY A;  1TXD A;  2DA0 A;  1UNR A;  1ZM0 A;  3CIK A;  2N23 A;  5D3V A;  2YT0 A;  2Y7B A;  1K5D B;  1MKE A;  4KHA A;  4HB0 B;  2JP2 A; 
#chains in the Genus database with same CATH topology
 3ODW A;  2RSG A;  4HAY B;  1UEF A;  2DYN A;  2IYB A;  1ZC4 B;  1P5T A;  5D3X A;  4GMV A;  3T06 A;  3DXE A;  1FHX A;  2M38 A;  2YT1 A;  1WJM A;  4HAX B;  2KR0 A;  2LOX A;  2XQN M;  1FHW A;  3P7Z A;  1XX0 A;  3NSU A;  4PNK A;  2DHI A;  2P8V A;  2LYD A;  3OHM B;  3LJU X;  2NZ8 B;  5CLL B;  1BTK A;  3BJI A;  3V5W A;  5EFX A;  4EJN A;  1P6S A;  1X86 A;  3ZVR A;  4A5K A;  3UZT A;  3KZ1 A;  1KI1 B;  1DDW A;  3WA0 A;  5CLQ B;  2ROZ B;  1GC6 A;  1P3R A;  3D8E A;  2UZR A;  5JP4 A;  4WVF B;  4WSF A;  4HDO A;  3FVC A;  1LB1 A;  1BAK A;  5C6R A;  2ROV A;  4A6F A;  1NU2 A;  1X1G A;  4Y94 A;  2DKQ A;  2E2X A;  4F7H A;  3OAN A;  3KSY A;  2EC1 A;  2VRW B;  3TFM A;  4ZRI A;  2Z0P A;  1XCG A;  1ZSQ A;  2DKP A;  4K81 A;  1FB8 A;  2UZS A;  4KAX B;  4KHB B;  5DHA B;  1N3H A;  1OY2 A;  1Q67 A;  3U7D A;  4K2P A;  1MPH A;  1WJ1 A;  4A6F B;  1BTN A;  1W1G A;  4CYE A;  4F7G A;  1FGZ A;  1W1D A;  1SGH A;  2ADZ A;  1EF1 A;  1XKE A;  1EVH A;  5FI0 A;  1FAO A;  1WGQ A;  4L1R A;  1ZC3 B;  2GCJ A;  5L81 A;  3NWD A;  1DYN A;  1T77 A;  1WG7 A;  2DHK A;  2ZKM X;  1V88 A;  3A58 A;  4Z2N A;  2YS3 A;  3DCX A;  5KCV A;  2AL6 A;  3FM8 C;  5HE3 A;  2FJL A;  2DHJ A;  1H4R A;  5HE2 A;  1V5P A;  2HTH B;  4GXB A;  2J59 M;  2KUP A;  2QKL A;  4D0N B;  4A6K A;  1Y19 B;  1PLS A;  5J3Q A;  2ELB A;  4K2O A;  1ZYI A;  2I5F A;  3HSA A;  2IFS A;  5LG4 B;  2K00 A;  2P0H A;  3PEG A;  5C79 A;  1MAI A;  2DX5 A;  2VKI A;  2M14 A;  5JLJ B;  2R0D A;  2W2W A;  3F5R A;  1PFJ A;  3A98 B;  2YT2 A;  2Z13 A;  1IRS A;  1U5G A;  3QWM A;  4CHM A;  1TQZ A;  2NBV A;  1BWN A;  4PQ0 A;  4ZRK A;  2NMB A;  5JHH A;  3KRW A;  5KQ1 A;  1U5F A;  5HE0 A;  2DX1 A;  4GNK B;  2CY4 A;  1KZG A;  3ODX A;  3MPX A;  3ULC A;  4GOU A;  2RVB B;  1MK7 B;  5C5B B;  3AU4 A;  2RRF A;  2VSZ A;  1RRP B;  4B6H A;  5KQ4 A;  2UVM A;  3BIN A;  4K17 A;  2Z0O A;  3AJ4 A;  1J19 A;  2RGN B;  1MI1 A;  3MDB C;  3QIJ A;  4OT1 A;  5J3T A;  2KUQ A;  4CHJ A;  1U5E A;  1AWE A;  2Z14 A;  5DH9 B;  1LW3 A;  5DI9 B;  5LOP B;  4GPT B;  2KCJ A;  3HK0 A;  3TVV A;  3FEH A;  1EGX A;  4QJ5 B;  2P0D A;  3ULB A;  2QKM A;  4DIX A;  1UNQ A;  1U2B A;  3TCA