1AQCA

X11 ptb domain-10mer peptide complex
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
166
structure length
130
Chain Sequence
b'MEDLIDGIIFAANYLGSTQLLSDKTPSKNVRMMQAQEAVSRIKMAQKLMTEVDLFILTQRIKVLNADTQETMMDHPLRTISYIADIGNIVVLMARRRYKMICHVFESEDAQLIAQSIGQAFSVAYQEFLR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords X11
publication title Sequence-specific recognition of the internalization motif of the Alzheimer's amyloid precursor protein by the X11 PTB domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Complex (peptide binding module/peptide)
total genus 30
structure length 130
sequence length 166
chains with identical sequence B
ec nomenclature
pdb deposition date 1997-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00640 PID Phosphotyrosine interaction domain (PTB/PID)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1aqcA00
5C5BA 1XD4A 4A6FA 4MT7A 4HAVB 4HATB 2GCJA 1XKEA 2M38A 3SV1A 4A6KA 1U5FA 1U5EA 2YT1A 1LB1A 4GZUA 2N23A 3KY9A 4CYEA 2J0MA 4MK0A 1UNQA 4GXBA 3KRWA 1Y5OA 3P7ZA 2RSGA 1TQZA 4PQ0A 3SNHA 4NSWA 5LONB 5D3VA 2RLOA 2J59M 1FHWA 3KZ1A 4PNKA 1ZVRA 4HAYB 2NZ8B 1E5WA 4DX8A 4YL8A 1M7RA 1V5UA 2I1KA 2RNRB 2YRYA 2Z0OA 5D3YA 1NTYA 4Y94A 2KUPA 3N7CA 1AQCA 4EKUA 1KI1B 1TXDA 2VRWB 2X18A 5JHHA 3DXDA 1I7AA 2EJ8A 1FB8A 4HB4B 4DBBA 1DROA 5KQ4A 2Z0QA 2I5CA 4ZRKA 3VIAA 3TFMA 5EFXA 4Z2MB 1KZ7A 3TW1A 1EAZA 2Y8FA 3PSCA 2DHJA 2J0KA 2LKOA 5C6RA 5JP4A 3IVFA 1XODA 3FEHA 1WGQA 1ZC4B 2EC1A 1BAKA 1OQNA 2LOZA 2QKLA 1FGYA 2LOXA 3BINA 1XR0B 3MDBC 2W2XD 1FGZA 2GS0A 3LJUX 3SUZA 3ZDTA 3WYFB 1GC6A 3V5WA 2CAYA 3TO1A 1WG7A 1FHXA 2KGXB 1V88A 1V61A 3QBVB 2OTXA 5DHFB 4ZRJA 4F7HA 4CHMA 2R09A 2DTCA 2IFSA 4F7GA 3KRXA 5JHGA 1J0WA 1NTVA 3PVWA 2AL6A 5HE0A 4GMXB 1GC7A 1DDMA 3AU5A 2CRFA 5HE2A 4IFSA 2K2JA 2VSZA 1U27A 3SYXA 3TCAA 2IYBA 4KVGB 1U2BA 1UEFA 2PZ1A 1I2HA 3GYOA 4C0AA 1H10A 2CODA 2COFA 2GCLA 1WGUA 1FAOA 3ZVRA 4GPTB 2DYNA 5FI1A 2KCJA 5DH9B 2EMTA 1V5PA 1LW3A 2YSZA 2QKMA 3RCPA 3KSYA 1XCGA 2UZRA 4HHVA 1NI2A 2M14A 4ZRIA 3DXCA 4YONA 2D9WA 2UZSA 1U5DA 2EMSA 1EVHA 5KQ1A 4XWXA 2HE7A 1W1DA 2K00A 5J3QA 3A8QA 3M1IB 1DBHA 2W2XC 5HE3A 2ROZB 1P5TA 2Q13A 1MK9B 2DLWA 4HAZB 3AU4A 5JLJB 3HW2B 4EJNA 2H7EA 5J3YA 3CXBB 1W1GA 2DX1A 2MFQA 2DHKA 5C16A 5DIFB 4HB3B 2MWNB 4GN1A 1IRSA 1PFJA 4A6HA 1AWEA 4HAWB 2ZPYA 3HQCA 3U8ZA 5LOPB 5D27A 3PZDA 1KZGA 4EMOA 4DX90 2DYQA 2D9VA 3ODXA 1MPHA 4HDQA 3P6AA 5DI9B 4HDOA 2XQNM 2W2WA 5D3WA 5KCVA 1QQGA 3O96A 2DA0A 1ZC3B 5CLLB 2D10A 1P3RA 2VKIA 2BCJA 4L6EA 1EF1A 2FJLA 2NMBA 3UZTA 1WJ1A 2N0YA 4TKNA 1FOEA 3WA0A 3PP2A 2GJYA 4Z2NA 1Z87A 3ULCA 5C79A 3D8EA 1ZM0A 1V89A 4KHBB 5FI0A 4GMVA 1PLSA 2YS5A 1BTNA 2RUKB 4MY6A 4P7IA 1TJ6A 1J19A 1K5DB 4IAPA 2P0DA 2YS1A 4K2OA 2LULA 2COCA 4WJ7A 1UNPA 1OY2A 1BTKA 4K17A 2COAA 1W1HA 2YVCA 3D8FA 1MAIA 2J0JA 3A8PA 4HAXB 2I5FA 3QWMA 2K2UA 3DXEA 3AJ4A 3HK0A 4KAXB 1DYNA 2LG1A 3A98B 1SGHA 3NSUA 2RVBB 1DDVA 2CY4A 1V5MA 1WI1A 3PVLA 3ODOA 1ISNA 2ADZA 5CLQB 