1AQCA

X11 ptb domain-10mer peptide complex
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
166
structure length
130
Chain Sequence
MEDLIDGIIFAANYLGSTQLLSDKTPSKNVRMMQAQEAVSRIKMAQKLMTEVDLFILTQRIKVLNADTQETMMDHPLRTISYIADIGNIVVLMARRRYKMICHVFESEDAQLIAQSIGQAFSVAYQEFLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords X11
publication title Sequence-specific recognition of the internalization motif of the Alzheimer's amyloid precursor protein by the X11 PTB domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Complex (peptide binding module/peptide)
total genus 30
structure length 130
sequence length 166
chains with identical sequence B
ec nomenclature
pdb deposition date 1997-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00640 PID Phosphotyrosine interaction domain (PTB/PID)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1aqcA00
3TFMA 2Y8GA 5C5BA 2AL6A 3V5WA 4HHVA 2DFKA 4XWXA 4F7HA 1BTKA 1FAOA 4CHMA 2MKRA 2L1CA 1FGYA 1V5UA 1SHCA 4HB0B 1PLSA 2GCLA 1OY2A 1FHOA 1WGQA 1UEFA 3MDBC 1MIXA 2YT1A 5D3VA 3SNHA 3X23A 5KQ4A 4K81A 1Y19B 1BWNA 2DHKA 3QIJA 2COFA 2YS3A 1X05A 5CLQB 3P6AA 4KVGB 3GYPA 2D9VA 1XCGA 3F0WA 3DXEA 2D9YA 2I5FA 1UNRA 3KSYA 1GC7A 2OTXA 1EAZA 2DA0A 2ELBA 2NMBA 2YF0A 5C5BB 4D0NB 2W2WA 4NY0A 2N0YA 4HDQA 2LOZA 2Q13A 1WVHA 1NTYA 2LOXA 3SO6A 4HAZB 1U2BA 1OQNA 2VKIA 3KY9A 4A6HA 1UPQA 2DYQA 1NTVA 1AWEA 4GMXB 5CLLB 4HB3B 4HAUB 2K2UA 2D9XA 2EMTA 1WJ1A 2CY5A 2RUKB 2L2IA 3TVVA 4PQ0A 3CIKA 4YONA 3TCAA 1MKEA 3KZ1A 5GOWB 4DX90 1RJ2A 1H4RA 4HAWB 4A6KA 1U29A 2D2QA 2KCJA 3PVUA 3NSUA 4IFSA 1MK9B 3P7ZA 1W1DA 4K2PA 2Y7BA 2YS5A 1DDVA 1IRSA 3FM8C 2H7EA 1MIZB 5FI1A 1XX0A 1DBHA 2RVBB 2ROZB 2Y8FA 3A98B 1V88A 1NU2A 1UPRA 5C79A 2J0JA 4IAPA 2H7DA 1X86A 1BTNA 3F5RA 1V5MA 2Z0QA 4WVFB 3ML4A 2I1KA 2GCJA 3PSCA 4TYZA 4WSFA 1PFJA 4ZRJA 3PP2A 2RLOA 4HB4B 2E2XA 2DTCA 1WGUA 3MPXA 1U5GA 2YVCA 2UZSA 2KGXB 3AU4A 4CHJA 5LONB 2EMSA 4B6HA 4DBBA 5EFXA 4DXAB 1Z87A 2DKPA 4HAYB 3A8PA 3HK0A 3HW2B 4KHOA 4Y94A 2KUPA 3U7DA 5JP4A 3QBVB 5FI0A 2VRWB 3KRXA 4L6EA 4YL8A 1DDWA 2EC1A 1ZM0A 3FSSA 2EJ8A 1GC6A 4PNKA 4C0AA 4KAXB 1ZC4B 4Z2NA 4GMVA 3PEGA 2XQNM 2I5CA 3N7CA 4MK0A 4ZRKA 5C6RA 5L81A 1TJ6A 2YT0A 1BAKA 1MPHA 1M7RA 2N23A 4A6FA 3TW1A 4MY6A 2J59M 3A8QA 3WYFB 3OANA 2MFQA 1J0WA 1NI2A 1Y5OA 1LW3A 2RNRB 5JHGA 2D10A 3M1IB 4K17A 1U27A 1X1FA 2M14A 2JP2A 3RCPA 2GJYA 1P5TA 1UNPA 5DH9B 5DHAB 4DX8A 2M38A 2DHIA 5DHFB 1ZSQA 1FHXA 3VOQA 3ULBA 1X1GA 3DXDA 3TO1A 1U5DA 2CODA 1V61A 1XD4A 4HDOA 3BJIA 2QKLA 3D8EA 5D3WA 4A6FB 2ZPYA 2MWNB 4GXBA 2CAYA 1UNQA 1Q67A 3D8DA 3FEHA 3PG7A 5JHHA 1H10A 2PZ1A 3ODXA 1W1HA 1N3HA 2LG1A 2YSZA 2AEHA 5J3YA 3SYXA 3G9WA 1QQGA 2K2JA 5HE2A 2ROVA 1DROA 2IYBA 3AU5A 1U5FA 1ZC3B 3SV1A 2LKOA 2J0MA 3PVWA 3O96A 2BCJA 2HTHB 4HB2B 2J0KA 1RRPB 2LYDA 3GYOA 1I7AA 3ZDTA 2V76A 1AQCA 1OMWA 1GG3A 5HE3A 4IOYX 3VIAA 1X11A 4HAXB 1FHWA 2COCA 4KHBB 3UZTA 1XODA 2ADZA 4F7UP 1WI1A 5HE0A 2DN6A 1EGXA 1DDMA 1WJMA 1V5PA 2YRYA 