A;  4IAP A;  5IRS A;  1DBH A;  1DRO A;  1MIX A;  4H8S A;  5GOW B;  4DXA B;  2DN6 A;  2GJY A;  2DLW A;  3QBV B;  1PMS A;  1UPQ A;  1X11 A;  5DIF B;  2D11 A;  2I5C A;  2X18 A;  2EMS A;  2YVC A;  2Y8G A;  2COC A;  2CAY A;  4GN1 A;  3CXB B;  3A8Q A;  5D27 A;  4TYZ A;  1V5M A;  3DXD A;  2P0F A;  4HB3 B;  2D9V A;  2L1C A;  1DDM A;  4QXA B;  3A8P A;  3PVU A;  4NY0 A;  3NWF A;  2Z4D A;  3PVW A;  2MFQ A;  2LOZ A;  5C5B A;  1MIZ B;  3O96 A;  5DHF B;  2BCJ A;  1X05 A;  1U5D A;  2YS5 A;  2D9X A;  2CRF A;  3U12 A;  2D10 A;  2YS1 A;  2DYQ A;  4EKU A;  2RNR B;  5HE1 A;  1ISN A;  3ZDT A;  4DX9 0;  4Z2M B;  2KIG A;  2GCL A;  4BBK A;  2Z59 A;  4C0A A;  4QJ4 B;  1FOE A;  1XR0 B;  2LUL A;  1SHC A;  2AEH A;  3TW1 A;  4HHV A;  3KRX A;  4ZRJ A;  2J0M A;  1UNP A;  5D3W A;  4HDQ A;  2K49 A;  2RLO A;  3HIE A;  4HAT B;  4IFS A;  1WGU A;  2D9W A;  3PG7 A;  5JHG A;  3N7C A;  2MDX A;  2H7E A;  4NSW A;  5C16 A;  2Y8F A;  1M7E A;  4L6E A;  1J0W A;  1WVH A;  1XOD A;  3PVL A;  2COA A;  1GG3 A;  3VIA A;  2I1K A;  4YL8 A;  1GC7 A;  3VOQ A;  1NI2 A;  2KIE A;  2RUK B;  2J0K A;  1NTV A;  2LG1 A;  4HAZ B;  2OQB A;  1Z87 A;  4HAV B;  1U27 A;  3SUZ A;  2MWN B;  4CSQ A;  1UPR A;  1OMW A;  4F7U P;  2V76 A;  2FJU B;  3D8D A;  3D8F A;  3AU5 A;  2L2I A;  5M4Y B;  4HSI A;  3IVF A;  2D4Q A;  1I2H A;  3X23 A;  1K5G B;  2R09 A;  3SNH A;  2YF0 A;  4GMX B;  1XD4 A;  3TO1 A;  3F0W A;  2PZ1 A;  2K2J A;  3KY9 A;  3SYX A;  4HAW B;  4DBB A;  4P7I A;  2DTC A;  3GYP A;  2R2Y A;  1B55 A;  3NWA A;  4WJ7 A;  5D3Y A;  2H7D A;  2DFK A;  1W1H A;  1E5W A;  2HE7 A;  2G35 A;  4QJ3 B;  5J3Y A;  1WI1 A;  4IOY X;  4MT7 A;  1V61 A;  4HB2 B;  1MK9 B;  4HAU B;  3P6A A;  1EAZ A;  1DDV A;  4GZU A;  1TJ6 A;  4MK0 A;  5I2M A;  4MY6 A;  2MKR A;  2YSZ A;  2ZPY A;  4HB4 B;  1KZ7 A;  1V5U A;  2Z0Q A;  3FSS A;  5I2S A;  2W2X C;  2LKO A;  3B77 A;  4DX8 A;  1RJ2 A;  1FHO A;  2CY5 A;  1X1F A;  4KVG B;  2ELA A;  2W2X D;  3G9W A;  1AQC A;  3WYF B;  3ODO A;  2Q13 A;  2D9Z A;  3DXC A;  1M7R A;  2D9Y A;  2GUM A;  4KHB A;  1OQN A;  1QC6 A;  1H10 A;  4A6H A;  2D2Q A;  2K8E A;  2I1J A;  5FI1 A;  3SO6 A;  3M1I B;  4OSN A;  3HQC A;  3PZD A;  4EMO A;  2GS0 A;  2KGX B;  3HW2 B;  3GYO A;  2EMT A;  4KHO A;  4D6W A;  1ZVR A;  1Y5O A;  1U29 A;  3SV1 A;  5LON B;  3NW8 A;  2COD A;  3PP2 A;  2EJ8 A;  2COF A;  2K2U A;  4YON A;  4XWX A;  2YRY A;  3U8Z A;  2N0Y A;  2OTX A;  1NTY A;  3PSC A;  3ML4 A;  2J0J A;  1V89 A;  1I7A A;  3RCP A;  1QQG A;  4TKN A;  1FGY A;  1TXD A;  2DA0 A;  1UNR A;  1ZM0 A;  3CIK A;  2N23 A;  5D3V A;  2YT0 A;  2Y7B A;  1K5D B;  1MKE A;  4KHA A;  4HB0 B;  2JP2 A; 