1K5GB 4TYZA 1U29A 2E2XA 2D9YA 3ML4A 3TVVA 2L1CA 1UPQA 2RGNB 1XX0A 2MDXA 3X23A 1X86A 2D9XA 1UPRA 4NY0A 1ZSQA 2V76A 4HB2B 2D4QA 1X1FA 2L2IA 1SHCA 4H8SA 1PMSA 4B6HA 2R0DA 2MKRA 4HAUB 2YS3A 3F0WA 3GYPA 2DKQA 1H4RA 1M7EA 2UVMA 1WJMA 1MIZB 4KHAA 1RRPB 5GOWB 3CIKA 1DDWA 1N3HA 3ODWA 1B55A 1MKEA 2DX5A 1X1GA 2D11A 1P6SA 2P0FA 2ELAA 1MK7B 2LYDA 3BJIA 4HB0B 2I1JA 2ROVA 2P8VA 1UNRA 2DKPA 2Y8GA 3PEGA 3U7DA 5L81A 5DHAB 2H7DA 1Y19B 3OANA 4WSFA 2YT0A 1QC6A 4KHOA 2D2QA 4BBKA 3PVUA 1U5GA 3D8DA 3FSSA 1WVHA 4A5KA 4D0NB 3FM8C 1FHOA 4K2PA 3QIJA 2G35A 2D9ZA 3MPXA 1X05A 2Z0PA 1EGXA 1GG3A 2JP2A 1X11A 1BWNA 2CY5A 2DFKA 5C5BB 2P0HA 3SO6A 4A6FB 3PG7A 2Y7BA 1MIXA 2DHIA 1RJ2A 4K81A 5J3TA 5D3XA 1OMWA 3F5RA 4CHJA 4IOYX 5HE1A 1Q67A 1NU2A 3G9WA 3ULBA 3VOQA 2HTHB 4WVFB 3T06A 2ELBA 4F7UP 2AEHA 2DN6A 2YF0A 2OQBA 4DXAB
chains in the Genus database with same CATH superfamily
5C5BA 2KUQA 1XD4A 4A6FA 4MT7A 4HAVB 4HATB 2GCJA 1XKEA 2M38A 3SV1A 4A6KA 1U5FA 1U5EA 2YT1A 1LB1A 4GZUA 2N23A 3KY9A 4CYEA 2J0MA 4MK0A 1UNQA 4GXBA 3KRWA 1Y5OA 2Z14A 3P7ZA 2RSGA 1TQZA 4PQ0A 3SNHA 4NSWA 5LONB 5D3VA 2RLOA 2J59M 1FHWA 3KZ1A 3NWDA 4PNKA 1ZVRA 4HAYB 2NZ8B 3NWAA 1E5WA 4DX8A 4YL8A 1ZYIA 3HSAA 1M7RA 1V5UA 2I1KA 2RNRB 2YRYA 2Z0OA 5D3YA 1NTYA 4Y94A 2KUPA 3N7CA 1AQCA 4EKUA 1KI1B 1TXDA 2VRWB 2X18A 5JHHA 3DXDA 1I7AA 2EJ8A 1FB8A 4HB4B 4DBBA 1DROA 2YT2A 5KQ4A 2Z0QA 2I5CA 4ZRKA 3VIAA 3TFMA 5EFXA 4Z2MB 1KZ7A 3TW1A 1EAZA 2Y8FA 3PSCA 2DHJA 2J0KA 2LKOA 5C6RA 5JP4A 3IVFA 1XODA 3FEHA 4DIXA 1WGQA 1ZC4B 2EC1A 1BAKA 1OQNA 2LOZA 2QKLA 1FGYA 2LOXA 3BINA 1XR0B 3MDBC 2W2XD 1FGZA 2GS0A 3LJUX 3SUZA 3ZDTA 3WYFB 1GC6A 3V5WA 2CAYA 3TO1A 1WG7A 1FHXA 2KGXB 1V88A 1V61A 4GNKB 3QBVB 2OTXA 5DHFB 4ZRJA 4F7HA 4CHMA 2R09A 2DTCA 2IFSA 4F7GA 3KRXA 5JHGA 1J0WA 1NTVA 3PVWA 2AL6A 5HE0A 4GMXB 1GC7A 1DDMA 3AU5A 2CRFA 5HE2A 4IFSA 2K2JA 5LG4B 2VSZA 1U27A 3SYXA 3TCAA 2IYBA 4KVGB 1U2BA 1UEFA 2PZ1A 1I2HA 3GYOA 4C0AA 1H10A 1MI1A 2CODA 2KIGA 2COFA 2GCLA 1WGUA 1FAOA 3ZVRA 4GPTB 2DYNA 5FI1A 2KCJA 5DH9B 2EMTA 1V5PA 1LW3A 2YSZA 2QKMA 2R2YA 3RCPA 3KSYA 1XCGA 2UZRA 4HHVA 1NI2A 2M14A 4ZRIA 3DXCA 3OHMB 4YONA 2D9WA 2UZSA 1U5DA 2EMSA 1EVHA 5KQ1A 4XWXA 2HE7A 1W1DA 2K00A 5J3QA 3A8QA 3M1IB 1DBHA 2W2XC 5HE3A 2ROZB 1P5TA 2Q13A 1MK9B 2DLWA 4HAZB 2Z4DA 3NW8A 3AU4A 5JLJB 3HIEA 3HW2B 4EJNA 2KIEA 2H7EA 5J3YA 3CXBB 1W1GA 2DX1A 2MFQA 2DHKA 5C16A 5DIFB 4HB3B 2MWNB 4GN1A 2GUMA 1IRSA 1PFJA 4A6HA 4OT1A 1AWEA 4HAWB 2ZPYA 2RRFA 3HQCA 3U8ZA 5LOPB 2K49A 5D27A 3PZDA 1KZGA 2KR0A 4EMOA 4GOUA 4DX90 2DYQA 2D9VA 3ODXA 1MPHA 4HDQA 3P6AA 5DI9B 4HDOA 2XQNM 2W2WA 5D3WA 5KCVA 1QQGA 3O96A 2DA0A 1ZC3B 5CLLB 2D10A 1P3RA 2VKIA 2BCJA 4L6EA 1EF1A 2FJLA 2NMBA 4HSIA 3UZTA 1WJ1A 2N0YA 4TKNA 1FOEA 3WA0A 3PP2A 2GJYA 4Z2NA 1Z87A 3ULCA 5C79A 3D8EA 1ZM0A 1V89A 4KHBB 5FI0A 4GMVA 1PLSA 2YS5A 1BTNA 3DCXA 2RUKB 4MY6A 4P7IA 1TJ6A 4QJ5B 1J19A 1K5DB 4IAPA 2P0DA 2YS1A 2Z13A 3A58A 4K2OA 4D6WA 2LULA 2COCA 4WJ7A 1UNPA 1OY2A 1BTKA 4K17A 2COAA 4KHBA 1W1HA 