1AQCA

X11 ptb domain-10mer peptide complex
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
166
structure length
130
Chain Sequence
MEDLIDGIIFAANYLGSTQLLSDKTPSKNVRMMQAQEAVSRIKMAQKLMTEVDLFILTQRIKVLNADTQETMMDHPLRTISYIADIGNIVVLMARRRYKMICHVFESEDAQLIAQSIGQAFSVAYQEFLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords X11
publication title Sequence-specific recognition of the internalization motif of the Alzheimer's amyloid precursor protein by the X11 PTB domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Complex (peptide binding module/peptide)
total genus 30
structure length 130
sequence length 166
chains with identical sequence B
ec nomenclature
pdb deposition date 1997-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00640 PID Phosphotyrosine interaction domain (PTB/PID)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1aqcA00
1Z87A 4KVGB 2D2QA 1GC7A 4A6FA 2LYDA 3X23A 5D3YA 2MWNB 4PNKA 1FOEA 2RNRB 4DX90 4NY0A 3PZDA 1U5FA 3GYPA 1U5EA 3QWMA 2P0HA 3P7ZA 5D27A 1KZ7A 2FJLA 2KGXB 2P0DA 4C0AA 1K5GB 1WG7A 4KHAA 1M7EA 3V5WA 3F0WA 2UVMA 3KZ1A 3OANA 4KHOA 1UNQA 4HAUB 4EMOA 5D3VA 4IOYX 1XODA 4BBKA 3TFMA 2YS1A 1MKEA 2K2JA 2QKLA 3PVUA 2COAA 1ZVRA 2EMSA 3RCPA 4HAVB 3QIJA 4K2PA 3PVWA 3D8DA 1K5DB 2KUPA 2E2XA 2JP2A 1OQNA 3CIKA 2GJYA 3FSSA 5KQ4A 2LOZA 2RGNB 3IVFA 2H7EA 3A8QA 2Z0PA 3A98B 3PVLA 1U27A 1FB8A 1PLSA 4CHMA 2YVCA 2Z0OA 1NTVA 2P0FA 1EF1A 5FI0A 1WJMA 1EGXA 1W1GA 3PG7A 3O96A 2MKRA 3HW2B 5J3TA 2AL6A 2YRYA 3BJIA 2HTHB 3TW1A 2LKOA 3U8ZA 3NSUA 5JLJB 4ZRKA 3PEGA 2RVBB 1UPQA 4HATB 5DH9B 5JHGA 5LONB 1Y19B 2YF0A 2ROVA 2N0YA 1DDMA 4D0NB 3KRXA 2D4QA 2J0JA 4A6KA 3QBVB 2I1JA 2LOXA 3KSYA 4HAYB 1UNPA 2R0DA 2MFQA 4HAXB 4HB0B 4NSWA 4A5KA 5DIFB 5C5BA 2H7DA 2CODA 5C6RA 1XR0B 4P7IA 3SV1A 3D8EA 4L6EA 3T06A 1H4RA 2YS3A 1SGHA 5HE1A 4K17A 4MK0A 1NU2A 2CRFA 1MK7B 2COFA 1WGUA 3HQCA 1J19A 4HB2B 1WVHA 3SUZA 1V61A 1MIZB 2YSZA 4K2OA 2J0KA 1BTNA 1U29A 1LB1A 3WYFB 2G35A 5J3YA 1FHWA 2LG1A 2P8VA 4KHBB 1V5UA 1TJ6A 4F7GA 1QC6A 3AU4A 1WI1A 1OMWA 3VOQA 4Y94A 2DA0A 2DYQA 1DROA 3SNHA 3UZTA 4GXBA 1EAZA 3TCAA 2GCJA 2ZPYA 3DXEA 3SYXA 2DX1A 2DKPA 4Z2NA 2YT0A 2DHJA 2XQNM 5CLLB 