#chains in the Genus database with same CATH homology
 3ODW A;  2RSG A;  4HAY B;  1UEF A;  2DYN A;  2IYB A;  1ZC4 B;  1P5T A;  5D3X A;  4GMV A;  3T06 A;  3DXE A;  1FHX A;  2M38 A;  2YT1 A;  1WJM A;  4HAX B;  2LOX A;  2XQN M;  1FHW A;  3P7Z A;  1XX0 A;  3NSU A;  4PNK A;  2DHI A;  2P8V A;  2LYD A;  3LJU X;  2NZ8 B;  5CLL B;  1BTK A;  3BJI A;  3V5W A;  5EFX A;  4EJN A;  1P6S A;  1X86 A;  3ZVR A;  4A5K A;  3UZT A;  3KZ1 A;  1KI1 B;  1DDW A;  3WA0 A;  5CLQ B;  2ROZ B;  1GC6 A;  1P3R A;  3D8E A;  2UZR A;  5JP4 A;  4WVF B;  4WSF A;  4HDO A;  1LB1 A;  1BAK A;  5C6R A;  2ROV A;  4A6F A;  1NU2 A;  1X1G A;  4Y94 A;  2DKQ A;  2E2X A;  4F7H A;  3OAN A;  3KSY A;  2EC1 A;  2VRW B;  3TFM A;  4ZRI A;  2Z0P A;  1XCG A;  4K81 A;  1ZSQ A;  2DKP A;  1FB8 A;  2UZS A;  4KAX B;  4KHB B;  5DHA B;  1N3H A;  1OY2 A;  1Q67 A;  3U7D A;  4K2P A;  1MPH A;  1WJ1 A;  4A6F B;  1BTN A;  1W1G A;  4CYE A;  4F7G A;  1FGZ A;  1W1D A;  1SGH A;  2ADZ A;  1EF1 A;  1XKE A;  1EVH A;  5FI0 A;  1FAO A;  1WGQ A;  1ZC3 B;  2GCJ A;  5L81 A;  1DYN A;  1WG7 A;  2DHK A;  1V88 A;  4Z2N A;  2YS3 A;  5KCV A;  2AL6 A;  3FM8 C;  5HE3 A;  2FJL A;  2DHJ A;  1H4R A;  5HE2 A;  1V5P A;  2HTH B;  4GXB A;  2J59 M;  2KUP A;  2QKL A;  4D0N B;  4A6K A;  1Y19 B;  1PLS A;  5J3Q A;  2ELB A;  4K2O A;  2I5F A;  2IFS A;  2K00 A;  2P0H A;  3PEG A;  5C79 A;  1MAI A;  2DX5 A;  2VKI A;  2M14 A;  5JLJ B;  2R0D A;  2W2W A;  3F5R A;  1PFJ A;  3A98 B;  1IRS A;  1U5G A;  3QWM A;  4CHM A;  1TQZ A;  1BWN A;  4PQ0 A;  4ZRK A;  2NMB A;  5JHH A;  3KRW A;  5KQ1 A;  1U5F A;  5HE0 A;  2DX1 A;  2CY4 A;  1KZG A;  3ODX A;  3MPX A;  3ULC A;  2RVB B;  1MK7 B;  5C5B B;  3AU4 A;  2VSZ A;  1RRP B;  4B6H A;  5KQ4 A;  2UVM A;  3BIN A;  4K17 A;  2Z0O A;  1J19 A;  3AJ4 A;  2RGN B;  3MDB C;  3QIJ A;  5J3T A;  4CHJ A;  1U5E A;  1AWE A;  5DH9 B;  5DI9 B;  1LW3 A;  5LOP B;  4GPT B;  2KCJ A;  3HK0 A;  3TVV A;  3FEH A;  1EGX A;  2P0D A;  3ULB A;  2QKM A;  1UNQ A;  1U2B A;  3TCA A;  4IAP A;  1DBH A;  1DRO A;  1MIX A;  4H8S A;  5GOW B;  4DXA B;  2DN6 A;  