2YVCA 3D8FA 1MAIA 2J0JA 3A8PA 4HAXB 2I5FA 3QWMA 2K2UA 3DXEA 3AJ4A 3B77A 3HK0A 4KAXB 2Z59A 1DYNA 2LG1A 3A98B 1SGHA 3NSUA 2RVBB 1DDVA 2CY4A 1V5MA 1WI1A 5IRSA 3PVLA 3ODOA 1ISNA 2ADZA 5CLQB 1K5GB 4TYZA 1U29A 2E2XA 4L1RA 2D9YA 3ML4A 3TVVA 2L1CA 1UPQA 4DXAB 2RGNB 1XX0A 2MDXA 3X23A 1X86A 4OSNA 2D9XA 1UPRA 4NY0A 1ZSQA 5M4YB 2V76A 4HB2B 2D4QA 1X1FA 2L2IA 1SHCA 4H8SA 1PMSA 4B6HA 2R0DA 2MKRA 4HAUB 2YS3A 3F0WA 3GYPA 2DKQA 1H4RA 2NBVA 4QXAB 1M7EA 2UVMA 1WJMA 1MIZB 4KHAA 1RRPB 5GOWB 3CIKA 1DDWA 1N3HA 3ODWA 1B55A 1MKEA 2DX5A 1X1GA 2D11A 1P6SA 2P0FA 2ELAA 1MK7B 2LYDA 3BJIA 4HB0B 2I1JA 2ROVA 2P8VA 1UNRA 2FJUB 2DKPA 2Y8GA 3PEGA 3U7DA 5L81A 5DHAB 2H7DA 1Y19B 3OANA 2K8EA 2YT0A 4WSFA 1QC6A 4KHOA 2D2QA 4BBKA 2ZKMX 3PVUA 4CSQA 1U5GA 3D8DA 3FSSA 1WVHA 4A5KA 4D0NB 3FM8C 1FHOA 4K2PA 3QIJA 2G35A 2D9ZA 3MPXA 1X05A 2Z0PA 1EGXA 1GG3A 2JP2A 1X11A 1BWNA 2CY5A 2DFKA 5C5BB 2P0HA 3SO6A 4A6FB 3PG7A 2Y7BA 1MIXA 2DHIA 1RJ2A 4K81A 5I2MA 5J3TA 5D3XA 4QJ4B 1OMWA 3F5RA 4QJ3B 4CHJA 4IOYX 5HE1A 1Q67A 1NU2A 3G9WA 3ULBA 3VOQA 2HTHB 4WVFB 3T06A 2ELBA 3U12A 5I2SA 3FVCA 3NWFA 4F7UP 2AEHA 2DN6A 2YF0A 2OQBA 1T77A
chains in the Genus database with same CATH topology
5C5BA 1XD4A 4A6FA 4MT7A 4HAVB 4HATB 2GCJA 1XKEA 2M38A 3SV1A 4A6KA 1U5FA 1U5EA 2YT1A 1LB1A 4GZUA 2N23A 3KY9A 4CYEA 2J0MA 4MK0A 1UNQA 4GXBA 3KRWA 1Y5OA 3P7ZA 2RSGA 1TQZA 4PQ0A 3SNHA 4NSWA 5LONB 5D3VA 2RLOA 2J59M 1FHWA 3KZ1A 4PNKA 1ZVRA 4HAYB 2NZ8B 1E5WA 4DX8A 4YL8A 1M7RA 1V5UA 2I1KA 2RNRB 2YRYA 2Z0OA 5D3YA 1NTYA 4Y94A 2KUPA 3N7CA 1AQCA 4EKUA 1KI1B 1TXDA 2VRWB 2X18A 5JHHA 3DXDA 1I7AA 2EJ8A 1FB8A 4HB4B 4DBBA 1DROA 5KQ4A 2Z0QA 2I5CA 4ZRKA 3VIAA 3TFMA 5EFXA 4Z2MB 1KZ7A 3TW1A 1EAZA 2Y8FA 3PSCA 2DHJA 2J0KA 2LKOA 5C6RA 5JP4A 3IVFA 1XODA 3FEHA 1WGQA 1ZC4B 2EC1A 1BAKA 1OQNA 2LOZA 2QKLA 1FGYA 2LOXA 3BINA 1XR0B 3MDBC 2W2XD 1FGZA 2GS0A 3LJUX 3SUZA 3ZDTA 3WYFB 1GC6A 3V5WA 2CAYA 3TO1A 1WG7A 1FHXA 2KGXB 1V88A 1V61A 3QBVB 2OTXA 5DHFB 4ZRJA 4F7HA 4CHMA 2R09A 2DTCA 2IFSA 4F7GA 3KRXA 5JHGA 1J0WA 1NTVA 3PVWA 2AL6A 5HE0A 4GMXB 1GC7A 1DDMA 3AU5A 2CRFA 5HE2A 4IFSA 2K2JA 2VSZA 1U27A 3SYXA 3TCAA 2IYBA 4KVGB 1U2BA 1UEFA 2PZ1A 1I2HA 3GYOA 4C0AA 1H10A 2CODA 2COFA 2GCLA 1WGUA 1FAOA 3ZVRA 4GPTB 2DYNA 5FI1A 2KCJA 5DH9B 2EMTA 1V5PA 1LW3A 2YSZA 2QKMA 3RCPA 3KSYA 1XCGA 2UZRA 4HHVA 1NI2A 2M14A 4ZRIA 3DXCA 4YONA 2D9WA 2UZSA 1U5DA 2EMSA 1EVHA 5KQ1A 4XWXA 2HE7A 1W1DA 2K00A 5J3QA 3A8QA 3M1IB 1DBHA 2W2XC 5HE3A 2ROZB 1P5TA 2Q13A 1MK9B 2DLWA 4HAZB 3AU4A 5JLJB 3HW2B 4EJNA 2H7EA 5J3YA 3CXBB 1W1GA 2DX1A 2MFQA 2DHKA 5C16A 5DIFB 4HB3B 2MWNB 4GN1A 1IRSA 1PFJA 4A6HA 1AWEA 4HAWB 2ZPYA 3HQCA 3U8ZA 5LOPB 5D27A 3PZDA 1KZGA 4EMOA 4DX90 2DYQA 2D9VA 3ODXA 1MPHA 4HDQA 3P6AA 5DI9B 4HDOA 2XQNM 2W2WA 5D3WA 5KCVA 1QQGA 3O96A 2DA0A 1ZC3B 5CLLB 2D10A 1P3RA 2VKIA 2BCJA 4L6EA 1EF1A 2FJLA 2NMBA 3UZTA 1WJ1A 2N0YA 4TKNA 1FOEA 3WA0A 3PP2A 2GJYA 4Z2NA 1Z87A 3ULCA 5C79A 3D8EA 1ZM0A 1V89A 4KHBB 5FI0A 4GMVA 1PLSA 2YS5A 1BTNA 2RUKB 4MY6A 