1AQCA

X11 ptb domain-10mer peptide complex
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
166
structure length
130
Chain Sequence
MEDLIDGIIFAANYLGSTQLLSDKTPSKNVRMMQAQEAVSRIKMAQKLMTEVDLFILTQRIKVLNADTQETMMDHPLRTISYIADIGNIVVLMARRRYKMICHVFESEDAQLIAQSIGQAFSVAYQEFLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Complex (peptide binding module/peptide)
molecule keywords X11
publication title Sequence-specific recognition of the internalization motif of the Alzheimer's amyloid precursor protein by the X11 PTB domain.
pubmed doi rcsb
source organism Homo sapiens
total genus 30
structure length 130
sequence length 166
chains with identical sequence B
ec nomenclature
pdb deposition date 1997-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00640 PID Phosphotyrosine interaction domain (PTB/PID)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1aqcA00
4HAYB 1NI2A 2P0FA 2Z0QA 2DKPA 4HAUB 1DDVA 5D3YA 4XWXA 1I7AA 1NTVA 3ULCA 3GYOA 2OTXA 1EAZA 1WJMA 3MDBC 4A6KA 1N3HA 1ZC4B 2K00A 1DDWA 2DHIA 2VKIA 1TXDA 2AL6A 4GXBA 1BWNA 1V5MA 4GMXB 2J0KA 1SGHA 2BCJA 3SV1A 2H7DA 2KUPA 2ROZB 2DN6A 1V61A 1DDMA 3A98B 2LOZA 4HHVA 2X18A 2J59M 5J3YA 4DX90 1XKEA 2Y8GA 1TJ6A 3X23A 2ADZA 1EF1A 2D2QA 1W1HA 1KZGA 4KHBB 3PZDA 2MKRA 2RGNB 4NSWA 2R09A 1SHCA 2EJ8A 3LJUX 2CODA 4A5KA 2DFKA 3AJ4A 4HDQA 1W1GA 3AU5A 1FOEA 2N0YA 2CY5A 2N23A 5HE3A 2P0DA 3WYFB 2M38A 4EJNA 5C79A 2KCJA 2LKOA 4KHAA 1BAKA 2NZ8B 5KCVA 4GMVA 4IFSA 2DTCA 2D10A 4YL8A 1DROA 3RCPA 1QQGA 1J0WA 2R0DA 3AU4A 2FJLA 2J0MA 2XQNM 5DH9B 3P7ZA 3SO6A 1U5FA 1NTYA 2I1KA 1XODA 2VSZA 5D27A 1ISNA 1Z87A 4GPTB 3TW1A 1FGZA 3CIKA 5LOPB 4A6HA 2CY4A 1EVHA 3O96A 2CRFA 5JHHA 3TCAA 4ZRJA 3N7CA 2P0HA 2Z0PA 3OANA 1FAOA 4HAWB 4DBBA 2LYDA 2RSGA 2D9VA 4ZRIA 1WJ1A 2GCLA 5D3VA 1TQZA 4HAXB 4HB2B 2YF0A 4GZUA 2GJYA 1LB1A 2EMSA 2I5FA 2D11A 3CXBB 1OY2A 1UNPA 1GC7A 2YRYA 3KRXA 5DIFB 2LOXA 4ZRKA 3ML4A 3U7DA 1U5GA 3PVLA 3BJIA 4IOYX 3QBVB 3WA0A 1FHOA 4HB3B 1FHXA 3PG7A 2UVMA 1ZC3B 3F0WA 5CLQB 3GYPA 1UNRA 4D0NB 1PLSA 5C16A 1WVHA 1X86A 2D9WA 1XX0A 3KRWA 4K2OA 1H10A 4Z2MB 4F7HA 2D9ZA 1UPQA 1MKEA 4HAVB 4H8SA 1E5WA 1U29A 2M14A 3VOQA 4K2PA 5KQ4A 2PZ1A 3A8PA 1MAIA 2YSZA 3M1IB 4HAZB 5LONB 1W1DA 1FGYA 3QWMA 4MT7A 5GOWB 2JP2A 1UEFA 5EFXA 2P8VA 2YT0A 3D8EA 1OMWA 2I5CA 5J3QA 3G9WA 3FM8C 5D3WA 2E2XA 1WG7A 1V5UA 2IYBA 1U5DA 1XR0B 1BTNA 2ELAA 5L81A 5JLJB 1Y19B 4YONA 2Y7BA 2YS1A 4P7IA 3SNHA 3F5RA 4PNKA 2DX5A 2J0JA 2HTHB 4PQ0A 1MPHA 5JP4A 1Y5OA 2DLWA 4CHMA 2I1JA 5DHAB 2VRWB 2DHJA 1DBHA 4MY6A 4DX8A 4MK0A 2Y8FA 4KAXB 2H7EA 5C5BB 1H4RA 1PFJA 1MIXA 1V88A 2W2XD 1MK9B 2LG1A 3QIJA 2L2IA 5C6RA 2NMBA 2DYQA 4NY0A 4A6FA 1X11A 4DXAB 2QKLA 1X05A 1K5DB 1XCGA 4IAPA 4HB4B 2COFA 2G35A 1B55A 4F7GA 2KGXB 2MFQA 1NU2A 2RUKB 3DXEA 3KSYA 3UZTA 1AWEA 3DXCA 5J3TA 2YVCA 4CYEA 4TYZA 4EMOA 3TVVA 1MIZB 1PMSA 2ZPYA 1P6SA 3KY9A 1UNQA 5HE1A 3U8ZA 2EMTA 2AEHA 3IVFA 1I2HA 3D8FA 2RNRB 1WI1A 1DYNA 2LULA 3PVWA 2DA0A 1RJ2A 1V89A 2UZSA 