3AU5A 5JP4A 1I2HA 4K81A 2VRWB 2IFSA 4WJ7A 2HE7A 1W1HA 4DXAB 1PFJA 1E5WA 1M7RA 4WVFB 5KQ1A 1FHOA 5C16A 3BINA 2ADZA 2I5CA 4F7UP 2M14A 2EC1A 4CYEA 1ZC3B 3F5RA 3PP2A 1ISNA 1WJ1A 4GMXB 4GPTB 2D9ZA 1MPHA 1ZC4B 2OTXA 5D3XA 2V76A 2YT1A 2DLWA 1XX0A 3TVVA 4HDOA 1X1FA 2Y7BA 1B55A 2D9XA 1BTKA 3DXCA 5KCVA 2L2IA 5D3WA 2PZ1A 1MIXA 5DI9B 2CY5A 1RRPB 1EVHA 2COCA 1SHCA 1KZGA 2RUKB 1FGYA 4F7HA 2BCJA 5EFXA 2DHKA 1QQGA 1AWEA 1UNRA 2OQBA 2N23A 2CY4A 4HDQA 1P5TA 2K2UA 2LULA 1XCGA 3U7DA 3KY9A 2Z0QA 3MPXA 1U5DA 5HE0A 2NZ8B 5GOWB 2EJ8A 1GG3A 1KI1B 3HK0A 1N3HA 3WA0A 3FEHA 5DHAB 4GMVA 1V5MA 1AQCA 2KCJA 2RSGA 1ZSQA 4IAPA 4DBBA 1MAIA 2AEHA 1UEFA 2W2XD 2QKMA 1X86A 4CHJA 2IYBA 2D11A 2DN6A 3ODOA 2DYNA 4GZUA 2J0MA 1WGQA 4GN1A 4MT7A 4ZRJA 4MY6A 1P6SA 4YONA 2GCLA 3FM8C 2D10A 3CXBB 3D8FA 1TXDA 5JHHA 1DBHA 1LW3A 5L81A 1BAKA 4HAZB 5HE2A 3A8PA 2ELAA 1DYNA 4EKUA 3ML4A 1OY2A 2W2XC 4IFSA 2DTCA 4XWXA 4HHVA 2YS5A 1DDVA 1X11A 1DDWA 1V89A 5J3QA 1IRSA 2RLOA 3DXDA 5DHFB 1FGZA 2UZRA 4A6HA 4DX8A 2DFKA 5C5BB 1BWNA 3LJUX 4Z2MB 2DHIA 2EMTA 4HAWB 2CAYA 1FAOA 1Q67A 2DKQA 3GYOA 3MDBC 2M38A 3ZDTA 2Y8FA 4WSFA 1NI2A 4TYZA 3P6AA 3VIAA 1V88A 2D9VA 1X05A 4YL8A 2L1CA 4A6FB 2J59M 3PSCA 4ZRIA 4HB4B 3ZVRA 2I1KA 5LOPB 2D9YA 1H10A 2UZSA 1RJ2A 3N7CA 1U5GA 2I5FA 3G9WA 5FI1A 3SO6A 2Y8GA 1W1DA 4B6HA 5HE3A 2ROZB 2VSZA 1J0WA 3M1IB 4KAXB 2NMBA 3AJ4A 4PQ0A 3KRWA 3ODWA 2GS0A 4TKNA 1PMSA 2K00A 1UPRA 2MDXA 2W2WA 1XD4A 3ULCA 1TQZA 2X18A 1XKEA 2R09A 5CLQB 1MK9B 1P3RA 1GC6A 1FHXA 3ODXA 2ELBA 2Q13A 1NTYA 1X1GA 1Y5OA 3TO1A 4H8SA 1ZM0A 2DX5A 2D9WA 5C79A 1I7AA 2VKIA 3ULBA 1U2BA 4EJNA 1V5PA 4HB3B
chains in the Genus database with same CATH superfamily
1Z87A 4KVGB 2D2QA 1GC7A 4A6FA 2LYDA 3X23A 5D3YA 2MWNB 4PNKA 1FOEA 4D6WA 2RNRB 4DX90 4NY0A 3PZDA 1U5FA 3GYPA 1U5EA 3QWMA 2P0HA 3P7ZA 5D27A 1KZ7A 2FJLA 2KGXB 2P0DA 4C0AA 1K5GB 3OHMB 1WG7A 4KHAA 1M7EA 3V5WA 3U12A 3F0WA 3HIEA 2UVMA 3KZ1A 3OANA 4KHOA 1UNQA 4HAUB 4EMOA 2KR0A 5D3VA 4IOYX 1XODA 1T77A 4BBKA 3TFMA 2YS1A 1MKEA 2K2JA 2QKLA 3PVUA 2COAA 1ZVRA 2EMSA 3RCPA 4HAVB 3QIJA 4K2PA 3PVWA 2NBVA 3D8DA 1K5DB 2KUPA 2E2XA 2JP2A 1OQNA 3CIKA 2GJYA 3FSSA 5KQ4A 2LOZA 2RGNB 3IVFA 2H7EA 3A8QA 2Z0PA 3A98B 