3T06A 2CRFA 4BBKA 2D11A 1K5DB 2D9WA 1EVHA 2DX5A 4NSWA 4F7GA 4ZRIA 1J19A 1PMSA 1U5EA 1E5WA 4EKUA 2R09A 2DHJA 1XR0B 2P8VA 2D4QA 5D3YA 1EF1A 3ULCA 2FJLA 1P3RA 3LJUX 4HAVB 3CXBB 2Z0OA 1ISNA 2W2XC 3DXCA 5D27A 5DIFB 1FB8A 1V89A 2RGNB 3WA0A 2CY4A 1SGHA 1FOEA 1I2HA 2K00A 5KQ1A 4KHAA 2RSGA 4GPTB 3U8ZA 1KZ7A 2IFSA 4HATB 1B55A 1XKEA 4TKNA 2P0DA 3SUZA 4GZUA 4CYEA 3BINA 2NZ8B 2GS0A 3PVLA 3ZVRA 2DYNA 5D3XA 4H8SA 5LOPB 2ELAA 1MK7B 4EMOA 4GN1A 4Z2MB 2DX1A 1M7EA 4EJNA 1DYNA 1QC6A 2COAA 1K5GB 1P6SA 5C16A 4MT7A 2UZRA 5HE1A 5JLJB 3KRWA 3PZDA 3HQCA 2P0FA 2MDXA 1TQZA 1FGZA 2HE7A 4WJ7A 5J3TA 2X18A 5DI9B 2VSZA 1KZGA 1LB1A 5J3QA 1KI1B 1WG7A 2DKQA 2OQBA 2D9ZA 2DLWA 1W1GA 4A5KA 1MAIA 4P7IA 3D8FA 2QKMA 2I1JA 2G35A 3QWMA 3AJ4A 2P0HA 2YS1A 3IVFA 4K2OA 2UVMA 2W2XD 3ODOA 1TXDA 2Z0PA 3ODWA 1ZVRA 5KCVA 2LULA 2R0DA
chains in the Genus database with same CATH superfamily
3TFMA 2Y8GA 5C5BA 2AL6A 3V5WA 4HHVA 2DFKA 4XWXA 4F7HA 1BTKA 1FAOA 4CHMA 2MKRA 2L1CA 3HIEA 1FGYA 2FJUB 1V5UA 1SHCA 4HB0B 1PLSA 2GCLA 1OY2A 1FHOA 1WGQA 1UEFA 3MDBC 1MIXA 2YT1A 5D3VA 3SNHA 3X23A 5KQ4A 2YT2A 4K81A 1Y19B 1BWNA 2DHKA 3QIJA 2COFA 2YS3A 1X05A 5CLQB 3P6AA 4KVGB 3GYPA 2D9VA 1XCGA 3F0WA 3DXEA 4OT1A 2D9YA 2I5FA 1UNRA 3KSYA 1GC7A 2OTXA 1EAZA 2DA0A 2ELBA 2NMBA 2YF0A 5C5BB 4D0NB 2W2WA 4NY0A 2N0YA 4HDQA 2LOZA 2Q13A 1MI1A 2LOXA 1WVHA 1NTYA 2KIGA 3SO6A 4HAZB 1U2BA 1OQNA 2VKIA 3KY9A 4A6HA 1UPQA 2DYQA 1NTVA 3A58A 1AWEA 4GMXB 5CLLB 4HB3B 4HAUB 2K2UA 2D9XA 2EMTA 1WJ1A 2CY5A 2RUKB 2L2IA 3TVVA 4PQ0A 3CIKA 4YONA 3TCAA 1MKEA 3KZ1A 4L1RA 5GOWB 4DX90 4CSQA 1RJ2A 2GUMA 1H4RA 4HAWB 4A6KA 1U29A 2D2QA 2KCJA 3PVUA 3NSUA 4IFSA 1MK9B 4KHBA 3P7ZA 1W1DA 4K2PA 5I2MA 2Y7BA 2YS5A 1DDVA 1IRSA 3FM8C 2H7EA 1MIZB 5FI1A 1XX0A 2Z13A 3B77A 1DBHA 2RVBB 2ROZB 4GOUA 2Y8FA 3A98B 1V88A 1NU2A 1UPRA 5C79A 2J0JA 4IAPA 2H7DA 1X86A 1BTNA 3F5RA 1V5MA 2Z0QA 4WVFB 3ML4A 2I1KA 2GCJA 3PSCA 4TYZA 4WSFA 1PFJA 4ZRJA 3PP2A 2RLOA 4HB4B 4OSNA 2E2XA 2DTCA 1WGUA 3MPXA 1U5GA 2YVCA 2UZSA 2KGXB 3AU4A 4CHJA 5LONB 2EMSA 4B6HA 4DBBA 5EFXA 4DXAB 1Z87A 3U12A 2DKPA 4HAYB 3A8PA 3HK0A 3HW2B 4KHOA 4Y94A 2KUPA 3U7DA 5JP4A 3QBVB 5FI0A 2VRWB 1T77A 3KRXA 4L6EA 4YL8A 1DDWA 2EC1A 1ZM0A 3FSSA 2KR0A 2EJ8A 1GC6A 4PNKA 4C0AA 4KAXB 1ZC4B 4Z2NA 2KUQA 4GMVA 3PEGA 2XQNM 2I5CA 3N7CA 4MK0A 4ZRKA 5C6RA 5L81A 1TJ6A 2YT0A 1BAKA 1MPHA 1M7RA 2N23A 4A6FA 4QXAB 3TW1A 4MY6A 2J59M 2Z14A 3A8QA 3WYFB 3OANA 2MFQA 1J0WA 1NI2A 1Y5OA 1LW3A 2RNRB 5JHGA 2D10A 3M1IB 4K17A 1U27A 3FVCA 1X1FA 2M14A 2JP2A 3RCPA 2GJYA 1P5TA 1ZYIA 1UNPA 5DH9B 5DHAB 2R2YA 4DX8A 2M38A 2DHIA 5DHFB 1ZSQA 1FHXA 3VOQA 3ULBA 1X1GA 3DXDA 3TO1A 2Z59A 1U5DA 2CODA 1V61A 1XD4A 4HDOA 3BJIA 2QKLA 3D8EA 5D3WA 4A6FB 2ZPYA 2MWNB 4GXBA 2CAYA 2NBVA 1UNQA 1Q67A 3D8DA 3FEHA 3PG7A 5JHHA 1H10A 2PZ1A 3ODXA 1W1HA 1N3HA 2LG1A 2YSZA 2AEHA 5J3YA 3SYXA 3G9WA 4QJ5B 1QQGA 2K2JA 5HE2A 2ROVA 5IRSA 1DROA 2IYBA 3AU5A 4QJ3B 1U5FA 1ZC3B 3SV1A 2LKOA 2J0MA 3PVWA 3O96A 2BCJA 2HTHB 5LG4B 4HB2B 2J0KA 1RRPB 