1FHWA 2W2XC 1X1GA 2COAA 3HW2B 4WVFB 2DYNA 4F7UP 2GCJA 3ZVRA 3BINA 3TO1A 3SUZA 5FI1A 4HATB 1FB8A 3A8QA 3PEGA 2DX1A 3HQCA 1IRSA 1LW3A 1EGXA 4B6HA 1Q67A 1OQNA 3V5WA 2RLOA 2QKMA 1GC6A 2ROVA 2COCA 2YT1A 3SYXA 2EC1A 2D9XA 5DI9B 3T06A 3D8DA 3DXDA 5DHFB 2HE7A 5KQ1A 2UZRA 1U5EA 1U27A 2MWNB 4K17A 5FI0A 4WSFA 2OQBA 2Q13A 3ZDTA 1ZSQA 4Y94A 3VIAA 1UPRA 4KHOA 4GN1A 2K2UA 3PSCA 3MPXA 1XD4A 3PP2A 3ODWA 4L6EA 2MDXA 3ULBA 4BBKA 1U2BA 4A6FB 3KZ1A 4WJ7A 1J19A 3NSUA 5HE0A 4Z2NA 1RRPB 1M7EA 1WGQA 2YS3A 5D3XA 1X1FA 4HB0B 2CAYA 4EKUA 2DHKA 2L1CA 4C0AA 1BTKA 1KI1B 3P6AA 3PVUA 1V5PA 5HE2A 1AQCA 2K2JA 1P5TA 2YS5A 1P3RA 5CLLB 4K81A 2W2WA 2Z0OA 2D9YA 1QC6A 3ODOA 1K5GB 1MK7B 4HDOA 2IFSA 1WGUA 1M7RA 2DKQA 5JHGA 3TFMA 1ZVRA 4CHJA 3FEHA 1KZ7A 3FSSA 5C5BA 2D4QA 4KVGB 1ZM0A 2ELBA 4TKNA 3HK0A 2RVBB 3ODXA 2V76A 1GG3A 2GS0A
chains in the Genus database with same CATH superfamily
4HAYB 1NI2A 2P0FA 2Z0QA 2DKPA 4HAUB 1DDVA 5D3YA 4XWXA 1I7AA 2NBVA 1NTVA 3ULCA 3GYOA 2OTXA 1EAZA 1WJMA 3MDBC 4A6KA 1N3HA 1ZC4B 2K00A 1DDWA 2DHIA 2VKIA 1TXDA 2AL6A 4GXBA 1BWNA 1V5MA 4GMXB 2J0KA 1SGHA 2BCJA 3SV1A 2H7DA 2KUPA 2ROZB 2DN6A 1V61A 1DDMA 3A98B 2LOZA 4HHVA 2X18A 2J59M 5J3YA 3U12A 4CSQA 4DX90 1XKEA 2Y8GA 1TJ6A 3X23A 2ADZA 1EF1A 2D2QA 1W1HA 1KZGA 4KHBB 4QXAB 2K8EA 3PZDA 2MKRA 2RGNB 4NSWA 2R09A 1SHCA 2EJ8A 2YT2A 2CODA 3LJUX 4A5KA 2DFKA 3AJ4A 4HDQA 1W1GA 3AU5A 3A58A 2Z14A 1FOEA 2N0YA 2CY5A 2ZKMX 2N23A 2RRFA 5HE3A 2P0DA 3WYFB 2M38A 4EJNA 5C79A 2KCJA 2LKOA 4KHAA 1BAKA 2NZ8B 5KCVA 4GMVA 4IFSA 2DTCA 2D10A 4YL8A 4QJ5B 5LG4B 1DROA 3RCPA 1QQGA 1J0WA 2R0DA 3AU4A 2FJLA 2J0MA 2XQNM 5DH9B 3NWDA 3P7ZA 3SO6A 2Z59A 1U5FA 1NTYA 2I1KA 1XODA 2VSZA 5D27A 1ISNA 1Z87A 3HSAA 4GPTB 3TW1A 1FGZA 3CIKA 5LOPB 4A6HA 2CY4A 1EVHA 3O96A 2CRFA 5JHHA 3TCAA 5I2SA 4ZRJA 3N7CA 2P0HA 2Z0PA 3OANA 1FAOA 4HAWB 4DBBA 2LYDA 1ZYIA 2RSGA 2D9VA 4ZRIA 1WJ1A 2GCLA 5D3VA 1TQZA 4HAXB 4HB2B 4D6WA 2YF0A 4GZUA 2GJYA 1LB1A 2EMSA 2I5FA 2D11A 3CXBB 1OY2A 1UNPA 1GC7A 3NWFA 2YRYA 2Z4DA 3KRXA 5DIFB 2LOXA 4ZRKA 4GNKB 3ML4A 3U7DA 1U5GA 3PVLA 3BJIA 4IOYX 3QBVB 3OHMB 3WA0A 1FHOA 4HB3B 1FHXA 3PG7A 2UVMA 1ZC3B 3F0WA 5CLQB 3GYPA 1UNRA 4D0NB 5M4YB 1PLSA 5C16A 1WVHA 1X86A 2D9WA 1XX0A 3KRWA 2K49A 4K2OA 1H10A 4Z2MB 4F7HA 2D9ZA 1UPQA 1MKEA 4HAVB 4H8SA 4DIXA 1E5WA 1U29A 2M14A 3VOQA 4K2PA 5KQ4A 2PZ1A 3A8PA 1MAIA 2YSZA 3M1IB 4HAZB 5LONB 1W1DA 1FGYA 3QWMA 4MT7A 5GOWB 2JP2A 1UEFA 5EFXA 2P8VA 2YT0A 3D8EA 1OMWA 2I5CA 5J3QA 3G9WA 3FM8C 5D3WA 2E2XA 1WG7A 1V5UA 2IYBA 1U5DA 1XR0B 1BTNA 2ELAA 5L81A 5JLJB 1Y19B 4YONA 2Y7BA 2YS1A 4P7IA 3SNHA 3F5RA 4PNKA 2DX5A 2J0JA 2HTHB 4PQ0A 1MPHA 3DCXA 5JP4A 1Y5OA 2DLWA 4GOUA 4CHMA 2I1JA 5DHAB 2VRWB 2DHJA 4KHBA 1DBHA 4MY6A 4DX8A 4MK0A 2Y8FA 4KAXB 2H7EA 5IRSA 5C5BB 1H4RA 1PFJA 1MIXA 1V88A 2W2XD 1MK9B 2LG1A 3QIJA 4HSIA 2L2IA 4OT1A 5C6RA 2NMBA 2DYQA 4NY0A 4A6FA 1X11A 4DXAB 5I2MA 2QKLA 1X05A 1K5DB 1XCGA 4IAPA 4HB4B 2COFA 2G35A 1B55A 4F7GA 2KGXB 2MFQA 1NU2A 2RUKB 3DXEA 3KSYA 3UZTA 1AWEA 