3PVLA 1U27A 1FB8A 1PLSA 4CHMA 2YVCA 2Z0OA 1NTVA 2KIEA 2P0FA 1EF1A 5FI0A 1WJMA 1EGXA 3A58A 1W1GA 3PG7A 2Z14A 2MKRA 3HW2B 3O96A 5J3TA 2AL6A 2YRYA 3BJIA 2HTHB 3TW1A 2LKOA 3U8ZA 4QJ4B 3NSUA 5JLJB 4ZRKA 3PEGA 2RVBB 1UPQA 4HATB 5DH9B 5JHGA 5LONB 1Y19B 2YF0A 2ROVA 2N0YA 1DDMA 4D0NB 3KRXA 2D4QA 2J0JA 4A6KA 3DCXA 3QBVB 2I1JA 2LOXA 3KSYA 4HAYB 1UNPA 3HSAA 2R0DA 2MFQA 4HAXB 4HB0B 4NSWA 4A5KA 5DIFB 5C5BA 2H7DA 2CODA 5C6RA 1XR0B 4P7IA 4OT1A 3SV1A 3D8EA 4L6EA 3T06A 1H4RA 2YS3A 1SGHA 5HE1A 4K17A 4MK0A 1NU2A 2CRFA 5IRSA 1MK7B 2COFA 4QXAB 1WGUA 3HQCA 1J19A 5LG4B 4HB2B 1WVHA 2KIGA 3SUZA 1V61A 1MIZB 2YSZA 4K2OA 2J0KA 1BTNA 2K49A 1U29A 1LB1A 3WYFB 2G35A 5M4YB 5J3YA 1FHWA 2LG1A 2P8VA 4KHBB 1V5UA 1TJ6A 2K8EA 4F7GA 1QC6A 3AU4A 1WI1A 1OMWA 3VOQA 4Y94A 2DA0A 2DYQA 1DROA 5I2SA 3SNHA 3UZTA 4GXBA 1EAZA 3NWDA 2GCJA 2ZPYA 3TCAA 3DXEA 2RRFA 3SYXA 2DX1A 2DKPA 4Z2NA 2YT0A 2DHJA 2XQNM 5CLLB 3AU5A 5JP4A 1I2HA 4K81A 2VRWB 2IFSA 4WJ7A 2HE7A 4L1RA 1W1HA 4DXAB 1PFJA 1E5WA 1M7RA 4WVFB 5KQ1A 1FHOA 5C16A 3BINA 2ADZA 2I5CA 4F7UP 2M14A 2EC1A 4CYEA 1ZC3B 3F5RA 3PP2A 1ISNA 1WJ1A 4GMXB 4GPTB 2D9ZA 1MPHA 1ZC4B 2OTXA 2Z4DA 5D3XA 2V76A 2YT1A 2DLWA 1XX0A 3TVVA 4HDOA 1X1FA 2Y7BA 2KUQA 1B55A 2D9XA 1BTKA 3DXCA 4QJ3B 5KCVA 2L2IA 5D3WA 2PZ1A 1MIXA 5DI9B 2CY5A 4DIXA 1RRPB 1EVHA 4GNKB 2COCA 1SHCA 1KZGA 2RUKB 4OSNA 1FGYA 4F7HA 3FVCA 2BCJA 5EFXA 2DHKA 1QQGA 1AWEA 1UNRA 2OQBA 2N23A 2CY4A 4HDQA 1P5TA 2K2UA 2LULA 1XCGA 3U7DA 3KY9A 2Z0QA 3MPXA 1U5DA 5HE0A 2NZ8B 5GOWB 2EJ8A 1GG3A 1KI1B 3HK0A 1N3HA 3WA0A 3FEHA 5DHAB 4GMVA 1V5MA 3NWFA 1AQCA 2KCJA 2RSGA 1ZSQA 4IAPA 4DBBA 1MAIA 2AEHA 1UEFA 2W2XD 2QKMA 1X86A 4CHJA 2IYBA 2D11A 2DN6A 3ODOA 2DYNA 4GZUA 2J0MA 5I2MA 2GUMA 1WGQA 4GN1A 4MT7A 4ZRJA 4MY6A 1P6SA 4YONA 2GCLA 2R2YA 3FM8C 2D10A 3CXBB 3D8FA 1TXDA 5JHHA 2Z13A 1DBHA 1LW3A 2Z59A 5L81A 1BAKA 4HAZB 5HE2A 3A8PA 2ELAA 1DYNA 4EKUA 3ML4A 1OY2A 2W2XC 4IFSA 2DTCA 3NWAA 4XWXA 4CSQA 4HHVA 2YS5A 1DDVA 1X11A 1DDWA 1V89A 5J3QA 1IRSA 2RLOA 3DXDA 5DHFB 1FGZA 2UZRA 4A6HA 3B77A 4DX8A 2DFKA 2FJUB 5C5BB 1BWNA 3LJUX 4Z2MB 2DHIA 2EMTA 4HAWB 2CAYA 1FAOA 1Q67A 2DKQA 3GYOA 3MDBC 2M38A 2ZKMX 3ZDTA 2Y8FA 4WSFA 1NI2A 4TYZA 3P6AA 3VIAA 