2ZKMX 2LYDA 3GYOA 1I7AA 3HSAA 3ZDTA 2V76A 1AQCA 2RRFA 1OMWA 1GG3A 5HE3A 4IOYX 3VIAA 2KIEA 1X11A 4HAXB 1FHWA 2COCA 4KHBB 3NWDA 3UZTA 1XODA 2ADZA 4F7UP 1WI1A 5HE0A 2DN6A 3NWAA 1EGXA 1DDMA 1WJMA 1V5PA 2YRYA 3T06A 2CRFA 4BBKA 2D11A 1K5DB 2D9WA 1EVHA 2DX5A 4NSWA 4F7GA 4ZRIA 1J19A 1PMSA 1U5EA 1E5WA 4EKUA 2R09A 2DHJA 1XR0B 2P8VA 2D4QA 5D3YA 1EF1A 4D6WA 3ULCA 2FJLA 1P3RA 3LJUX 4HAVB 3NWFA 3CXBB 4QJ4B 2Z0OA 1ISNA 2W2XC 5I2SA 2K49A 3DXCA 5D27A 5DIFB 1FB8A 1V89A 2RGNB 3WA0A 2CY4A 1SGHA 1FOEA 1I2HA 2K00A 5KQ1A 4KHAA 2RSGA 4GPTB 3U8ZA 1KZ7A 2IFSA 4HATB 1B55A 1XKEA 4TKNA 2P0DA 3SUZA 4GZUA 4CYEA 3BINA 3DCXA 2NZ8B 2GS0A 3PVLA 3ZVRA 2DYNA 5D3XA 4H8SA 5LOPB 2ELAA 3NW8A 1MK7B 4EMOA 4GN1A 4Z2MB 2DX1A 1M7EA 4EJNA 1DYNA 1QC6A 2COAA 1K5GB 1P6SA 5C16A 4MT7A 2UZRA 4DIXA 5HE1A 5JLJB 3KRWA 3PZDA 3HQCA 2P0FA 2MDXA 1TQZA 1FGZA 2HE7A 4WJ7A 5J3TA 2X18A 5DI9B 2VSZA 1KZGA 1LB1A 5J3QA 1KI1B 1WG7A 4HSIA 2DKQA 5M4YB 2OQBA 2D9ZA 2DLWA 1W1GA 4A5KA 1MAIA 2K8EA 4GNKB 4P7IA 3D8FA 2QKMA 3OHMB 2I1JA 2G35A 3QWMA 3AJ4A 2P0HA 2YS1A 3IVFA 4K2OA 2UVMA 2W2XD 3ODOA 1TXDA 2Z0PA 3ODWA 2Z4DA 1ZVRA 5KCVA 2LULA 2R0DA
chains in the Genus database with same CATH topology
3TFMA 2Y8GA 5C5BA 2AL6A 3V5WA 4HHVA 2DFKA 4XWXA 4F7HA 1BTKA 1FAOA 4CHMA 2MKRA 2L1CA 1FGYA 1V5UA 1SHCA 4HB0B 1PLSA 2GCLA 1OY2A 1FHOA 1WGQA 1UEFA 3MDBC 1MIXA 2YT1A 5D3VA 3SNHA 3X23A 5KQ4A 4K81A 1Y19B 1BWNA 2DHKA 3QIJA 2COFA 2YS3A 1X05A 5CLQB 3P6AA 4KVGB 3GYPA 2D9VA 1XCGA 3F0WA 3DXEA 2D9YA 2I5FA 1UNRA 3KSYA 1GC7A 2OTXA 1EAZA 2DA0A 2ELBA 2NMBA 2YF0A 5C5BB 4D0NB 2W2WA 4NY0A 2N0YA 4HDQA 2LOZA 2Q13A 1WVHA 1NTYA 2LOXA 3SO6A 4HAZB 1U2BA 1OQNA 2VKIA 3KY9A 4A6HA 1UPQA 2DYQA 1NTVA 1AWEA 4GMXB 5CLLB 4HB3B 4HAUB 2K2UA 2D9XA 2EMTA 1WJ1A 2CY5A 2RUKB 2L2IA 3TVVA 4PQ0A 3CIKA 4YONA 3TCAA 1MKEA 3KZ1A 5GOWB 4DX90 1RJ2A 1H4RA 4HAWB 4A6KA 1U29A 2D2QA 2KCJA 3PVUA 3NSUA 4IFSA 1MK9B 3P7ZA 1W1DA 4K2PA 2Y7BA 2YS5A 1DDVA 1IRSA 3FM8C 2H7EA 1MIZB 5FI1A 1XX0A 1DBHA 2RVBB 2ROZB 2Y8FA 3A98B 1V88A 1NU2A 1UPRA 5C79A 2J0JA 4IAPA 2H7DA 1X86A 1BTNA 3F5RA 1V5MA 2Z0QA 4WVFB 3ML4A 2I1KA 2GCJA 3PSCA 4TYZA 4WSFA 1PFJA 4ZRJA 3PP2A 2RLOA 4HB4B 2E2XA 2DTCA 1WGUA 3MPXA 1U5GA 2YVCA 2UZSA 2KGXB 3AU4A 4CHJA 5LONB 2EMSA 4B6HA 4DBBA 5EFXA 4DXAB 1Z87A 2DKPA 4HAYB 3A8PA 3HK0A 3HW2B 4KHOA 4Y94A 2KUPA 3U7DA 5JP4A 3QBVB 5FI0A 2VRWB 3KRXA 4L6EA 4YL8A 1DDWA 2EC1A 1ZM0A 3FSSA 2EJ8A 1GC6A 4PNKA 4C0AA 4KAXB 1ZC4B 4Z2NA 4GMVA 3PEGA 2XQNM 2I5CA 3N7CA 4MK0A 4ZRKA 5C6RA 5L81A 1TJ6A 2YT0A 1BAKA 1MPHA 1M7RA 2N23A 4A6FA 3TW1A 4MY6A 2J59M 3A8QA 3WYFB 3OANA 2MFQA 1J0WA 1NI2A 1Y5OA 1LW3A 2RNRB 5JHGA 2D10A 3M1IB 4K17A 1U27A 1X1FA 2M14A 2JP2A 3RCPA 2GJYA 1P5TA 1UNPA 5DH9B 5DHAB 4DX8A 2M38A 2DHIA 5DHFB 1ZSQA 1FHXA 3VOQA 3ULBA 1X1GA 3DXDA 3TO1A 1U5DA 2CODA 1V61A 1XD4A 4HDOA 3BJIA 2QKLA 3D8EA 5D3WA 4A6FB 2ZPYA 2MWNB 4GXBA 2CAYA 1UNQA 1Q67A 3D8DA 3FEHA 3PG7A 5JHHA 1H10A 2PZ1A 3ODXA 1W1HA 1N3HA 2LG1A 2YSZA 2AEHA 5J3YA 3SYXA 3G9WA 1QQGA 2K2JA 