3DXCA 5J3TA 2YVCA 4CYEA 4TYZA 4EMOA 3TVVA 1MIZB 1PMSA 2ZPYA 1P6SA 3KY9A 1UNQA 5HE1A 3U8ZA 2EMTA 2AEHA 3IVFA 1I2HA 4QJ4B 4L1RA 3D8FA 1T77A 2RNRB 3NWAA 1WI1A 1DYNA 2LULA 3PVWA 2DA0A 1RJ2A 1V89A 2UZSA 1FHWA 2W2XC 1X1GA 2R2YA 2COAA 3HW2B 4WVFB 2DYNA 2FJUB 4F7UP 2GCJA 3ZVRA 3BINA 3TO1A 3SUZA 5FI1A 4HATB 3NW8A 1FB8A 3A8QA 3PEGA 2DX1A 3HQCA 1IRSA 1LW3A 1EGXA 4OSNA 4B6HA 1Q67A 1OQNA 3V5WA 2RLOA 2QKMA 1GC6A 2ROVA 2COCA 2YT1A 3SYXA 2EC1A 2D9XA 5DI9B 3T06A 3D8DA 3DXDA 5DHFB 2HE7A 5KQ1A 2UZRA 1U5EA 1U27A 2MWNB 4K17A 5FI0A 4WSFA 2OQBA 2Q13A 3ZDTA 1ZSQA 4Y94A 3VIAA 1UPRA 4KHOA 4GN1A 2K2UA 3PSCA 3MPXA 1XD4A 3PP2A 3ODWA 4L6EA 2MDXA 3ULBA 4BBKA 2KR0A 1U2BA 4A6FB 3KZ1A 4WJ7A 1J19A 3NSUA 5HE0A 4Z2NA 3HIEA 1RRPB 1M7EA 1WGQA 2YS3A 5D3XA 1X1FA 4HB0B 2CAYA 4EKUA 2DHKA 2L1CA 4C0AA 3B77A 1BTKA 1KI1B 3P6AA 3PVUA 1V5PA 2GUMA 5HE2A 1AQCA 2K2JA 1P5TA 2YS5A 1P3RA 5CLLB 4K81A 2W2WA 2Z0OA 2D9YA 1QC6A 3ODOA 2KUQA 1K5GB 1MK7B 4HDOA 2IFSA 1WGUA 1M7RA 2KIEA 2KIGA 2DKQA 2Z13A 3FVCA 5JHGA 3TFMA 1ZVRA 4CHJA 3FEHA 1KZ7A 1MI1A 3FSSA 5C5BA 2D4QA 4KVGB 1ZM0A 2ELBA 4TKNA 3HK0A 2RVBB 3ODXA 2V76A 4QJ3B 1GG3A 2GS0A
chains in the Genus database with same CATH topology
4HAYB 1NI2A 2P0FA 2Z0QA 2DKPA 4HAUB 1DDVA 5D3YA 4XWXA 1I7AA 1NTVA 3ULCA 3GYOA 2OTXA 1EAZA 1WJMA 3MDBC 4A6KA 1N3HA 1ZC4B 2K00A 1DDWA 2DHIA 2VKIA 1TXDA 2AL6A 4GXBA 1BWNA 1V5MA 4GMXB 2J0KA 1SGHA 2BCJA 3SV1A 2H7DA 2KUPA 2ROZB 2DN6A 1V61A 1DDMA 3A98B 2LOZA 4HHVA 2X18A 2J59M 5J3YA 4DX90 1XKEA 2Y8GA 1TJ6A 3X23A 2ADZA 1EF1A 2D2QA 1W1HA 1KZGA 4KHBB 3PZDA 2MKRA 2RGNB 4NSWA 2R09A 1SHCA 2EJ8A 3LJUX 2CODA 4A5KA 2DFKA 3AJ4A 4HDQA 1W1GA 3AU5A 1FOEA 2N0YA 2CY5A 2N23A 5HE3A 2P0DA 3WYFB 2M38A 4EJNA 5C79A 2KCJA 2LKOA 4KHAA 1BAKA 2NZ8B 5KCVA 4GMVA 4IFSA 2DTCA 2D10A 4YL8A 1DROA 3RCPA 1QQGA 1J0WA 2R0DA 3AU4A 2FJLA 2J0MA 2XQNM 5DH9B 3P7ZA 3SO6A 1U5FA 1NTYA 2I1KA 1XODA 2VSZA 5D27A 1ISNA 1Z87A 4GPTB 3TW1A 1FGZA 3CIKA 5LOPB 4A6HA 2CY4A 1EVHA 3O96A 2CRFA 5JHHA 3TCAA 4ZRJA 3N7CA 2P0HA 2Z0PA 3OANA 1FAOA 4HAWB 4DBBA 2LYDA 2RSGA 2D9VA 4ZRIA 1WJ1A 2GCLA 5D3VA 1TQZA 4HAXB 4HB2B 2YF0A 4GZUA 2GJYA 1LB1A 2EMSA 2I5FA 2D11A 3CXBB 1OY2A 1UNPA 1GC7A 2YRYA 3KRXA 5DIFB 2LOXA 4ZRKA 3ML4A 3U7DA 1U5GA 3PVLA 3BJIA 4IOYX 3QBVB 3WA0A 1FHOA 4HB3B 1FHXA 3PG7A 2UVMA 1ZC3B 3F0WA 5CLQB 3GYPA 1UNRA 4D0NB 1PLSA 5C16A 1WVHA 1X86A 2D9WA 1XX0A 3KRWA 4K2OA 1H10A 4Z2MB 4F7HA 2D9ZA 1UPQA 1MKEA 4HAVB 4H8SA 1E5WA 1U29A 2M14A 3VOQA 4K2PA 5KQ4A 2PZ1A 3A8PA 1MAIA 2YSZA 3M1IB 4HAZB 5LONB 1W1DA 1FGYA 3QWMA 4MT7A 5GOWB 2JP2A 1UEFA 5EFXA 2P8VA 2YT0A 3D8EA 1OMWA 2I5CA 5J3QA 3G9WA 3FM8C 5D3WA 2E2XA 1WG7A 1V5UA 2IYBA 1U5DA 1XR0B 1BTNA 2ELAA 5L81A 5JLJB 1Y19B 4YONA 2Y7BA 2YS1A 4P7IA 3SNHA 3F5RA 4PNKA 2DX5A 2J0JA 2HTHB 4PQ0A 1MPHA 5JP4A 1Y5OA 2DLWA 4CHMA 2I1JA 5DHAB 2VRWB 2DHJA 1DBHA 4MY6A 4DX8A 4MK0A 2Y8FA 4KAXB 2H7EA 5C5BB 1H4RA 1PFJA 1MIXA 1V88A 2W2XD 1MK9B 2LG1A 3QIJA 2L2IA 5C6RA 2NMBA 2DYQA 4NY0A 4A6FA 1X11A 4DXAB 2QKLA 1X05A 