4P7IA 1TJ6A 1J19A 1K5DB 4IAPA 2P0DA 2YS1A 4K2OA 2LULA 2COCA 4WJ7A 1UNPA 1OY2A 1BTKA 4K17A 2COAA 1W1HA 2YVCA 3D8FA 1MAIA 2J0JA 3A8PA 4HAXB 2I5FA 3QWMA 2K2UA 3DXEA 3AJ4A 3HK0A 4KAXB 1DYNA 2LG1A 3A98B 1SGHA 3NSUA 2RVBB 1DDVA 2CY4A 1V5MA 1WI1A 3PVLA 3ODOA 1ISNA 2ADZA 5CLQB 1K5GB 4TYZA 1U29A 2E2XA 2D9YA 3ML4A 3TVVA 2L1CA 1UPQA 2RGNB 1XX0A 2MDXA 3X23A 1X86A 2D9XA 1UPRA 4NY0A 1ZSQA 2V76A 4HB2B 2D4QA 1X1FA 2L2IA 1SHCA 4H8SA 1PMSA 4B6HA 2R0DA 2MKRA 4HAUB 2YS3A 3F0WA 3GYPA 2DKQA 1H4RA 1M7EA 2UVMA 1WJMA 1MIZB 4KHAA 1RRPB 5GOWB 3CIKA 1DDWA 1N3HA 3ODWA 1B55A 1MKEA 2DX5A 1X1GA 2D11A 1P6SA 2P0FA 2ELAA 1MK7B 2LYDA 3BJIA 4HB0B 2I1JA 2ROVA 2P8VA 1UNRA 2DKPA 2Y8GA 3PEGA 3U7DA 5L81A 5DHAB 2H7DA 1Y19B 3OANA 4WSFA 2YT0A 1QC6A 4KHOA 2D2QA 4BBKA 3PVUA 1U5GA 3D8DA 3FSSA 1WVHA 4A5KA 4D0NB 3FM8C 1FHOA 4K2PA 3QIJA 2G35A 2D9ZA 3MPXA 1X05A 2Z0PA 1EGXA 1GG3A 2JP2A 1X11A 1BWNA 2CY5A 2DFKA 5C5BB 2P0HA 3SO6A 4A6FB 3PG7A 2Y7BA 1MIXA 2DHIA 1RJ2A 4K81A 5J3TA 5D3XA 1OMWA 3F5RA 4CHJA 4IOYX 5HE1A 1Q67A 1NU2A 3G9WA 3ULBA 3VOQA 2HTHB 4WVFB 3T06A 2ELBA 4F7UP 2AEHA 2DN6A 2YF0A 2OQBA 4DXAB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C5B A;  1XD4 A;  4A6F A;  4MT7 A;  4HAV B;  4HAT B;  2GCJ A;  1XKE A;  2M38 A;  3SV1 A;  4A6K A;  1U5F A;  1U5E A;  2YT1 A;  1LB1 A;  4GZU A;  2N23 A;  3KY9 A;  4CYE A;  2J0M A;  4MK0 A;  1UNQ A;  4GXB A;  3KRW A;  1Y5O A;  3P7Z A;  2RSG A;  1TQZ A;  4PQ0 A;  3SNH A;  4NSW A;  5LON B;  5D3V A;  2RLO A;  2J59 M;  1FHW A;  3KZ1 A;  4PNK A;  1ZVR A;  4HAY B;  2NZ8 B;  1E5W A;  4DX8 A;  4YL8 A;  1M7R A;  1V5U A;  2I1K A;  2RNR B;  2YRY A;  2Z0O A;  5D3Y A;  1NTY A;  4Y94 A;  2KUP A;  3N7C A;  1AQC A;  4EKU A;  1KI1 B;  1TXD A;  2VRW B;  2X18 A;  5JHH A;  3DXD A;  1I7A A;  2EJ8 A;  1FB8 A;  4HB4 B;  4DBB A;  1DRO A;  5KQ4 A;  2Z0Q A;  2I5C A;  4ZRK A;  3VIA A;  3TFM A;  5EFX A;  4Z2M B;  1KZ7 A;  3TW1 A;  1EAZ A;  2Y8F A;  3PSC A;  2DHJ A;  2J0K A;  2LKO A;  5C6R A;  5JP4 A;  3IVF A;  1XOD A;  3FEH A;  1WGQ A;  1ZC4 B;  2EC1 A;  1BAK A;  1OQN A;  2LOZ A;  2QKL A;  1FGY A;  2LOX A;  3BIN A;  1XR0 B;  3MDB C;  2W2X D;  1FGZ A;  2GS0 A;  3LJU X;  3SUZ A;  3ZDT A;  3WYF B;  1GC6 A;  3V5W A;  2CAY A;  3TO1 A;  1WG7 A;  1FHX A;  2KGX B;  1V88 A;  1V61 A;  3QBV B;  2OTX A;  5DHF B;  4ZRJ A;  4F7H A;  4CHM A;  2R09 A;  2DTC A;  2IFS A;  4F7G A;  3KRX A;  5JHG A;  1J0W A;  1NTV A;  3PVW A;  2AL6 A;  5HE0 A;  4GMX B;  1GC7 A;  1DDM A;  3AU5 A;  2CRF A;  5HE2 A;  4IFS A;  2K2J A;  2VSZ A;  1U27 A;  3SYX A;  3TCA A;  2IYB A;  4KVG B;  1U2B A;  1UEF A;  2PZ1 A;  1I2H A;  3GYO A;  4C0A A;  1H10 A;  2COD A;  2COF A;  2GCL A;  1WGU A;  1FAO A;  3ZVR A;  4GPT B;  2DYN A;  5FI1 A;  2KCJ A;  5DH9 B;  2EMT A;  1V5P A;  1LW3 A;  2YSZ A;  2QKM A;  3RCP A;  3KSY A;  1XCG A;  2UZR A;  4HHV A;  1NI2 A;  2M14 A;  4ZRI A;  3DXC A;  4YON A;  2D9W A;  2UZS A;  1U5D A;  2EMS A;  1EVH A;  5KQ1 A;  4XWX A;  2HE7 A;  