1V88A 2D9VA 1X05A 4YL8A 2L1CA 4A6FB 2J59M 4GOUA 3PSCA 4ZRIA 4HB4B 3ZVRA 3NW8A 2I1KA 4QJ5B 5LOPB 2D9YA 1H10A 2UZSA 1RJ2A 3N7CA 1U5GA 2I5FA 3G9WA 5FI1A 3SO6A 2Y8GA 1W1DA 4B6HA 4KHBA 1MI1A 5HE3A 2ROZB 2VSZA 1J0WA 3M1IB 4KAXB 2NMBA 3AJ4A 1ZYIA 4PQ0A 3KRWA 3ODWA 2GS0A 4TKNA 1PMSA 2K00A 1UPRA 2MDXA 2W2WA 1XD4A 3ULCA 1TQZA 2X18A 1XKEA 4HSIA 2R09A 5CLQB 1MK9B 1P3RA 1GC6A 1FHXA 3ODXA 2ELBA 2Q13A 1NTYA 2YT2A 1X1GA 1Y5OA 3TO1A 4H8SA 1ZM0A 2DX5A 2D9WA 5C79A 1I7AA 2VKIA 3ULBA 1U2BA 4EJNA 1V5PA 4HB3B
chains in the Genus database with same CATH topology
1Z87A 4KVGB 2D2QA 1GC7A 4A6FA 2LYDA 3X23A 5D3YA 2MWNB 4PNKA 1FOEA 2RNRB 4DX90 4NY0A 3PZDA 1U5FA 3GYPA 1U5EA 3QWMA 2P0HA 3P7ZA 5D27A 1KZ7A 2FJLA 2KGXB 2P0DA 4C0AA 1K5GB 1WG7A 4KHAA 1M7EA 3V5WA 3F0WA 2UVMA 3KZ1A 3OANA 4KHOA 1UNQA 4HAUB 4EMOA 5D3VA 4IOYX 1XODA 4BBKA 3TFMA 2YS1A 1MKEA 2K2JA 2QKLA 3PVUA 2COAA 1ZVRA 2EMSA 3RCPA 4HAVB 3QIJA 4K2PA 3PVWA 3D8DA 1K5DB 2KUPA 2E2XA 2JP2A 1OQNA 3CIKA 2GJYA 3FSSA 5KQ4A 2LOZA 2RGNB 3IVFA 2H7EA 3A8QA 2Z0PA 3A98B 3PVLA 1U27A 1FB8A 1PLSA 4CHMA 2YVCA 2Z0OA 1NTVA 2P0FA 1EF1A 5FI0A 1WJMA 1EGXA 1W1GA 3PG7A 3O96A 2MKRA 3HW2B 5J3TA 2AL6A 2YRYA 3BJIA 2HTHB 3TW1A 2LKOA 3U8ZA 3NSUA 5JLJB 4ZRKA 3PEGA 2RVBB 1UPQA 4HATB 5DH9B 5JHGA 5LONB 1Y19B 2YF0A 2ROVA 2N0YA 1DDMA 4D0NB 3KRXA 2D4QA 2J0JA 4A6KA 3QBVB 2I1JA 2LOXA 3KSYA 4HAYB 1UNPA 2R0DA 2MFQA 4HAXB 4HB0B 4NSWA 4A5KA 5DIFB 5C5BA 2H7DA 2CODA 5C6RA 1XR0B 4P7IA 3SV1A 3D8EA 4L6EA 3T06A 1H4RA 2YS3A 1SGHA 5HE1A 4K17A 4MK0A 1NU2A 2CRFA 1MK7B 2COFA 1WGUA 3HQCA 1J19A 4HB2B 1WVHA 3SUZA 1V61A 1MIZB 2YSZA 4K2OA 2J0KA 1BTNA 1U29A 1LB1A 3WYFB 2G35A 5J3YA 1FHWA 2LG1A 2P8VA 4KHBB 1V5UA 1TJ6A 4F7GA 1QC6A 3AU4A 1WI1A 1OMWA 3VOQA 4Y94A 2DA0A 2DYQA 1DROA 3SNHA 3UZTA 4GXBA 1EAZA 3TCAA 2GCJA 2ZPYA 3DXEA 3SYXA 2DX1A 2DKPA 4Z2NA 2YT0A 2DHJA 2XQNM 5CLLB 3AU5A 5JP4A 1I2HA 4K81A 2VRWB 2IFSA 4WJ7A 2HE7A 1W1HA 4DXAB 1PFJA 1E5WA 1M7RA 4WVFB 5KQ1A 1FHOA 5C16A 3BINA 2ADZA 2I5CA 4F7UP 2M14A 2EC1A 4CYEA 1ZC3B 3F5RA 3PP2A 1ISNA 1WJ1A 4GMXB 4GPTB 2D9ZA 1MPHA 1ZC4B 2OTXA 5D3XA 2V76A 2YT1A 2DLWA 1XX0A 3TVVA 4HDOA 1X1FA 2Y7BA 1B55A 2D9XA 1BTKA 3DXCA 5KCVA 2L2IA 5D3WA 2PZ1A 1MIXA 