1K5DB 1XCGA 4IAPA 4HB4B 2COFA 2G35A 1B55A 4F7GA 2KGXB 2MFQA 1NU2A 2RUKB 3DXEA 3KSYA 3UZTA 1AWEA 3DXCA 5J3TA 2YVCA 4CYEA 4TYZA 4EMOA 3TVVA 1MIZB 1PMSA 2ZPYA 1P6SA 3KY9A 1UNQA 5HE1A 3U8ZA 2EMTA 2AEHA 3IVFA 1I2HA 3D8FA 2RNRB 1WI1A 1DYNA 2LULA 3PVWA 2DA0A 1RJ2A 1V89A 2UZSA 1FHWA 2W2XC 1X1GA 2COAA 3HW2B 4WVFB 2DYNA 4F7UP 2GCJA 3ZVRA 3BINA 3TO1A 3SUZA 5FI1A 4HATB 1FB8A 3A8QA 3PEGA 2DX1A 3HQCA 1IRSA 1LW3A 1EGXA 4B6HA 1Q67A 1OQNA 3V5WA 2RLOA 2QKMA 1GC6A 2ROVA 2COCA 2YT1A 3SYXA 2EC1A 2D9XA 5DI9B 3T06A 3D8DA 3DXDA 5DHFB 2HE7A 5KQ1A 2UZRA 1U5EA 1U27A 2MWNB 4K17A 5FI0A 4WSFA 2OQBA 2Q13A 3ZDTA 1ZSQA 4Y94A 3VIAA 1UPRA 4KHOA 4GN1A 2K2UA 3PSCA 3MPXA 1XD4A 3PP2A 3ODWA 4L6EA 2MDXA 3ULBA 4BBKA 1U2BA 4A6FB 3KZ1A 4WJ7A 1J19A 3NSUA 5HE0A 4Z2NA 1RRPB 1M7EA 1WGQA 2YS3A 5D3XA 1X1FA 4HB0B 2CAYA 4EKUA 2DHKA 2L1CA 4C0AA 1BTKA 1KI1B 3P6AA 3PVUA 1V5PA 5HE2A 1AQCA 2K2JA 1P5TA 2YS5A 1P3RA 5CLLB 4K81A 2W2WA 2Z0OA 2D9YA 1QC6A 3ODOA 1K5GB 1MK7B 4HDOA 2IFSA 1WGUA 1M7RA 2DKQA 5JHGA 3TFMA 1ZVRA 4CHJA 3FEHA 1KZ7A 3FSSA 5C5BA 2D4QA 4KVGB 1ZM0A 2ELBA 4TKNA 3HK0A 2RVBB 3ODXA 2V76A 1GG3A 2GS0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HAY B;  1NI2 A;  2P0F A;  2Z0Q A;  2DKP A;  4HAU B;  1DDV A;  5D3Y A;  4XWX A;  1I7A A;  1NTV A;  3ULC A;  3GYO A;  2OTX A;  1EAZ A;  1WJM A;  3MDB C;  4A6K A;  1N3H A;  1ZC4 B;  2K00 A;  1DDW A;  2DHI A;  2VKI A;  1TXD A;  2AL6 A;  4GXB A;  1BWN A;  1V5M A;  4GMX B;  2J0K A;  1SGH A;  2BCJ A;  3SV1 A;  2H7D A;  2KUP A;  2ROZ B;  2DN6 A;  1V61 A;  1DDM A;  3A98 B;  2LOZ A;  4HHV A;  2X18 A;  2J59 M;  5J3Y A;  4DX9 0;  1XKE A;  2Y8G A;  1TJ6 A;  3X23 A;  2ADZ A;  1EF1 A;  2D2Q A;  1W1H A;  1KZG A;  4KHB B;  3PZD A;  2MKR A;  2RGN B;  4NSW A;  2R09 A;  1SHC A;  2EJ8 A;  3LJU X;  2COD A;  4A5K A;  2DFK A;  3AJ4 A;  4HDQ A;  1W1G A;  3AU5 A;  1FOE A;  2N0Y A;  2CY5 A;  2N23 A;  5HE3 A;  2P0D A;  3WYF B;  2M38 A;  4EJN A;  5C79 A;  2KCJ A;  2LKO A;  4KHA A;  1BAK A;  2NZ8 B;  5KCV A;  4GMV A;  4IFS A;  2DTC A;  2D10 A;  4YL8 A;  1DRO A;  3RCP A;  1QQG A;  1J0W A;  2R0D A;  3AU4 A;  2FJL A;  2J0M A;  2XQN M;  5DH9 B;  3P7Z A;  3SO6 A;  1U5F A;  1NTY A;  2I1K A;  1XOD A;  2VSZ A;  5D27 A;  1ISN A;  1Z87 A;  4GPT B;  3TW1 A;  1FGZ A;  3CIK A;  5LOP B;  4A6H A;  2CY4 A;  1EVH A;  3O96 A;  2CRF A;  5JHH A;  3TCA A;  4ZRJ A;  3N7C A;  2P0H A;  2Z0P A;  3OAN A;  1FAO A;  4HAW B;  4DBB A;  2LYD A;  2RSG A;  2D9V A;  4ZRI A;  1WJ1 A;  2GCL A;  5D3V A;  1TQZ A;  4HAX B;  4HB2 B;  2YF0 A;  4GZU A;  2GJY A;  1LB1 A;  2EMS A;  2I5F A;  2D11 A;  3CXB B;  1OY2 A;  1UNP A;  1GC7 A;  2YRY A;  3KRX A;  5DIF B;  2LOX A;  4ZRK A;  3ML4 A;  3U7D A;  1U5G A;  3PVL A;  3BJI A;  4IOY X;  3QBV B;  3WA0 A;  1FHO A;  4HB3 B;  1FHX A;  3PG7 A;  2UVM A;  1ZC3 B;  3F0W A;  5CLQ B;  3GYP A;  1UNR A;  4D0N B;  1PLS A;  5C16 A;  1WVH A;  1X86 A;  2D9W A;  1XX0 A;  3KRW A;  4K2O A;  1H10 A;  4Z2M B;  4F7H A;  2D9Z