5HE2A 2ROVA 1DROA 2IYBA 3AU5A 1U5FA 1ZC3B 3SV1A 2LKOA 2J0MA 3PVWA 3O96A 2BCJA 2HTHB 4HB2B 2J0KA 1RRPB 2LYDA 3GYOA 1I7AA 3ZDTA 2V76A 1AQCA 1OMWA 1GG3A 5HE3A 4IOYX 3VIAA 1X11A 4HAXB 1FHWA 2COCA 4KHBB 3UZTA 1XODA 2ADZA 4F7UP 1WI1A 5HE0A 2DN6A 1EGXA 1DDMA 1WJMA 1V5PA 2YRYA 3T06A 2CRFA 4BBKA 2D11A 1K5DB 2D9WA 1EVHA 2DX5A 4NSWA 4F7GA 4ZRIA 1J19A 1PMSA 1U5EA 1E5WA 4EKUA 2R09A 2DHJA 1XR0B 2P8VA 2D4QA 5D3YA 1EF1A 3ULCA 2FJLA 1P3RA 3LJUX 4HAVB 3CXBB 2Z0OA 1ISNA 2W2XC 3DXCA 5D27A 5DIFB 1FB8A 1V89A 2RGNB 3WA0A 2CY4A 1SGHA 1FOEA 1I2HA 2K00A 5KQ1A 4KHAA 2RSGA 4GPTB 3U8ZA 1KZ7A 2IFSA 4HATB 1B55A 1XKEA 4TKNA 2P0DA 3SUZA 4GZUA 4CYEA 3BINA 2NZ8B 2GS0A 3PVLA 3ZVRA 2DYNA 5D3XA 4H8SA 5LOPB 2ELAA 1MK7B 4EMOA 4GN1A 4Z2MB 2DX1A 1M7EA 4EJNA 1DYNA 1QC6A 2COAA 1K5GB 1P6SA 5C16A 4MT7A 2UZRA 5HE1A 5JLJB 3KRWA 3PZDA 3HQCA 2P0FA 2MDXA 1TQZA 1FGZA 2HE7A 4WJ7A 5J3TA 2X18A 5DI9B 2VSZA 1KZGA 1LB1A 5J3QA 1KI1B 1WG7A 2DKQA 2OQBA 2D9ZA 2DLWA 1W1GA 4A5KA 1MAIA 4P7IA 3D8FA 2QKMA 2I1JA 2G35A 3QWMA 3AJ4A 2P0HA 2YS1A 3IVFA 4K2OA 2UVMA 2W2XD 3ODOA 1TXDA 2Z0PA 3ODWA 1ZVRA 5KCVA 2LULA 2R0DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TFM A;  2Y8G A;  5C5B A;  2AL6 A;  3V5W A;  4HHV A;  2DFK A;  4XWX A;  4F7H A;  1BTK A;  1FAO A;  4CHM A;  2MKR A;  2L1C A;  1FGY A;  1V5U A;  1SHC A;  4HB0 B;  1PLS A;  2GCL A;  1OY2 A;  1FHO A;  1WGQ A;  1UEF A;  3MDB C;  1MIX A;  2YT1 A;  5D3V A;  3SNH A;  3X23 A;  5KQ4 A;  4K81 A;  1Y19 B;  1BWN A;  2DHK A;  3QIJ A;  2COF A;  2YS3 A;  1X05 A;  5CLQ B;  3P6A A;  4KVG B;  3GYP A;  2D9V A;  1XCG A;  3F0W A;  3DXE A;  2D9Y A;  2I5F A;  1UNR A;  3KSY A;  1GC7 A;  2OTX A;  1EAZ A;  2DA0 A;  2ELB A;  2NMB A;  2YF0 A;  5C5B B;  4D0N B;  2W2W A;  4NY0 A;  2N0Y A;  4HDQ A;  2LOZ A;  2Q13 A;  1WVH A;  1NTY A;  2LOX A;  3SO6 A;  4HAZ B;  1U2B A;  1OQN A;  2VKI A;  3KY9 A;  4A6H A;  1UPQ A;  2DYQ A;  1NTV A;  1AWE A;  4GMX B;  5CLL B;  4HB3 B;  4HAU B;  2K2U A;  2D9X A;  2EMT A;  1WJ1 A;  2CY5 A;  2RUK B;  2L2I A;  3TVV A;  4PQ0 A;  3CIK A;  4YON A;  3TCA A;  1MKE A;  3KZ1 A;  5GOW B;  4DX9 0;  1RJ2 A;  1H4R A;  4HAW B;  4A6K A;  1U29 A;  2D2Q A;  2KCJ A;  3PVU A;  3NSU A;  4IFS A;  1MK9 B;  3P7Z A;  1W1D A;  4K2P A;  2Y7B A;  2YS5 A;  1DDV A;  1IRS A;  3FM8 C;  2H7E A;  1MIZ B;  5FI1 A;  1XX0 A;  1DBH A;  2RVB B;  2ROZ B;  2Y8F A;  3A98 B;  1V88 A;  1NU2 A;  1UPR A;  5C79 A;  2J0J A;  4IAP A;  2H7D A;  1X86 A;  1BTN A;  3F5R A;  1V5M A;  2Z0Q A;  4WVF B;  3ML4 A;  2I1K A;  2GCJ A;  3PSC A;  4TYZ A;  4WSF A;  1PFJ A;  4ZRJ A;  3PP2 A;  2RLO A;  4HB4 B;  2E2X A;  2DTC A;  1WGU A;  3MPX A;  1U5G A;  2YVC A;  2UZS A;  2KGX B;  3AU4 A;  4CHJ A;  5LON B;  2EMS A;  4B6H A;  4DBB A;  5EFX A;  4DXA B;  1Z87 A;  2DKP A;  4HAY B;  3A8P A;  3HK0 A;  3HW2 B;  4KHO A;  4Y94 A;  2KUP A;  3U7D A;  5JP4 A;  3QBV B;  5FI0 A;  2VRW B;  3KRX A;  4L6E A;  4YL8 A;  1DDW A;  2EC1 A;  1ZM0 A;  3FSS A;  2EJ8 A;  