1W1D A;  2K00 A;  5J3Q A;  3A8Q A;  3M1I B;  1DBH A;  2W2X C;  5HE3 A;  2ROZ B;  1P5T A;  2Q13 A;  1MK9 B;  2DLW A;  4HAZ B;  3AU4 A;  5JLJ B;  3HW2 B;  4EJN A;  2H7E A;  5J3Y A;  3CXB B;  1W1G A;  2DX1 A;  2MFQ A;  2DHK A;  5C16 A;  5DIF B;  4HB3 B;  2MWN B;  4GN1 A;  1IRS A;  1PFJ A;  4A6H A;  1AWE A;  4HAW B;  2ZPY A;  3HQC A;  3U8Z A;  5LOP B;  5D27 A;  3PZD A;  1KZG A;  4EMO A;  4DX9 0;  2DYQ A;  2D9V A;  3ODX A;  1MPH A;  4HDQ A;  3P6A A;  5DI9 B;  4HDO A;  2XQN M;  2W2W A;  5D3W A;  5KCV A;  1QQG A;  3O96 A;  2DA0 A;  1ZC3 B;  5CLL B;  2D10 A;  1P3R A;  2VKI A;  2BCJ A;  4L6E A;  1EF1 A;  2FJL A;  2NMB A;  3UZT A;  1WJ1 A;  2N0Y A;  4TKN A;  1FOE A;  3WA0 A;  3PP2 A;  2GJY A;  4Z2N A;  1Z87 A;  3ULC A;  5C79 A;  3D8E A;  1ZM0 A;  1V89 A;  4KHB B;  5FI0 A;  4GMV A;  1PLS A;  2YS5 A;  1BTN A;  2RUK B;  4MY6 A;  4P7I A;  1TJ6 A;  1J19 A;  1K5D B;  4IAP A;  2P0D A;  2YS1 A;  4K2O A;  2LUL A;  2COC A;  4WJ7 A;  1UNP A;  1OY2 A;  1BTK A;  4K17 A;  2COA A;  1W1H A;  2YVC A;  3D8F A;  1MAI A;  2J0J A;  3A8P A;  4HAX B;  2I5F A;  3QWM A;  2K2U A;  3DXE A;  3AJ4 A;  3HK0 A;  4KAX B;  1DYN A;  2LG1 A;  3A98 B;  1SGH A;  3NSU A;  2RVB B;  1DDV A;  2CY4 A;  1V5M A;  1WI1 A;  3PVL A;  3ODO A;  1ISN A;  2ADZ A;  5CLQ B;  1K5G B;  4TYZ A;  1U29 A;  2E2X A;  2D9Y A;  3ML4 A;  3TVV A;  2L1C A;  1UPQ A;  2RGN B;  1XX0 A;  2MDX A;  3X23 A;  1X86 A;  2D9X A;  1UPR A;  4NY0 A;  1ZSQ A;  2V76 A;  4HB2 B;  2D4Q A;  1X1F A;  2L2I A;  1SHC A;  4H8S A;  1PMS A;  4B6H A;  2R0D A;  2MKR A;  4HAU B;  2YS3 A;  3F0W A;  3GYP A;  2DKQ A;  1H4R A;  1M7E A;  2UVM A;  1WJM A;  1MIZ B;  4KHA A;  1RRP B;  5GOW B;  3CIK A;  1DDW A;  1N3H A;  3ODW A;  1B55 A;  1MKE A;  2DX5 A;  1X1G A;  2D11 A;  1P6S A;  2P0F A;  2ELA A;  1MK7 B;  2LYD A;  3BJI A;  4HB0 B;  2I1J A;  2ROV A;  2P8V A;  1UNR A;  2DKP A;  2Y8G A;  3PEG A;  3U7D A;  5L81 A;  5DHA B;  2H7D A;  1Y19 B;  3OAN A;  4WSF A;  2YT0 A;  1QC6 A;  4KHO A;  2D2Q A;  4BBK A;  3PVU A;  1U5G A;  3D8D A;  3FSS A;  1WVH A;  4A5K A;  4D0N B;  3FM8 C;  1FHO A;  4K2P A;  3QIJ A;  2G35 A;  2D9Z A;  3MPX A;  1X05 A;  2Z0P A;  1EGX A;  1GG3 A;  2JP2 A;  1X11 A;  1BWN A;  2CY5 A;  2DFK A;  5C5B B;  2P0H A;  3SO6 A;  4A6F B;  3PG7 A;  2Y7B A;  1MIX A;  2DHI A;  1RJ2 A;  4K81 A;  5J3T A;  5D3X A;  1OMW A;  3F5R A;  4CHJ A;  4IOY X;  5HE1 A;  1Q67 A;  1NU2 A;  3G9W A;  3ULB A;  3VOQ A;  2HTH B;  4WVF B;  3T06 A;  2ELB A;  4F7U P;  2AEH A;  2DN6 A;  2YF0 A;  2OQB A;  4DXA B; 
#chains in the Genus database with same CATH topology
 5C5B A;  2KUQ A;  1XD4 A;  4A6F A;  4MT7 A;  4HAV B;  4HAT B;  2GCJ A;  1XKE A;  2M38 A;  3SV1 A;  4A6K A;  1U5F A;  1U5E A;  2YT1 A;  1LB1 A;  4GZU A;  2N23 A;  3KY9 A;  4CYE A;  2J0M A;  4MK0 A;  1UNQ A;  4GXB A;  3KRW A;  1Y5O A;  2Z14 A;  3P7Z A;  2RSG A;  1TQZ A;  4PQ0 A;  3SNH A;  4NSW A;  5LON B;  5D3V A;  2RLO A;  2J59 M;  1FHW A;  3KZ1 A;  3NWD A;  4PNK A;  1ZVR A;  4HAY B;  2NZ8 B;  3NWA A;  1E5W A;  4DX8 A;  4YL8 A;  1ZYI A;  3HSA A;  1M7R A;  1V5U A;  2I1K A;  2RNR B;  2YRY A;  2Z0O A;  5D3Y A;  1NTY A;  4Y94 A;  2KUP A;  3N7C A;  1AQC A;  4EKU A;  1KI1 B;  1TXD A;  2VRW B;  2X18 A;  5JHH A;  3DXD A;  1I7A A;  2EJ8 A;  1FB8 A;  4HB4 B;  4DBB A;  1DRO A;  2YT2 A;  5KQ4 A;  2Z0Q A;  2I5C A;  4ZRK A;  3VIA A;  3TFM A;  5EFX A;  4Z2M B;  1KZ7 A;  3TW1 A;  1EAZ A;  2Y8F A;  3PSC A;  2DHJ A;  2J0K A;  2LKO A;  5C6R A;  5JP4 A;  3IVF A;  1XOD A;  3FEH A;  4DIX A;  1WGQ A;  1ZC4 B;  2EC1 A;  1BAK A;  1OQN A;  2LOZ A;  2QKL A;  1FGY A;  2LOX A;  3BIN A;  1XR0 B;  3MDB C;  2W2X D;  1FGZ A;  2GS0 A;  3LJU X;  3SUZ A;  3ZDT A;  3WYF B;  1GC6 A;  3V5W A;  2CAY A;  3TO1 A;  1WG7 A;  1FHX A;  2KGX B;  1V88 A;  1V61 A;  4GNK B;  3QBV B;  2OTX A;  5DHF B;  4ZRJ A;  4F7H A;  4CHM A;  2R09 A;  2DTC A;  2IFS A;  4F7G A;  3KRX A;  5JHG A;  1J0W A;  1NTV A;  3PVW A;  2AL6 A;  5HE0 A;  4GMX B;  1GC7 A;  1DDM A;  3AU5 A;  2CRF A;  5HE2 A;  4IFS A;  2K2J A;  5LG4 B;  2VSZ A;  1U27 A;  3SYX A;  3TCA A;  2IYB A;  4KVG B;  1U2B A;  1UEF A;  2PZ1 A;  1I2H A;  3GYO A;  4C0A A;  1H10 A;  1MI1 A;  2COD A;  2KIG A;  2COF A;  2GCL A;  1WGU A;  1FAO A;  3ZVR A;  4GPT B;  2DYN A;  5FI1 A;  2KCJ A;  5DH9 B;  2EMT A;  1V5P A;  1LW3 A;  2YSZ A;  2QKM A;  2R2Y A;  3RCP A;  3KSY A;  1XCG A;  2UZR A;  4HHV A;  1NI2 A;  2M14 A;  4ZRI A;  3DXC A;  3OHM B;  4YON A;  2D9W A;  2UZS A;  1U5D A;  2EMS A;  1EVH A;  5KQ1 A;  4XWX A;  2HE7 A;  1W1D A;  2K00 A;  5J3Q A;  3A8Q A;  3M1I B;  1DBH A;  2W2X C;  5HE3 A;  2ROZ B;  1P5T A;  2Q13 A;  1MK9 B;  2DLW A;  4HAZ B;  2Z4D A;  3NW8 A;  3AU4 A;  5JLJ B;  3HIE A;  3HW2 B;  4EJN A;  2KIE A;  2H7E A;  5J3Y A;  3CXB B;  1W1G A;  2DX1 A;  2MFQ A;  2DHK A;  5C16 A;  5DIF B;  4HB3 B;  2MWN B;  4GN1 A;  2GUM A;  1IRS A;  1PFJ A;  4A6H A;  4OT1 A;  1AWE A;  4HAW B;  2ZPY A;  2RRF A;  3HQC A;  3U8Z A;  5LOP B;  2K49 A;  5D27 A;  3PZD A;  1KZG A;  2KR0 A;  4EMO A;  4GOU A;  4DX9 0;  2DYQ A;  2D9V A;  3ODX A;  1MPH A;  4HDQ A;  3P6A A;  5DI9 B;  4HDO A;  2XQN M;  2W2W A;  5D3W A;  5KCV A;  1QQG A;  3O96 A;  2DA0 A;  1ZC3 B;  5CLL B;  2D10 A;  1P3R A;  2VKI A;  2BCJ A;  4L6E A;  1EF1 A;  2FJL A;  2NMB A;  4HSI A;  3UZT A;  1WJ1 A;  2N0Y A;  4TKN A;  1FOE A;  3WA0 A;  3PP2 A;  2GJY A;  4Z2N A;  1Z87 A;  3ULC A;  5C79 A;  3D8E A;  1ZM0 A;  1V89 A;  4KHB B;  5FI0 A;  4GMV A;  1PLS A;  2YS5 A;  1BTN A;  3DCX A;  2RUK B;  4MY6 A;  4P7I A;  1TJ6 A;  4QJ5 B;  1J19 A;  1K5D B;  4IAP A;  2P0D A;  2YS1 A;  2Z13 A;  3A58 A;  4K2O A;  4D6W A;  2LUL A;  2COC A;  4WJ7 A;  1UNP A;  1OY2 A;  1BTK A;  4K17 A;  2COA A;  4KHB A;  1W1H A;  2YVC A;  3D8F A;  1MAI A;  2J0J A;  3A8P A;  4HAX B;  2I5F A;  3QWM A;  2K2U A;  3DXE A;  3AJ4 A;  3B77 A;  3HK0 A;  4KAX B;  2Z59 A;  1DYN A;  2LG1 A;  3A98 B;  1SGH A;  3NSU A;  2RVB B;  1DDV A;  2CY4 A;  