A;  1UPQ A;  1MKE A;  4HAV B;  4H8S A;  1E5W A;  1U29 A;  2M14 A;  3VOQ A;  4K2P A;  5KQ4 A;  2PZ1 A;  3A8P A;  1MAI A;  2YSZ A;  3M1I B;  4HAZ B;  5LON B;  1W1D A;  1FGY A;  3QWM A;  4MT7 A;  5GOW B;  2JP2 A;  1UEF A;  5EFX A;  2P8V A;  2YT0 A;  3D8E A;  1OMW A;  2I5C A;  5J3Q A;  3G9W A;  3FM8 C;  5D3W A;  2E2X A;  1WG7 A;  1V5U A;  2IYB A;  1U5D A;  1XR0 B;  1BTN A;  2ELA A;  5L81 A;  5JLJ B;  1Y19 B;  4YON A;  2Y7B A;  2YS1 A;  4P7I A;  3SNH A;  3F5R A;  4PNK A;  2DX5 A;  2J0J A;  2HTH B;  4PQ0 A;  1MPH A;  5JP4 A;  1Y5O A;  2DLW A;  4CHM A;  2I1J A;  5DHA B;  2VRW B;  2DHJ A;  1DBH A;  4MY6 A;  4DX8 A;  4MK0 A;  2Y8F A;  4KAX B;  2H7E A;  5C5B B;  1H4R A;  1PFJ A;  1MIX A;  1V88 A;  2W2X D;  1MK9 B;  2LG1 A;  3QIJ A;  2L2I A;  5C6R A;  2NMB A;  2DYQ A;  4NY0 A;  4A6F A;  1X11 A;  4DXA B;  2QKL A;  1X05 A;  1K5D B;  1XCG A;  4IAP A;  4HB4 B;  2COF A;  2G35 A;  1B55 A;  4F7G A;  2KGX B;  2MFQ A;  1NU2 A;  2RUK B;  3DXE A;  3KSY A;  3UZT A;  1AWE A;  3DXC A;  5J3T A;  2YVC A;  4CYE A;  4TYZ A;  4EMO A;  3TVV A;  1MIZ B;  1PMS A;  2ZPY A;  1P6S A;  3KY9 A;  1UNQ A;  5HE1 A;  3U8Z A;  2EMT A;  2AEH A;  3IVF A;  1I2H A;  3D8F A;  2RNR B;  1WI1 A;  1DYN A;  2LUL A;  3PVW A;  2DA0 A;  1RJ2 A;  1V89 A;  2UZS A;  1FHW A;  2W2X C;  1X1G A;  2COA A;  3HW2 B;  4WVF B;  2DYN A;  4F7U P;  2GCJ A;  3ZVR A;  3BIN A;  3TO1 A;  3SUZ A;  5FI1 A;  4HAT B;  1FB8 A;  3A8Q A;  3PEG A;  2DX1 A;  3HQC A;  1IRS A;  1LW3 A;  1EGX A;  4B6H A;  1Q67 A;  1OQN A;  3V5W A;  2RLO A;  2QKM A;  1GC6 A;  2ROV A;  2COC A;  2YT1 A;  3SYX A;  2EC1 A;  2D9X A;  5DI9 B;  3T06 A;  3D8D A;  3DXD A;  5DHF B;  2HE7 A;  5KQ1 A;  2UZR A;  1U5E A;  1U27 A;  2MWN B;  4K17 A;  5FI0 A;  4WSF A;  2OQB A;  2Q13 A;  3ZDT A;  1ZSQ A;  4Y94 A;  3VIA A;  1UPR A;  4KHO A;  4GN1 A;  2K2U A;  3PSC A;  3MPX A;  1XD4 A;  3PP2 A;  3ODW A;  4L6E A;  2MDX A;  3ULB A;  4BBK A;  1U2B A;  4A6F B;  3KZ1 A;  4WJ7 A;  1J19 A;  3NSU A;  5HE0 A;  4Z2N A;  1RRP B;  1M7E A;  1WGQ A;  2YS3 A;  5D3X A;  1X1F A;  4HB0 B;  2CAY A;  4EKU A;  2DHK A;  2L1C A;  4C0A A;  1BTK A;  1KI1 B;  3P6A A;  3PVU A;  1V5P A;  5HE2 A;  1AQC A;  2K2J A;  1P5T A;  2YS5 A;  1P3R A;  5CLL B;  4K81 A;  2W2W A;  2Z0O A;  2D9Y A;  1QC6 A;  3ODO A;  1K5G B;  1MK7 B;  4HDO A;  2IFS A;  1WGU A;  1M7R A;  2DKQ A;  5JHG A;  3TFM A;  1ZVR A;  4CHJ A;  3FEH A;  1KZ7 A;  3FSS A;  5C5B A;  2D4Q A;  4KVG B;  1ZM0 A;  2ELB A;  4TKN A;  3HK0 A;  2RVB B;  3ODX A;  2V76 A;  1GG3 A;  2GS0 A; 
#chains in the Genus database with same CATH topology