1GC6 A;  4PNK A;  4C0A A;  4KAX B;  1ZC4 B;  4Z2N A;  4GMV A;  3PEG A;  2XQN M;  2I5C A;  3N7C A;  4MK0 A;  4ZRK A;  5C6R A;  5L81 A;  1TJ6 A;  2YT0 A;  1BAK A;  1MPH A;  1M7R A;  2N23 A;  4A6F A;  3TW1 A;  4MY6 A;  2J59 M;  3A8Q A;  3WYF B;  3OAN A;  2MFQ A;  1J0W A;  1NI2 A;  1Y5O A;  1LW3 A;  2RNR B;  5JHG A;  2D10 A;  3M1I B;  4K17 A;  1U27 A;  1X1F A;  2M14 A;  2JP2 A;  3RCP A;  2GJY A;  1P5T A;  1UNP A;  5DH9 B;  5DHA B;  4DX8 A;  2M38 A;  2DHI A;  5DHF B;  1ZSQ A;  1FHX A;  3VOQ A;  3ULB A;  1X1G A;  3DXD A;  3TO1 A;  1U5D A;  2COD A;  1V61 A;  1XD4 A;  4HDO A;  3BJI A;  2QKL A;  3D8E A;  5D3W A;  4A6F B;  2ZPY A;  2MWN B;  4GXB A;  2CAY A;  1UNQ A;  1Q67 A;  3D8D A;  3FEH A;  3PG7 A;  5JHH A;  1H10 A;  2PZ1 A;  3ODX A;  1W1H A;  1N3H A;  2LG1 A;  2YSZ A;  2AEH A;  5J3Y A;  3SYX A;  3G9W A;  1QQG A;  2K2J A;  5HE2 A;  2ROV A;  1DRO A;  2IYB A;  3AU5 A;  1U5F A;  1ZC3 B;  3SV1 A;  2LKO A;  2J0M A;  3PVW A;  3O96 A;  2BCJ A;  2HTH B;  4HB2 B;  2J0K A;  1RRP B;  2LYD A;  3GYO A;  1I7A A;  3ZDT A;  2V76 A;  1AQC A;  1OMW A;  1GG3 A;  5HE3 A;  4IOY X;  3VIA A;  1X11 A;  4HAX B;  1FHW A;  2COC A;  4KHB B;  3UZT A;  1XOD A;  2ADZ A;  4F7U P;  1WI1 A;  5HE0 A;  2DN6 A;  1EGX A;  1DDM A;  1WJM A;  1V5P A;  2YRY A;  3T06 A;  2CRF A;  4BBK A;  2D11 A;  1K5D B;  2D9W A;  1EVH A;  2DX5 A;  4NSW A;  4F7G A;  4ZRI A;  1J19 A;  1PMS A;  1U5E A;  1E5W A;  4EKU A;  2R09 A;  2DHJ A;  1XR0 B;  2P8V A;  2D4Q A;  5D3Y A;  1EF1 A;  3ULC A;  2FJL A;  1P3R A;  3LJU X;  4HAV B;  3CXB B;  2Z0O A;  1ISN A;  2W2X C;  3DXC A;  5D27 A;  5DIF B;  1FB8 A;  1V89 A;  2RGN B;  3WA0 A;  2CY4 A;  1SGH A;  1FOE A;  1I2H A;  2K00 A;  5KQ1 A;  4KHA A;  2RSG A;  4GPT B;  3U8Z A;  1KZ7 A;  2IFS A;  4HAT B;  1B55 A;  1XKE A;  4TKN A;  2P0D A;  3SUZ A;  4GZU A;  4CYE A;  3BIN A;  2NZ8 B;  2GS0 A;  3PVL A;  3ZVR A;  2DYN A;  5D3X A;  4H8S A;  5LOP B;  2ELA A;  1MK7 B;  4EMO A;  4GN1 A;  4Z2M B;  2DX1 A;  1M7E A;  4EJN A;  1DYN A;  1QC6 A;  2COA A;  1K5G B;  1P6S A;  5C16 A;  4MT7 A;  2UZR A;  5HE1 A;  5JLJ B;  3KRW A;  3PZD A;  3HQC A;  2P0F A;  2MDX A;  1TQZ A;  1FGZ A;  2HE7 A;  4WJ7 A;  5J3T A;  2X18 A;  5DI9 B;  2VSZ A;  1KZG A;  1LB1 A;  5J3Q A;  1KI1 B;  1WG7 A;  2DKQ A;  2OQB A;  2D9Z A;  2DLW A;  1W1G A;  4A5K A;  1MAI A;  4P7I A;  3D8F A;  2QKM A;  2I1J A;  2G35 A;  3QWM A;  3AJ4 A;  2P0H A;  2YS1 A;  3IVF A;  4K2O A;  2UVM A;  2W2X D;  3ODO A;  1TXD A;  2Z0P A;  3ODW A;  1ZVR A;  5KCV A;  2LUL A;  2R0D A; 
#chains in the Genus database with same CATH topology