5DI9B 2CY5A 1RRPB 1EVHA 2COCA 1SHCA 1KZGA 2RUKB 1FGYA 4F7HA 2BCJA 5EFXA 2DHKA 1QQGA 1AWEA 1UNRA 2OQBA 2N23A 2CY4A 4HDQA 1P5TA 2K2UA 2LULA 1XCGA 3U7DA 3KY9A 2Z0QA 3MPXA 1U5DA 5HE0A 2NZ8B 5GOWB 2EJ8A 1GG3A 1KI1B 3HK0A 1N3HA 3WA0A 3FEHA 5DHAB 4GMVA 1V5MA 1AQCA 2KCJA 2RSGA 1ZSQA 4IAPA 4DBBA 1MAIA 2AEHA 1UEFA 2W2XD 2QKMA 1X86A 4CHJA 2IYBA 2D11A 2DN6A 3ODOA 2DYNA 4GZUA 2J0MA 1WGQA 4GN1A 4MT7A 4ZRJA 4MY6A 1P6SA 4YONA 2GCLA 3FM8C 2D10A 3CXBB 3D8FA 1TXDA 5JHHA 1DBHA 1LW3A 5L81A 1BAKA 4HAZB 5HE2A 3A8PA 2ELAA 1DYNA 4EKUA 3ML4A 1OY2A 2W2XC 4IFSA 2DTCA 4XWXA 4HHVA 2YS5A 1DDVA 1X11A 1DDWA 1V89A 5J3QA 1IRSA 2RLOA 3DXDA 5DHFB 1FGZA 2UZRA 4A6HA 4DX8A 2DFKA 5C5BB 1BWNA 3LJUX 4Z2MB 2DHIA 2EMTA 4HAWB 2CAYA 1FAOA 1Q67A 2DKQA 3GYOA 3MDBC 2M38A 3ZDTA 2Y8FA 4WSFA 1NI2A 4TYZA 3P6AA 3VIAA 1V88A 2D9VA 1X05A 4YL8A 2L1CA 4A6FB 2J59M 3PSCA 4ZRIA 4HB4B 3ZVRA 2I1KA 5LOPB 2D9YA 1H10A 2UZSA 1RJ2A 3N7CA 1U5GA 2I5FA 3G9WA 5FI1A 3SO6A 2Y8GA 1W1DA 4B6HA 5HE3A 2ROZB 2VSZA 1J0WA 3M1IB 4KAXB 2NMBA 3AJ4A 4PQ0A 3KRWA 3ODWA 2GS0A 4TKNA 1PMSA 2K00A 1UPRA 2MDXA 2W2WA 1XD4A 3ULCA 1TQZA 2X18A 1XKEA 2R09A 5CLQB 1MK9B 1P3RA 1GC6A 1FHXA 3ODXA 2ELBA 2Q13A 1NTYA 1X1GA 1Y5OA 3TO1A 4H8SA 1ZM0A 2DX5A 2D9WA 5C79A 1I7AA 2VKIA 3ULBA 1U2BA 4EJNA 1V5PA 4HB3B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Z87 A;  4KVG B;  2D2Q A;  1GC7 A;  4A6F A;  2LYD A;  3X23 A;  5D3Y A;  2MWN B;  4PNK A;  1FOE A;  2RNR B;  4DX9 0;  4NY0 A;  3PZD A;  1U5F A;  3GYP A;  1U5E A;  3QWM A;  2P0H A;  3P7Z A;  5D27 A;  1KZ7 A;  2FJL A;  2KGX B;  2P0D A;  4C0A A;  1K5G B;  1WG7 A;  4KHA A;  1M7E A;  3V5W A;  3F0W A;  2UVM A;  3KZ1 A;  3OAN A;  4KHO A;  1UNQ A;  4HAU B;  4EMO A;  5D3V A;  4IOY X;  1XOD A;  4BBK A;  3TFM A;  2YS1 A;  1MKE A;  2K2J A;  2QKL A;  3PVU A;  2COA A;  1ZVR A;  2EMS A;  3RCP A;  4HAV B;  3QIJ A;  4K2P A;  3PVW A;  3D8D A;  1K5D B;  2KUP A;  2E2X A;  2JP2 A;  1OQN A;  3CIK A;  2GJY A;  3FSS A;  5KQ4 A;  2LOZ A;  2RGN B;  3IVF A;  2H7E A;  3A8Q A;  2Z0P A;  3A98 B;  3PVL A;  1U27 A;  1FB8 A;  1PLS A;  4CHM A;  2YVC A;  2Z0O A;  1NTV A;  2P0F A;  1EF1 A;  5FI0 A;  1WJM A;  1EGX A;  1W1G A;  3PG7 A;  3O96 