 4HAY B;  1NI2 A;  2P0F A;  2Z0Q A;  2DKP A;  4HAU B;  1DDV A;  5D3Y A;  4XWX A;  1I7A A;  2NBV A;  1NTV A;  3ULC A;  3GYO A;  2OTX A;  1EAZ A;  1WJM A;  3MDB C;  4A6K A;  1N3H A;  1ZC4 B;  2K00 A;  1DDW A;  2DHI A;  2VKI A;  1TXD A;  2AL6 A;  4GXB A;  1BWN A;  1V5M A;  4GMX B;  2J0K A;  1SGH A;  2BCJ A;  3SV1 A;  2H7D A;  2KUP A;  2ROZ B;  2DN6 A;  1V61 A;  1DDM A;  3A98 B;  2LOZ A;  4HHV A;  2X18 A;  2J59 M;  5J3Y A;  3U12 A;  4CSQ A;  4DX9 0;  1XKE A;  2Y8G A;  1TJ6 A;  3X23 A;  2ADZ A;  1EF1 A;  2D2Q A;  1W1H A;  1KZG A;  4KHB B;  4QXA B;  2K8E A;  3PZD A;  2MKR A;  2RGN B;  4NSW A;  2R09 A;  1SHC A;  2EJ8 A;  2YT2 A;  2COD A;  3LJU X;  4A5K A;  2DFK A;  3AJ4 A;  4HDQ A;  1W1G A;  3AU5 A;  3A58 A;  2Z14 A;  1FOE A;  2N0Y A;  2CY5 A;  2ZKM X;  2N23 A;  2RRF A;  5HE3 A;  2P0D A;  3WYF B;  2M38 A;  4EJN A;  5C79 A;  2KCJ A;  2LKO A;  4KHA A;  1BAK A;  2NZ8 B;  5KCV A;  4GMV A;  4IFS A;  2DTC A;  2D10 A;  4YL8 A;  4QJ5 B;  5LG4 B;  1DRO A;  3RCP A;  1QQG A;  1J0W A;  2R0D A;  3AU4 A;  2FJL A;  2J0M A;  2XQN M;  5DH9 B;  3NWD A;  3P7Z A;  3SO6 A;  2Z59 A;  1U5F A;  1NTY A;  2I1K A;  1XOD A;  2VSZ A;  5D27 A;  1ISN A;  1Z87 A;  3HSA A;  4GPT B;  3TW1 A;  1FGZ A;  3CIK A;  5LOP B;  4A6H A;  2CY4 A;  1EVH A;  3O96 A;  2CRF A;  5JHH A;  3TCA A;  5I2S A;  4ZRJ A;  3N7C A;  2P0H A;  2Z0P A;  3OAN A;  1FAO A;  4HAW B;  4DBB A;  2LYD A;  1ZYI A;  2RSG A;  2D9V A;  4ZRI A;  1WJ1 A;  2GCL A;  5D3V A;  1TQZ A;  4HAX B;  4HB2 B;  4D6W A;  2YF0 A;  4GZU A;  2GJY A;  1LB1 A;  2EMS A;  2I5F A;  2D11 A;  3CXB B;  1OY2 A;  1UNP A;  1GC7 A;  3NWF A;  2YRY A;  2Z4D A;  3KRX A;  5DIF B;  2LOX A;  4ZRK A;  4GNK B;  3ML4 A;  3U7D A;  1U5G A;  3PVL A;  3BJI A;  4IOY X;  3QBV B;  3OHM B;  3WA0 A;  1FHO A;  4HB3 B;  1FHX A;  3PG7 A;  2UVM A;  1ZC3 B;  3F0W A;  5CLQ B;  3GYP A;  1UNR A;  4D0N B;  5M4Y B;  1PLS A;  5C16 A;  1WVH A;  1X86 A;  2D9W A;  1XX0 A;  3KRW A;  2K49 A;  4K2O A;  1H10 A;  4Z2M B;  4F7H A;  2D9Z A;  1UPQ A;  1MKE A;  4HAV B;  4H8S A;  4DIX A;  1E5W A;  1U29 A;  2M14 A;  3VOQ A;  4K2P A;  5KQ4 A;  2PZ1 A;  3A8P A;  1MAI A;  2YSZ A;  3M1I B;  4HAZ B;  5LON B;  1W1D A;  1FGY A;  3QWM A;  4MT7 A;  5GOW B;  2JP2 A;  1UEF A;  5EFX A;  2P8V A;  2YT0 A;  3D8E A;  1OMW A;  2I5C A;  5J3Q A;  3G9W A;  3FM8 C;  5D3W A;  2E2X A;  1WG7 A;  1V5U A;  2IYB A;  1U5D A;  1XR0 B;  1BTN A;  2ELA A;  5L81 A;  5JLJ B;  1Y19 B;  4YON A;  2Y7B A;  2YS1 A;  4P7I A;  3SNH A;  3F5R A;  4PNK A;  2DX5 A;  2J0J A;  2HTH B;  4PQ0 A;  1MPH A;  3DCX A;  5JP4 A;  1Y5O A;  2DLW A;  4GOU A;  4CHM A;  2I1J A;  5DHA B;  2VRW B;  2DHJ A;  4KHB A;  1DBH A;  4MY6 A;  4DX8 A;  4MK0 A;  2Y8F A;  4KAX B;  2H7E A;  5IRS A;  5C5B B;  1H4R A;  1PFJ A;  1MIX A;  1V88 A;  2W2X D;  1MK9 B;  2LG1 A;  3QIJ A;  4HSI A;  2L2I A;  4OT1 A;  5C6R A;  2NMB A;  2DYQ A;  4NY0 A;  4A6F A;  1X11 A;  4DXA B;  5I2M A;  2QKL A;  1X05 A;  1K5D B;  1XCG A;  4IAP A;  4HB4 B;  2COF A;  2G35 A;  1B55 A;  4F7G A;  2KGX B;  2MFQ A;  1NU2 A;  2RUK B;  3DXE A;  3KSY A;  3UZT A;  1AWE A;  3DXC A;  5J3T A;  2YVC A;  4CYE A;  4TYZ A;  4EMO A;  3TVV A;  1MIZ B;  1PMS A;  2ZPY A;  1P6S A;  3KY9 A;  1UNQ A;  5HE1 A;  3U8Z A;  2EMT A;  2AEH A;  3IVF A;  1I2H A;  4QJ4 B;  4L1R A;  3D8F A;  1T77 A;  2RNR