1V5M A;  1WI1 A;  5IRS A;  3PVL A;  3ODO A;  1ISN A;  2ADZ A;  5CLQ B;  1K5G B;  4TYZ A;  1U29 A;  2E2X A;  4L1R A;  2D9Y A;  3ML4 A;  3TVV A;  2L1C A;  1UPQ A;  4DXA B;  2RGN B;  1XX0 A;  2MDX A;  3X23 A;  1X86 A;  4OSN A;  2D9X A;  1UPR A;  4NY0 A;  1ZSQ A;  5M4Y B;  2V76 A;  4HB2 B;  2D4Q A;  1X1F A;  2L2I A;  1SHC A;  4H8S A;  1PMS A;  4B6H A;  2R0D A;  2MKR A;  4HAU B;  2YS3 A;  3F0W A;  3GYP A;  2DKQ A;  1H4R A;  2NBV A;  4QXA B;  1M7E A;  2UVM A;  1WJM A;  1MIZ B;  4KHA A;  1RRP B;  5GOW B;  3CIK A;  1DDW A;  1N3H A;  3ODW A;  1B55 A;  1MKE A;  2DX5 A;  1X1G A;  2D11 A;  1P6S A;  2P0F A;  2ELA A;  1MK7 B;  2LYD A;  3BJI A;  4HB0 B;  2I1J A;  2ROV A;  2P8V A;  1UNR A;  2FJU B;  2DKP A;  2Y8G A;  3PEG A;  3U7D A;  5L81 A;  5DHA B;  2H7D A;  1Y19 B;  3OAN A;  2K8E A;  2YT0 A;  4WSF A;  1QC6 A;  4KHO A;  2D2Q A;  4BBK A;  2ZKM X;  3PVU A;  4CSQ A;  1U5G A;  3D8D A;  3FSS A;  1WVH A;  4A5K A;  4D0N B;  3FM8 C;  1FHO A;  4K2P A;  3QIJ A;  2G35 A;  2D9Z A;  3MPX A;  1X05 A;  2Z0P A;  1EGX A;  1GG3 A;  2JP2 A;  1X11 A;  1BWN A;  2CY5 A;  2DFK A;  5C5B B;  2P0H A;  3SO6 A;  4A6F B;  3PG7 A;  2Y7B A;  1MIX A;  2DHI A;  1RJ2 A;  4K81 A;  5I2M A;  5J3T A;  5D3X A;  4QJ4 B;  1OMW A;  3F5R A;  4QJ3 B;  4CHJ A;  4IOY X;  5HE1 A;  1Q67 A;  1NU2 A;  3G9W A;  3ULB A;  3VOQ A;  2HTH B;  4WVF B;  3T06 A;  2ELB A;  3U12 A;  5I2S A;  3FVC A;  3NWF A;  4F7U P;  2AEH A;  2DN6 A;  2YF0 A;  2OQB A;  1T77 A; 
#chains in the Genus database with same CATH homology
 5C5B A;  1XD4 A;  4A6F A;  4MT7 A;  4HAV B;  4HAT B;  2GCJ A;  1XKE A;  2M38 A;  3SV1 A;  4A6K A;  1U5F A;  1U5E A;  2YT1 A;  1LB1 A;  4GZU A;  2N23 A;  3KY9 A;  4CYE A;  2J0M A;  4MK0 A;  1UNQ A;  4GXB A;  3KRW A;  1Y5O A;  3P7Z A;  2RSG A;  1TQZ A;  4PQ0 A;  3SNH A;  4NSW A;  5LON B;  5D3V A;  2RLO A;  2J59 M;  1FHW A;  3KZ1 A;  4PNK A;  1ZVR A;  4HAY B;  2NZ8 B;  1E5W A;  4DX8 A;  4YL8 A;  1M7R A;  1V5U A;  2I1K A;  2RNR B;  2YRY A;  2Z0O A;  5D3Y A;  1NTY A;  4Y94 A;  2KUP A;  3N7C A;  1AQC A;  4EKU A;  1KI1 B;  1TXD A;  2VRW B;  2X18 A;  5JHH A;  3DXD A;  1I7A A;  2EJ8 A;  1FB8 A;  4HB4 B;  4DBB A;  1DRO A;  5KQ4 A;  2Z0Q A;  2I5C A;  4ZRK A;  3VIA A;  3TFM A;  5EFX A;  4Z2M B;  1KZ7 A;  3TW1 A;  1EAZ A;  2Y8F A;  3PSC A;  2DHJ A;  2J0K A;  2LKO A;  5C6R A;  5JP4 A;  3IVF A;  1XOD A;  3FEH A;  1WGQ A;  1ZC4 B;  2EC1 A;  1BAK A;  1OQN A;  2LOZ A;  2QKL A;  1FGY A;  2LOX A;  3BIN A;  1XR0 B;  3MDB C;  2W2X D;  1FGZ A;  2GS0 A;  3LJU X;  3SUZ A;  3ZDT A;  3WYF B;  1GC6 A;  3V5W A;  2CAY A;  3TO1 A;  1WG7 A;  1FHX A;  2KGX B;  1V88 A;  1V61 A;  3QBV B;  2OTX A;  5DHF B;  4ZRJ A;  4F7H A;  4CHM A;  2R09 A;  2DTC A;  2IFS A;  4F7G A;  3KRX A;  5JHG A;  1J0W A;  1NTV A;  3PVW A;  2AL6 A;  5HE0 A;  4GMX B;  1GC7 A;  1DDM A;  3AU5 A;  2CRF A;  5HE2 A;  4IFS A;  2K2J A;  2VSZ A;  1U27 A;  3SYX A;  3TCA A;  2IYB A;  4KVG B;  1U2B A;  1UEF A;  