A;  2MKR A;  3HW2 B;  5J3T A;  2AL6 A;  2YRY A;  3BJI A;  2HTH B;  3TW1 A;  2LKO A;  3U8Z A;  3NSU A;  5JLJ B;  4ZRK A;  3PEG A;  2RVB B;  1UPQ A;  4HAT B;  5DH9 B;  5JHG A;  5LON B;  1Y19 B;  2YF0 A;  2ROV A;  2N0Y A;  1DDM A;  4D0N B;  3KRX A;  2D4Q A;  2J0J A;  4A6K A;  3QBV B;  2I1J A;  2LOX A;  3KSY A;  4HAY B;  1UNP A;  2R0D A;  2MFQ A;  4HAX B;  4HB0 B;  4NSW A;  4A5K A;  5DIF B;  5C5B A;  2H7D A;  2COD A;  5C6R A;  1XR0 B;  4P7I A;  3SV1 A;  3D8E A;  4L6E A;  3T06 A;  1H4R A;  2YS3 A;  1SGH A;  5HE1 A;  4K17 A;  4MK0 A;  1NU2 A;  2CRF A;  1MK7 B;  2COF A;  1WGU A;  3HQC A;  1J19 A;  4HB2 B;  1WVH A;  3SUZ A;  1V61 A;  1MIZ B;  2YSZ A;  4K2O A;  2J0K A;  1BTN A;  1U29 A;  1LB1 A;  3WYF B;  2G35 A;  5J3Y A;  1FHW A;  2LG1 A;  2P8V A;  4KHB B;  1V5U A;  1TJ6 A;  4F7G A;  1QC6 A;  3AU4 A;  1WI1 A;  1OMW A;  3VOQ A;  4Y94 A;  2DA0 A;  2DYQ A;  1DRO A;  3SNH A;  3UZT A;  4GXB A;  1EAZ A;  3TCA A;  2GCJ A;  2ZPY A;  3DXE A;  3SYX A;  2DX1 A;  2DKP A;  4Z2N A;  2YT0 A;  2DHJ A;  2XQN M;  5CLL B;  3AU5 A;  5JP4 A;  1I2H A;  4K81 A;  2VRW B;  2IFS A;  4WJ7 A;  2HE7 A;  1W1H A;  4DXA B;  1PFJ A;  1E5W A;  1M7R A;  4WVF B;  5KQ1 A;  1FHO A;  5C16 A;  3BIN A;  2ADZ A;  2I5C A;  4F7U P;  2M14 A;  2EC1 A;  4CYE A;  1ZC3 B;  3F5R A;  3PP2 A;  1ISN A;  1WJ1 A;  4GMX B;  4GPT B;  2D9Z A;  1MPH A;  1ZC4 B;  2OTX A;  5D3X A;  2V76 A;  2YT1 A;  2DLW A;  1XX0 A;  3TVV A;  4HDO A;  1X1F A;  2Y7B A;  1B55 A;  2D9X A;  1BTK A;  3DXC A;  5KCV A;  2L2I A;  5D3W A;  2PZ1 A;  1MIX A;  5DI9 B;  2CY5 A;  1RRP B;  1EVH A;  2COC A;  1SHC A;  1KZG A;  2RUK B;  1FGY A;  4F7H A;  2BCJ A;  5EFX A;  2DHK A;  1QQG A;  1AWE A;  1UNR A;  2OQB A;  2N23 A;  2CY4 A;  4HDQ A;  1P5T A;  2K2U A;  2LUL A;  1XCG A;  3U7D A;  3KY9 A;  2Z0Q A;  3MPX A;  1U5D A;  5HE0 A;  2NZ8 B;  5GOW B;  2EJ8 A;  1GG3 A;  1KI1 B;  3HK0 A;  1N3H A;  3WA0 A;  3FEH A;  5DHA B;  4GMV A;  1V5M A;  1AQC A;  2KCJ A;  2RSG A;  1ZSQ A;  4IAP A;  4DBB A;  1MAI A;  2AEH A;  1UEF A;  2W2X D;  2QKM A;  1X86 A;  4CHJ A;  2IYB A;  2D11 A;  2DN6 A;  3ODO A;  2DYN A;  4GZU A;  2J0M A;  1WGQ A;  4GN1 A;  4MT7 A;  4ZRJ A;  4MY6 A;  1P6S A;  4YON A;  2GCL A;  3FM8 C;  2D10 A;  3CXB B;  3D8F A;  1TXD A;  5JHH A;  1DBH A;  1LW3 A;  5L81 A;  1BAK A;  4HAZ B;  5HE2 A;  3A8P A;  2ELA A;  1DYN A;  4EKU A;  3ML4 A;  1OY2 A;  2W2X C;  4IFS A;  2DTC A;  4XWX A;  4HHV A;  2YS5 A;  1DDV A;  1X11 A;  1DDW A;  1V89 A;  5J3Q A;  1IRS A;  2RLO A;  3DXD A;  5DHF B;  1FGZ A;  2UZR A;  4A6H A;  4DX8 A;  2DFK A;  5C5B B;  1BWN A;  3LJU X;  4Z2M B;  2DHI A;  2EMT A;  4HAW B;  2CAY A;  1FAO A;  1Q67 A;  2DKQ A;  3GYO A;  3MDB C;  2M38 A;  3ZDT A;  2Y8F A;  4WSF A;  1NI2 A;  4TYZ A;  3P6A A;  3VIA A;  1V88 A;  2D9V A;  1X05 A;  4YL8 A;  2L1C A;  4A6F B;  2J59 M;  3PSC A;  4ZRI A;  4HB4 B;  3ZVR A;  2I1K A;  5LOP B;  2D9Y A;  1H10 A;  2UZS A;  1RJ2 A;  3N7C A;  1U5G A;  2I5F A;  3G9W A;  5FI1 A;  3SO6 A;  2Y8G A;  1W1D A;  4B6H A;  5HE3 A;  2ROZ B;  2VSZ A;  1J0W A;  3M1I B;  4KAX B;  2NMB A;  3AJ4 A;  4PQ0 A;  3KRW A;  3ODW A;  2GS0 A;  4TKN A;  1PMS A;  2K00 A;  1UPR A;  2MDX A;  2W2W A;  1XD4 A;  3ULC A;  1TQZ A;  2X18 A;  1XKE A;  2R09 A;  5CLQ B;  1MK9 B;  1P3R A;  1GC6 A;  1FHX A;  3ODX A;  2ELB A;  2Q13 A;  1NTY A;  1X1G A;  1Y5O A;  3TO1 A;  4H8S A;  1ZM0 A;  2DX5 A;  2D9W A;  5C79 A;  1I7A A;  2VKI A;  3ULB A;  1U2B A;  4EJN A;  1V5P A;  4HB3 B; 
#chains in the Genus database with same CATH topology
 1Z87 A;  4KVG B;  2D2Q A;  1GC7 A;  4A6F A;  2LYD A;  3X23 A;  5D3Y A;  2MWN B;  4PNK A;  1FOE A;  4D6W A;  2RNR B;  4DX9 0;  4NY0 A;  3PZD A;  1U5F A;  3GYP A;  1U5E A;  3QWM A;  2P0H A;  3P7Z A;  5D27 A;  1KZ7 A;  2FJL A;  2KGX B;  2P0D A;  4C0A A;  1K5G B;  3OHM B;  1WG7 A;  4KHA A;  1M7E A;  3V5W A;  3U12 A;  3F0W A;  3HIE A;  2UVM A;  3KZ1 A;  3OAN A;  4KHO A;  1UNQ A;  4HAU B;  4EMO A;  2KR0 A;  5D3V A;  4IOY X;  1XOD A;  1T77 A;  4BBK A;  3TFM A;  2YS1 A;  1MKE A;  2K2J A;  2QKL A;  3PVU A;  2COA A;  1ZVR A;  2EMS A;  3RCP A;  4HAV B;  3QIJ A;  4K2P A;  3PVW A;  2NBV A;  3D8D A;  1K5D B;  2KUP A;  2E2X A;  2JP2 A;  1OQN A;  3CIK A;  2GJY A;  3FSS A;  5KQ4 A;  2LOZ A;  2RGN B;  3IVF A;  2H7E A;  3A8Q A;  2Z0P A;  3A98 B;  3PVL A;  1U27 A;  1FB8 A;  1PLS A;  4CHM A;  2YVC