B;  3NWA A;  1WI1 A;  1DYN A;  2LUL A;  3PVW A;  2DA0 A;  1RJ2 A;  1V89 A;  2UZS A;  1FHW A;  2W2X C;  1X1G A;  2R2Y A;  2COA A;  3HW2 B;  4WVF B;  2DYN A;  2FJU B;  4F7U P;  2GCJ A;  3ZVR A;  3BIN A;  3TO1 A;  3SUZ A;  5FI1 A;  4HAT B;  3NW8 A;  1FB8 A;  3A8Q A;  3PEG A;  2DX1 A;  3HQC A;  1IRS A;  1LW3 A;  1EGX A;  4OSN A;  4B6H A;  1Q67 A;  1OQN A;  3V5W A;  2RLO A;  2QKM A;  1GC6 A;  2ROV A;  2COC A;  2YT1 A;  3SYX A;  2EC1 A;  2D9X A;  5DI9 B;  3T06 A;  3D8D A;  3DXD A;  5DHF B;  2HE7 A;  5KQ1 A;  2UZR A;  1U5E A;  1U27 A;  2MWN B;  4K17 A;  5FI0 A;  4WSF A;  2OQB A;  2Q13 A;  3ZDT A;  1ZSQ A;  4Y94 A;  3VIA A;  1UPR A;  4KHO A;  4GN1 A;  2K2U A;  3PSC A;  3MPX A;  1XD4 A;  3PP2 A;  3ODW A;  4L6E A;  2MDX A;  3ULB A;  4BBK A;  2KR0 A;  1U2B A;  4A6F B;  3KZ1 A;  4WJ7 A;  1J19 A;  3NSU A;  5HE0 A;  4Z2N A;  3HIE A;  1RRP B;  1M7E A;  1WGQ A;  2YS3 A;  5D3X A;  1X1F A;  4HB0 B;  2CAY A;  4EKU A;  2DHK A;  2L1C A;  4C0A A;  3B77 A;  1BTK A;  1KI1 B;  3P6A A;  3PVU A;  1V5P A;  2GUM A;  5HE2 A;  1AQC A;  2K2J A;  1P5T A;  2YS5 A;  1P3R A;  5CLL B;  4K81 A;  2W2W A;  2Z0O A;  2D9Y A;  1QC6 A;  3ODO A;  2KUQ A;  1K5G B;  1MK7 B;  4HDO A;  2IFS A;  1WGU A;  1M7R A;  2KIE A;  2KIG A;  2DKQ A;  2Z13 A;  3FVC A;  5JHG A;  3TFM A;  1ZVR A;  4CHJ A;  3FEH A;  1KZ7 A;  1MI1 A;  3FSS A;  5C5B A;  2D4Q A;  4KVG B;  1ZM0 A;  2ELB A;  4TKN A;  3HK0 A;  2RVB B;  3ODX A;  2V76 A;  4QJ3 B;  1GG3 A;  2GS0 A; 
#chains in the Genus database with same CATH homology
 4HAY B;  1NI2 A;  2P0F A;  2Z0Q A;  2DKP A;  4HAU B;  1DDV A;  5D3Y A;  4XWX A;  1I7A A;  1NTV A;  3ULC A;  3GYO A;  2OTX A;  1EAZ A;  1WJM A;  3MDB C;  4A6K A;  1N3H A;  1ZC4 B;  2K00 A;  1DDW A;  2DHI A;  2VKI A;  1TXD A;  2AL6 A;  4GXB A;  1BWN A;  1V5M A;  4GMX B;  2J0K A;  1SGH A;  2BCJ A;  3SV1 A;  2H7D A;  2KUP A;  2ROZ B;  2DN6 A;  1V61 A;  1DDM A;  3A98 B;  2LOZ A;  4HHV A;  2X18 A;  2J59 M;  5J3Y A;  4DX9 0;  1XKE A;  2Y8G A;  1TJ6 A;  3X23 A;  2ADZ A;  1EF1 A;  2D2Q A;  1W1H A;  1KZG A;  4KHB B;  3PZD A;  2MKR A;  2RGN B;  4NSW A;  2R09 A;  1SHC A;  2EJ8 A;  3LJU X;  2COD A;  4A5K A;  2DFK A;  3AJ4 A;  4HDQ A;  1W1G A;  3AU5 A;  1FOE A;  2N0Y A;  2CY5 A;  2N23 A;  5HE3 A;  2P0D A;  3WYF B;  2M38 A;  4EJN A;  5C79 A;  2KCJ A;  2LKO A;  4KHA A;  1BAK A;  2NZ8 B;  5KCV A;  4GMV A;  4IFS A;  2DTC A;  2D10 A;  4YL8 A;  1DRO A;  3RCP A;  1QQG A;  1J0W A;  2R0D A;  3AU4 A;  2FJL A;  2J0M A;  2XQN M;  5DH9 B;  3P7Z A;  3SO6 A;  1U5F A;  1NTY A;  2I1K A;  1XOD A;  2VSZ A;  5D27 A;  1ISN A;  1Z87 A;  4GPT B;  3TW1 A;  1FGZ A;  3CIK A;  5LOP B;  4A6H A;  2CY4 A;  1EVH A;  3O96 A;  2CRF A;  5JHH A;  3TCA A;  4ZRJ A;  3N7C A;  2P0H A;  2Z0P A;  3OAN A;  1FAO A;  4HAW B;  4DBB A;  2LYD A;  2RSG A;  2D9V A;  4ZRI A;  1WJ1 A;  2GCL A;  5D3V A;  1TQZ A;  4HAX B;  4HB2 B;  2YF0 A;  4GZU A;  2GJY A;  1LB1 A;  2EMS A;  2I5F A;  2D11 A;  3CXB