2GJY A;  2DLW A;  3QBV B;  1PMS A;  1UPQ A;  1X11 A;  5DIF B;  2D11 A;  2I5C A;  2X18 A;  2EMS A;  2YVC A;  2Y8G A;  2COC A;  2CAY A;  4GN1 A;  3CXB B;  3A8Q A;  5D27 A;  4TYZ A;  1V5M A;  3DXD A;  2P0F A;  4HB3 B;  2D9V A;  2L1C A;  1DDM A;  3A8P A;  3PVU A;  4NY0 A;  3PVW A;  2MFQ A;  2LOZ A;  5C5B A;  1MIZ B;  3O96 A;  5DHF B;  2BCJ A;  1X05 A;  1U5D A;  2YS5 A;  2D9X A;  2CRF A;  2D10 A;  2YS1 A;  2DYQ A;  4EKU A;  2RNR B;  5HE1 A;  1ISN A;  3ZDT A;  4DX9 0;  4Z2M B;  2GCL A;  4BBK A;  4C0A A;  1FOE A;  1XR0 B;  2LUL A;  1SHC A;  2AEH A;  3TW1 A;  4HHV A;  3KRX A;  4ZRJ A;  2J0M A;  1UNP A;  5D3W A;  4HDQ A;  2RLO A;  4HAT B;  4IFS A;  1WGU A;  2D9W A;  3PG7 A;  5JHG A;  3N7C A;  2MDX A;  2H7E A;  4NSW A;  5C16 A;  2Y8F A;  1M7E A;  4L6E A;  1J0W A;  1WVH A;  1XOD A;  3PVL A;  2COA A;  1GG3 A;  3VIA A;  2I1K A;  4YL8 A;  1GC7 A;  3VOQ A;  1NI2 A;  2RUK B;  2J0K A;  1NTV A;  2LG1 A;  4HAZ B;  2OQB A;  1Z87 A;  4HAV B;  1U27 A;  3SUZ A;  2MWN B;  1UPR A;  1OMW A;  4F7U P;  2V76 A;  3D8D A;  3D8F A;  3AU5 A;  2L2I A;  3IVF A;  2D4Q A;  1I2H A;  3X23 A;  1K5G B;  2R09 A;  3SNH A;  2YF0 A;  4GMX B;  1XD4 A;  3TO1 A;  3F0W A;  2PZ1 A;  2K2J A;  3KY9 A;  3SYX A;  4HAW B;  4DBB A;  4P7I A;  2DTC A;  3GYP A;  1B55 A;  4WJ7 A;  5D3Y A;  2H7D A;  2DFK A;  1W1H A;  1E5W A;  2HE7 A;  2G35 A;  5J3Y A;  1WI1 A;  4IOY X;  4MT7 A;  1V61 A;  4HB2 B;  1MK9 B;  4HAU B;  3P6A A;  1EAZ A;  1DDV A;  4GZU A;  1TJ6 A;  4MK0 A;  4MY6 A;  2MKR A;  2YSZ A;  2ZPY A;  4HB4 B;  1KZ7 A;  1V5U A;  2Z0Q A;  3FSS A;  2W2X C;  2LKO A;  4DX8 A;  1RJ2 A;  1FHO A;  2CY5 A;  1X1F A;  4KVG B;  2ELA A;  2W2X D;  3G9W A;  1AQC A;  3WYF B;  3ODO A;  2Q13 A;  2D9Z A;  3DXC A;  1M7R A;  2D9Y A;  1OQN A;  1QC6 A;  1H10 A;  4A6H A;  2D2Q A;  2I1J A;  5FI1 A;  3SO6 A;  3M1I B;  3HQC A;  3PZD A;  4EMO A;  2GS0 A;  2KGX B;  3HW2 B;  3GYO A;  2EMT A;  4KHO A;  1ZVR A;  1Y5O A;  1U29 A;  3SV1 A;  5LON B;  2COD A;  3PP2 A;  2EJ8 A;  2COF A;  2K2U A;  4YON A;  4XWX A;  2YRY A;  3U8Z A;  2N0Y A;  2OTX A;  1NTY A;  3PSC A;  3ML4 A;  2J0J A;  1V89 A;  1I7A A;  3RCP A;  1QQG A;  4TKN A;  1FGY A;  1TXD A;  2DA0 A;  1UNR A;  1ZM0 A;  3CIK A;  2N23 A;  5D3V A;  2YT0 A;  2Y7B A;  1K5D B;  1MKE A;  4KHA A;  4HB0 B;  2JP2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...