 3TFM A;  2Y8G A;  5C5B A;  2AL6 A;  3V5W A;  4HHV A;  2DFK A;  4XWX A;  4F7H A;  1BTK A;  1FAO A;  4CHM A;  2MKR A;  2L1C A;  3HIE A;  1FGY A;  2FJU B;  1V5U A;  1SHC A;  4HB0 B;  1PLS A;  2GCL A;  1OY2 A;  1FHO A;  1WGQ A;  1UEF A;  3MDB C;  1MIX A;  2YT1 A;  5D3V A;  3SNH A;  3X23 A;  5KQ4 A;  2YT2 A;  4K81 A;  1Y19 B;  1BWN A;  2DHK A;  3QIJ A;  2COF A;  2YS3 A;  1X05 A;  5CLQ B;  3P6A A;  4KVG B;  3GYP A;  2D9V A;  1XCG A;  3F0W A;  3DXE A;  4OT1 A;  2D9Y A;  2I5F A;  1UNR A;  3KSY A;  1GC7 A;  2OTX A;  1EAZ A;  2DA0 A;  2ELB A;  2NMB A;  2YF0 A;  5C5B B;  4D0N B;  2W2W A;  4NY0 A;  2N0Y A;  4HDQ A;  2LOZ A;  2Q13 A;  1MI1 A;  2LOX A;  1WVH A;  1NTY A;  2KIG A;  3SO6 A;  4HAZ B;  1U2B A;  1OQN A;  2VKI A;  3KY9 A;  4A6H A;  1UPQ A;  2DYQ A;  1NTV A;  3A58 A;  1AWE A;  4GMX B;  5CLL B;  4HB3 B;  4HAU B;  2K2U A;  2D9X A;  2EMT A;  1WJ1 A;  2CY5 A;  2RUK B;  2L2I A;  3TVV A;  4PQ0 A;  3CIK A;  4YON A;  3TCA A;  1MKE A;  3KZ1 A;  4L1R A;  5GOW B;  4DX9 0;  4CSQ A;  1RJ2 A;  2GUM A;  1H4R A;  4HAW B;  4A6K A;  1U29 A;  2D2Q A;  2KCJ A;  3PVU A;  3NSU A;  4IFS A;  1MK9 B;  4KHB A;  3P7Z A;  1W1D A;  4K2P A;  5I2M A;  2Y7B A;  2YS5 A;  1DDV A;  1IRS A;  3FM8 C;  2H7E A;  1MIZ B;  5FI1 A;  1XX0 A;  2Z13 A;  3B77 A;  1DBH A;  2RVB B;  2ROZ B;  4GOU A;  2Y8F A;  3A98 B;  1V88 A;  1NU2 A;  1UPR A;  5C79 A;  2J0J A;  4IAP A;  2H7D A;  1X86 A;  1BTN A;  3F5R A;  1V5M A;  2Z0Q A;  4WVF B;  3ML4 A;  2I1K A;  2GCJ A;  3PSC A;  4TYZ A;  4WSF A;  1PFJ A;  4ZRJ A;  3PP2 A;  2RLO A;  4HB4 B;  4OSN A;  2E2X A;  2DTC A;  1WGU A;  3MPX A;  1U5G A;  2YVC A;  2UZS A;  2KGX B;  3AU4 A;  4CHJ A;  5LON B;  2EMS A;  4B6H A;  4DBB A;  5EFX A;  4DXA B;  1Z87 A;  3U12 A;  2DKP A;  4HAY B;  3A8P A;  3HK0 A;  3HW2 B;  4KHO A;  4Y94 A;  2KUP A;  3U7D A;  5JP4 A;  3QBV B;  5FI0 A;  2VRW B;  1T77 A;  3KRX A;  4L6E A;  4YL8 A;  1DDW A;  2EC1 A;  1ZM0 A;  3FSS A;  2KR0 A;  2EJ8 A;  1GC6 A;  4PNK A;  4C0A A;  4KAX B;  1ZC4 B;  4Z2N A;  2KUQ A;  4GMV A;  3PEG A;  2XQN M;  2I5C A;  3N7C A;  4MK0 A;  4ZRK A;  5C6R A;  5L81 A;  1TJ6 A;  2YT0 A;  1BAK A;  1MPH A;  1M7R A;  2N23 A;  4A6F A;  4QXA B;  3TW1 A;  4MY6 A;  2J59 M;  2Z14 A;  3A8Q A;  3WYF B;  3OAN A;  2MFQ A;  1J0W A;  1NI2 A;  1Y5O A;  1LW3 A;  2RNR B;  5JHG A;  2D10 A;  3M1I B;  4K17 A;  1U27 A;  3FVC A;  1X1F A;  2M14 A;  2JP2 A;  3RCP A;  2GJY A;  1P5T A;  1ZYI A;  1UNP A;  5DH9 B;  5DHA B;  2R2Y A;  4DX8 A;  2M38 A;  2DHI A;  5DHF B;  1ZSQ A;  1FHX A;  3VOQ A;  3ULB A;  1X1G A;  3DXD A;  3TO1 A;  2Z59 A;  1U5D A;  2COD A;  1V61 A;  1XD4 A;  4HDO A;  3BJI A;  2QKL A;  3D8E A;  5D3W A;  4A6F B;  2ZPY A;  2MWN B;  4GXB A;  2CAY A;  2NBV A;  1UNQ A;  1Q67 A;  3D8D A;  3FEH A;  3PG7 A;  5JHH A;  1H10 A;  2PZ1 A;  3ODX A;  1W1H A;  1N3H A;  2LG1 A;  2YSZ A;  2AEH A;  5J3Y A;  3SYX A;  3G9W A;  4QJ5 B;  1QQG A;  2K2J A;  5HE2 A;  2ROV A;  5IRS A;  1DRO A;  2IYB A;  3AU5 A;  4QJ3 B;  1U5F A;  1ZC3 B;  3SV1 A;  2LKO A;  2J0M A;  3PVW A;  3O96 A;  2BCJ A;  2HTH B;  5LG4 B;  4HB2 B;  2J0K A;  1RRP B;  2ZKM X;  2LYD A;  3GYO A;  1I7A A;  3HSA A;  3ZDT A;  2V76 A;  1AQC A;  2RRF A;  1OMW A;  1GG3 A;  5HE3 A;  4IOY X;  3VIA A;  2KIE A;  1X11 A;  4HAX B;  1FHW A;  2COC A;  4KHB B;  3NWD A;  3UZT A;  1XOD A;  