2PZ1 A;  1I2H A;  3GYO A;  4C0A A;  1H10 A;  2COD A;  2COF A;  2GCL A;  1WGU A;  1FAO A;  3ZVR A;  4GPT B;  2DYN A;  5FI1 A;  2KCJ A;  5DH9 B;  2EMT A;  1V5P A;  1LW3 A;  2YSZ A;  2QKM A;  3RCP A;  3KSY A;  1XCG A;  2UZR A;  4HHV A;  1NI2 A;  2M14 A;  4ZRI A;  3DXC A;  4YON A;  2D9W A;  2UZS A;  1U5D A;  2EMS A;  1EVH A;  5KQ1 A;  4XWX A;  2HE7 A;  1W1D A;  2K00 A;  5J3Q A;  3A8Q A;  3M1I B;  1DBH A;  2W2X C;  5HE3 A;  2ROZ B;  1P5T A;  2Q13 A;  1MK9 B;  2DLW A;  4HAZ B;  3AU4 A;  5JLJ B;  3HW2 B;  4EJN A;  2H7E A;  5J3Y A;  3CXB B;  1W1G A;  2DX1 A;  2MFQ A;  2DHK A;  5C16 A;  5DIF B;  4HB3 B;  2MWN B;  4GN1 A;  1IRS A;  1PFJ A;  4A6H A;  1AWE A;  4HAW B;  2ZPY A;  3HQC A;  3U8Z A;  5LOP B;  5D27 A;  3PZD A;  1KZG A;  4EMO A;  4DX9 0;  2DYQ A;  2D9V A;  3ODX A;  1MPH A;  4HDQ A;  3P6A A;  5DI9 B;  4HDO A;  2XQN M;  2W2W A;  5D3W A;  5KCV A;  1QQG A;  3O96 A;  2DA0 A;  1ZC3 B;  5CLL B;  2D10 A;  1P3R A;  2VKI A;  2BCJ A;  4L6E A;  1EF1 A;  2FJL A;  2NMB A;  3UZT A;  1WJ1 A;  2N0Y A;  4TKN A;  1FOE A;  3WA0 A;  3PP2 A;  2GJY A;  4Z2N A;  1Z87 A;  3ULC A;  5C79 A;  3D8E A;  1ZM0 A;  1V89 A;  4KHB B;  5FI0 A;  4GMV A;  1PLS A;  2YS5 A;  1BTN A;  2RUK B;  4MY6 A;  4P7I A;  1TJ6 A;  1J19 A;  1K5D B;  4IAP A;  2P0D A;  2YS1 A;  4K2O A;  2LUL A;  2COC A;  4WJ7 A;  1UNP A;  1OY2 A;  1BTK A;  4K17 A;  2COA A;  1W1H A;  2YVC A;  3D8F A;  1MAI A;  2J0J A;  3A8P A;  4HAX B;  2I5F A;  3QWM A;  2K2U A;  3DXE A;  3AJ4 A;  3HK0 A;  4KAX B;  1DYN A;  2LG1 A;  3A98 B;  1SGH A;  3NSU A;  2RVB B;  1DDV A;  2CY4 A;  1V5M A;  1WI1 A;  3PVL A;  3ODO A;  1ISN A;  2ADZ A;  5CLQ B;  1K5G B;  4TYZ A;  1U29 A;  2E2X A;  2D9Y A;  3ML4 A;  3TVV A;  2L1C A;  1UPQ A;  2RGN B;  1XX0 A;  2MDX A;  3X23 A;  1X86 A;  2D9X A;  1UPR A;  4NY0 A;  1ZSQ A;  2V76 A;  4HB2 B;  2D4Q A;  1X1F A;  2L2I A;  1SHC A;  4H8S A;  1PMS A;  4B6H A;  2R0D A;  2MKR A;  4HAU B;  2YS3 A;  3F0W A;  3GYP A;  2DKQ A;  1H4R A;  1M7E A;  2UVM A;  1WJM A;  1MIZ B;  4KHA A;  1RRP B;  5GOW B;  3CIK A;  1DDW A;  1N3H A;  3ODW A;  1B55 A;  1MKE A;  2DX5 A;  1X1G A;  2D11 A;  1P6S A;  2P0F A;  2ELA A;  1MK7 B;  2LYD A;  3BJI A;  4HB0 B;  2I1J A;  2ROV A;  2P8V A;  1UNR A;  2DKP A;  2Y8G A;  3PEG A;  3U7D A;  5L81 A;  5DHA B;  2H7D A;  1Y19 B;  3OAN A;  4WSF A;  2YT0 A;  1QC6 A;  4KHO A;  2D2Q A;  4BBK A;  3PVU A;  1U5G A;  3D8D A;  3FSS A;  1WVH A;  4A5K A;  4D0N B;  3FM8 C;  1FHO A;  4K2P A;  3QIJ A;  2G35 A;  2D9Z A;  3MPX A;  1X05 A;  2Z0P A;  1EGX A;  1GG3 A;  2JP2 A;  1X11 A;  1BWN A;  2CY5 A;  2DFK A;  5C5B B;  2P0H A;  3SO6 A;  4A6F B;  3PG7 A;  2Y7B A;  1MIX A;  2DHI A;  1RJ2 A;  4K81 A;  5J3T A;  5D3X A;  1OMW A;  3F5R A;  4CHJ A;  4IOY X;  5HE1 A;  1Q67 A;  1NU2 A;  3G9W A;  3ULB A;  3VOQ A;  2HTH B;  4WVF B;  3T06 A;  2ELB A;  4F7U P;  2AEH A;  2DN6 A;  2YF0 A;  2OQB A;  4DXA B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...