B;  1OY2 A;  1UNP A;  1GC7 A;  2YRY A;  3KRX A;  5DIF B;  2LOX A;  4ZRK A;  3ML4 A;  3U7D A;  1U5G A;  3PVL A;  3BJI A;  4IOY X;  3QBV B;  3WA0 A;  1FHO A;  4HB3 B;  1FHX A;  3PG7 A;  2UVM A;  1ZC3 B;  3F0W A;  5CLQ B;  3GYP A;  1UNR A;  4D0N B;  1PLS A;  5C16 A;  1WVH A;  1X86 A;  2D9W A;  1XX0 A;  3KRW A;  4K2O A;  1H10 A;  4Z2M B;  4F7H A;  2D9Z A;  1UPQ A;  1MKE A;  4HAV B;  4H8S A;  1E5W A;  1U29 A;  2M14 A;  3VOQ A;  4K2P A;  5KQ4 A;  2PZ1 A;  3A8P A;  1MAI A;  2YSZ A;  3M1I B;  4HAZ B;  5LON B;  1W1D A;  1FGY A;  3QWM A;  4MT7 A;  5GOW B;  2JP2 A;  1UEF A;  5EFX A;  2P8V A;  2YT0 A;  3D8E A;  1OMW A;  2I5C A;  5J3Q A;  3G9W A;  3FM8 C;  5D3W A;  2E2X A;  1WG7 A;  1V5U A;  2IYB A;  1U5D A;  1XR0 B;  1BTN A;  2ELA A;  5L81 A;  5JLJ B;  1Y19 B;  4YON A;  2Y7B A;  2YS1 A;  4P7I A;  3SNH A;  3F5R A;  4PNK A;  2DX5 A;  2J0J A;  2HTH B;  4PQ0 A;  1MPH A;  5JP4 A;  1Y5O A;  2DLW A;  4CHM A;  2I1J A;  5DHA B;  2VRW B;  2DHJ A;  1DBH A;  4MY6 A;  4DX8 A;  4MK0 A;  2Y8F A;  4KAX B;  2H7E A;  5C5B B;  1H4R A;  1PFJ A;  1MIX A;  1V88 A;  2W2X D;  1MK9 B;  2LG1 A;  3QIJ A;  2L2I A;  5C6R A;  2NMB A;  2DYQ A;  4NY0 A;  4A6F A;  1X11 A;  4DXA B;  2QKL A;  1X05 A;  1K5D B;  1XCG A;  4IAP A;  4HB4 B;  2COF A;  2G35 A;  1B55 A;  4F7G A;  2KGX B;  2MFQ A;  1NU2 A;  2RUK B;  3DXE A;  3KSY A;  3UZT A;  1AWE A;  3DXC A;  5J3T A;  2YVC A;  4CYE A;  4TYZ A;  4EMO A;  3TVV A;  1MIZ B;  1PMS A;  2ZPY A;  1P6S A;  3KY9 A;  1UNQ A;  5HE1 A;  3U8Z A;  2EMT A;  2AEH A;  3IVF A;  1I2H A;  3D8F A;  2RNR B;  1WI1 A;  1DYN A;  2LUL A;  3PVW A;  2DA0 A;  1RJ2 A;  1V89 A;  2UZS A;  1FHW A;  2W2X C;  1X1G A;  2COA A;  3HW2 B;  4WVF B;  2DYN A;  4F7U P;  2GCJ A;  3ZVR A;  3BIN A;  3TO1 A;  3SUZ A;  5FI1 A;  4HAT B;  1FB8 A;  3A8Q A;  3PEG A;  2DX1 A;  3HQC A;  1IRS A;  1LW3 A;  1EGX A;  4B6H A;  1Q67 A;  1OQN A;  3V5W A;  2RLO A;  2QKM A;  1GC6 A;  2ROV A;  2COC A;  2YT1 A;  3SYX A;  2EC1 A;  2D9X A;  5DI9 B;  3T06 A;  3D8D A;  3DXD A;  5DHF B;  2HE7 A;  5KQ1 A;  2UZR A;  1U5E A;  1U27 A;  2MWN B;  4K17 A;  5FI0 A;  4WSF A;  2OQB A;  2Q13 A;  3ZDT A;  1ZSQ A;  4Y94 A;  3VIA A;  1UPR A;  4KHO A;  4GN1 A;  2K2U A;  3PSC A;  3MPX A;  1XD4 A;  3PP2 A;  3ODW A;  4L6E A;  2MDX A;  3ULB A;  4BBK A;  1U2B A;  4A6F B;  3KZ1 A;  4WJ7 A;  1J19 A;  3NSU A;  5HE0 A;  4Z2N A;  1RRP B;  1M7E A;  1WGQ A;  2YS3 A;  5D3X A;  1X1F A;  4HB0 B;  2CAY A;  4EKU A;  2DHK A;  2L1C A;  4C0A A;  1BTK A;  1KI1 B;  3P6A A;  3PVU A;  1V5P A;  5HE2 A;  1AQC A;  2K2J A;  1P5T A;  2YS5 A;  1P3R A;  5CLL B;  4K81 A;  2W2W A;  2Z0O A;  2D9Y A;  1QC6 A;  3ODO A;  1K5G B;  1MK7 B;  4HDO A;  2IFS A;  1WGU A;  1M7R A;  2DKQ A;  5JHG A;  3TFM A;  1ZVR A;  4CHJ A;  3FEH A;  1KZ7 A;  3FSS A;  5C5B A;  2D4Q A;  4KVG B;  1ZM0 A;  2ELB A;  4TKN A;  3HK0 A;  2RVB B;  3ODX A;  2V76 A;  1GG3 A;  2GS0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...