2ADZ A;  4F7U P;  1WI1 A;  5HE0 A;  2DN6 A;  3NWA A;  1EGX A;  1DDM A;  1WJM A;  1V5P A;  2YRY A;  3T06 A;  2CRF A;  4BBK A;  2D11 A;  1K5D B;  2D9W A;  1EVH A;  2DX5 A;  4NSW A;  4F7G A;  4ZRI A;  1J19 A;  1PMS A;  1U5E A;  1E5W A;  4EKU A;  2R09 A;  2DHJ A;  1XR0 B;  2P8V A;  2D4Q A;  5D3Y A;  1EF1 A;  4D6W A;  3ULC A;  2FJL A;  1P3R A;  3LJU X;  4HAV B;  3NWF A;  3CXB B;  4QJ4 B;  2Z0O A;  1ISN A;  2W2X C;  5I2S A;  2K49 A;  3DXC A;  5D27 A;  5DIF B;  1FB8 A;  1V89 A;  2RGN B;  3WA0 A;  2CY4 A;  1SGH A;  1FOE A;  1I2H A;  2K00 A;  5KQ1 A;  4KHA A;  2RSG A;  4GPT B;  3U8Z A;  1KZ7 A;  2IFS A;  4HAT B;  1B55 A;  1XKE A;  4TKN A;  2P0D A;  3SUZ A;  4GZU A;  4CYE A;  3BIN A;  3DCX A;  2NZ8 B;  2GS0 A;  3PVL A;  3ZVR A;  2DYN A;  5D3X A;  4H8S A;  5LOP B;  2ELA A;  3NW8 A;  1MK7 B;  4EMO A;  4GN1 A;  4Z2M B;  2DX1 A;  1M7E A;  4EJN A;  1DYN A;  1QC6 A;  2COA A;  1K5G B;  1P6S A;  5C16 A;  4MT7 A;  2UZR A;  4DIX A;  5HE1 A;  5JLJ B;  3KRW A;  3PZD A;  3HQC A;  2P0F A;  2MDX A;  1TQZ A;  1FGZ A;  2HE7 A;  4WJ7 A;  5J3T A;  2X18 A;  5DI9 B;  2VSZ A;  1KZG A;  1LB1 A;  5J3Q A;  1KI1 B;  1WG7 A;  4HSI A;  2DKQ A;  5M4Y B;  2OQB A;  2D9Z A;  2DLW A;  1W1G A;  4A5K A;  1MAI A;  2K8E A;  4GNK B;  4P7I A;  3D8F A;  2QKM A;  3OHM B;  2I1J A;  2G35 A;  3QWM A;  3AJ4 A;  2P0H A;  2YS1 A;  3IVF A;  4K2O A;  2UVM A;  2W2X D;  3ODO A;  1TXD A;  2Z0P A;  3ODW A;  2Z4D A;  1ZVR A;  5KCV A;  2LUL A;  2R0D A; 
#chains in the Genus database with same CATH homology
 3TFM A;  2Y8G A;  5C5B A;  2AL6 A;  3V5W A;  4HHV A;  2DFK A;  4XWX A;  4F7H A;  1BTK A;  1FAO A;  4CHM A;  2MKR A;  2L1C A;  1FGY A;  1V5U A;  1SHC A;  4HB0 B;  1PLS A;  2GCL A;  1OY2 A;  1FHO A;  1WGQ A;  1UEF A;  3MDB C;  1MIX A;  2YT1 A;  5D3V A;  3SNH A;  3X23 A;  5KQ4 A;  4K81 A;  1Y19 B;  1BWN A;  2DHK A;  3QIJ A;  2COF A;  2YS3 A;  1X05 A;  5CLQ B;  3P6A A;  4KVG B;  3GYP A;  2D9V A;  1XCG A;  3F0W A;  3DXE A;  2D9Y A;  2I5F A;  1UNR A;  3KSY A;  1GC7 A;  2OTX A;  1EAZ A;  2DA0 A;  2ELB A;  2NMB A;  2YF0 A;  5C5B B;  4D0N B;  2W2W A;  4NY0 A;  2N0Y A;  4HDQ A;  2LOZ A;  2Q13 A;  1WVH A;  1NTY A;  2LOX A;  3SO6 A;  4HAZ B;  1U2B A;  1OQN A;  2VKI A;  3KY9 A;  4A6H A;  1UPQ A;  2DYQ A;  1NTV A;  1AWE A;  4GMX B;  5CLL B;  4HB3 B;  4HAU B;  2K2U A;  2D9X A;  2EMT A;  1WJ1 A;  2CY5 A;  2RUK B;  2L2I A;  3TVV A;  4PQ0 A;  3CIK A;  4YON A;  3TCA A;  1MKE A;  3KZ1 A;  5GOW B;  4DX9 0;  1RJ2 A;  1H4R A;  4HAW B;  4A6K A;  1U29 A;  2D2Q A;  2KCJ A;  3PVU A;  3NSU A;  4IFS A;  1MK9 B;  3P7Z A;  1W1D A;  4K2P A;  2Y7B A;  2YS5 A;  1DDV A;  1IRS A;  3FM8 C;  2H7E A;  1MIZ B;  5FI1 A;  1XX0 A;  1DBH A;  2RVB B;  2ROZ B;  2Y8F A;  3A98 B;  1V88 A;  1NU2 A;  1UPR A;  5C79 A;  2J0J A;  4IAP A;  2H7D A;  1X86 A;  1BTN A;  3F5R A;  1V5M A;  2Z0Q A;  4WVF B;  3ML4 A;  2I1K A;  2GCJ A;  3PSC A;  4TYZ A;  4WSF A;  1PFJ A;  4ZRJ A;  3PP2 A;  2RLO A;  4HB4 B;  2E2X A;  2DTC A;  1WGU A;  3MPX A;  1U5G A;  2YVC A;  2UZS A;  2KGX B;  3AU4 A;  4CHJ A;  5LON B;  2EMS A;  4B6H A;  4DBB A;  5EFX A;  4DXA B;  1Z87 A;  2DKP A;  4HAY B;  3A8P A;  3HK0 A;  3HW2 B;  4KHO A;  4Y94 A;  2KUP A;  3U7D A;  5JP4 A;  3QBV B;  5FI0 A;  2VRW B;  3KRX A;  4L6E A;  4YL8 A;  1DDW A;  2EC1 A;  1ZM0 A;  3FSS A;  2EJ8 A;  1GC6 A;  4PNK A;  4C0A A;  4KAX B;  1ZC4 B;  4Z2N A;  4GMV A;  3PEG A;  2XQN M;  2I5C A;  3N7C A;  4MK0 A;  4ZRK A;  5C6R A;  5L81 A;  1TJ6 A;  2YT0 A;  1BAK A;  1MPH A;  1M7R A;  2N23 A;  4A6F A;  3TW1 A;  4MY6 A;  2J59 M;  3A8Q A;  3WYF B;  3OAN A;  2MFQ A;  1J0W A;  1NI2 A;  1Y5O A;  1LW3 A;  2RNR B;  5JHG A;  2D10 A;  3M1I B;  4K17 A;  1U27 A;  1X1F A;  2M14 A;  2JP2 A;  3RCP A;  2GJY A;  1P5T A;  1UNP A;  5DH9 B;  5DHA B;  4DX8 A;  2M38 A;  2DHI A;  5DHF B;  1ZSQ A;  1FHX A;  3VOQ A;  3ULB A;  1X1G A;  3DXD A;  3TO1 A;  1U5D A;  2COD A;  1V61 A;  1XD4 A;  4HDO A;  3BJI A;  2QKL A;  3D8E A;  5D3W A;  4A6F B;  2ZPY A;  2MWN B;  4GXB A;  2CAY A;  1UNQ A;  1Q67 A;  3D8D A;  3FEH A;  3PG7 A;  5JHH A;  1H10 A;  2PZ1 A;  3ODX A;  1W1H A;  1N3H A;  2LG1 A;  2YSZ A;  2AEH A;  5J3Y A;  3SYX A;  3G9W A;  1QQG A;  2K2J A;  5HE2 A;  2ROV A;  1DRO A;  2IYB A;  3AU5 A;  1U5F A;  1ZC3 B;  3SV1 A;  2LKO A;  2J0M A;  3PVW A;  3O96 A;  2BCJ A;  2HTH B;  4HB2 B;  2J0K A;  1RRP B;  2LYD A;  3GYO A;  1I7A A;  3ZDT A;  2V76 A;  1AQC A;  1OMW A;  1GG3 A;  5HE3 A;  4IOY X;  3VIA A;  1X11 A;  4HAX B;  1FHW A;  2COC A;  4KHB B;  3UZT A;  1XOD A;  2ADZ A;  4F7U P;  1WI1 A;  5HE0 A;  2DN6 A;  1EGX A;  1DDM A;  1WJM A;  1V5P A;  2YRY A;  3T06 A;  2CRF A;  4BBK A;  2D11 A;  1K5D B;  2D9W A;  1EVH A;  2DX5 A;  4NSW A;  4F7G A;  4ZRI A;  1J19 A;  1PMS A;  1U5E A;  1E5W A;  4EKU A;  2R09 A;  2DHJ A;  1XR0 B;  2P8V A;  2D4Q A;  5D3Y A;  1EF1 A;  3ULC A;  2FJL A;  1P3R A;  3LJU X;  4HAV B;  3CXB B;  2Z0O A;  1ISN A;  2W2X C;  3DXC A;  5D27 A;  5DIF B;  1FB8 A;  1V89 A;  2RGN B;  3WA0 A;  2CY4 A;  1SGH A;  1FOE A;  1I2H A;  2K00 A;  5KQ1 A;  4KHA A;  2RSG A;  4GPT B;  3U8Z A;  1KZ7 A;  2IFS A;  4HAT B;  1B55 A;  1XKE A;  4TKN A;  2P0D A;  3SUZ A;  4GZU A;  4CYE A;  3BIN A;  2NZ8 B;  2GS0 A;  3PVL A;  3ZVR A;  2DYN A;  5D3X A;  4H8S A;  5LOP B;  2ELA A;  1MK7 B;  4EMO A;  4GN1 A;  4Z2M B;  2DX1 A;  1M7E A;  4EJN A;  1DYN A;  1QC6 A;  2COA A;  1K5G B;  1P6S A;  5C16 A;  4MT7 A;  2UZR A;  5HE1 A;  5JLJ B;  3KRW A;  3PZD A;  3HQC A;  2P0F A;  2MDX A;  1TQZ A;  1FGZ A;  2HE7 A;  4WJ7 A;  5J3T A;  2X18 A;  5DI9 B;  2VSZ A;  1KZG A;  1LB1 A;  5J3Q A;  1KI1 B;  1WG7 A;  2DKQ A;  2OQB A;  2D9Z A;  2DLW A;  1W1G A;  4A5K A;  1MAI A;  4P7I A;  3D8F A;  2QKM A;  2I1J A;  2G35 A;  3QWM A;  3AJ4 A;  2P0H A;  2YS1 A;  3IVF A;  4K2O A;  2UVM A;  2W2X D;  3ODO A;  1TXD A;  2Z0P A;  3ODW A;  1ZVR A;  5KCV A;  2LUL A;  2R0D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...