A;  2Z0O A;  1NTV A;  2KIE A;  2P0F A;  1EF1 A;  5FI0 A;  1WJM A;  1EGX A;  3A58 A;  1W1G A;  3PG7 A;  2Z14 A;  2MKR A;  3HW2 B;  3O96 A;  5J3T A;  2AL6 A;  2YRY A;  3BJI A;  2HTH B;  3TW1 A;  2LKO A;  3U8Z A;  4QJ4 B;  3NSU A;  5JLJ B;  4ZRK A;  3PEG A;  2RVB B;  1UPQ A;  4HAT B;  5DH9 B;  5JHG A;  5LON B;  1Y19 B;  2YF0 A;  2ROV A;  2N0Y A;  1DDM A;  4D0N B;  3KRX A;  2D4Q A;  2J0J A;  4A6K A;  3DCX A;  3QBV B;  2I1J A;  2LOX A;  3KSY A;  4HAY B;  1UNP A;  3HSA A;  2R0D A;  2MFQ A;  4HAX B;  4HB0 B;  4NSW A;  4A5K A;  5DIF B;  5C5B A;  2H7D A;  2COD A;  5C6R A;  1XR0 B;  4P7I A;  4OT1 A;  3SV1 A;  3D8E A;  4L6E A;  3T06 A;  1H4R A;  2YS3 A;  1SGH A;  5HE1 A;  4K17 A;  4MK0 A;  1NU2 A;  2CRF A;  5IRS A;  1MK7 B;  2COF A;  4QXA B;  1WGU A;  3HQC A;  1J19 A;  5LG4 B;  4HB2 B;  1WVH A;  2KIG A;  3SUZ A;  1V61 A;  1MIZ B;  2YSZ A;  4K2O A;  2J0K A;  1BTN A;  2K49 A;  1U29 A;  1LB1 A;  3WYF B;  2G35 A;  5M4Y B;  5J3Y A;  1FHW A;  2LG1 A;  2P8V A;  4KHB B;  1V5U A;  1TJ6 A;  2K8E A;  4F7G A;  1QC6 A;  3AU4 A;  1WI1 A;  1OMW A;  3VOQ A;  4Y94 A;  2DA0 A;  2DYQ A;  1DRO A;  5I2S A;  3SNH A;  3UZT A;  4GXB A;  1EAZ A;  3NWD A;  2GCJ A;  2ZPY A;  3TCA A;  3DXE A;  2RRF A;  3SYX A;  2DX1 A;  2DKP A;  4Z2N A;  2YT0 A;  2DHJ A;  2XQN M;  5CLL B;  3AU5 A;  5JP4 A;  1I2H A;  4K81 A;  2VRW B;  2IFS A;  4WJ7 A;  2HE7 A;  4L1R A;  1W1H A;  4DXA B;  1PFJ A;  1E5W A;  1M7R A;  4WVF B;  5KQ1 A;  1FHO A;  5C16 A;  3BIN A;  2ADZ A;  2I5C A;  4F7U P;  2M14 A;  2EC1 A;  4CYE A;  1ZC3 B;  3F5R A;  3PP2 A;  1ISN A;  1WJ1 A;  4GMX B;  4GPT B;  2D9Z A;  1MPH A;  1ZC4 B;  2OTX A;  2Z4D A;  5D3X A;  2V76 A;  2YT1 A;  2DLW A;  1XX0 A;  3TVV A;  4HDO A;  1X1F A;  2Y7B A;  2KUQ A;  1B55 A;  2D9X A;  1BTK A;  3DXC A;  4QJ3 B;  5KCV A;  2L2I A;  5D3W A;  2PZ1 A;  1MIX A;  5DI9 B;  2CY5 A;  4DIX A;  1RRP B;  1EVH A;  4GNK B;  2COC A;  1SHC A;  1KZG A;  2RUK B;  4OSN A;  1FGY A;  4F7H A;  3FVC A;  2BCJ A;  5EFX A;  2DHK A;  1QQG A;  1AWE A;  1UNR A;  2OQB A;  2N23 A;  2CY4 A;  4HDQ A;  1P5T A;  2K2U A;  2LUL A;  1XCG A;  3U7D A;  3KY9 A;  2Z0Q A;  3MPX A;  1U5D A;  5HE0 A;  2NZ8 B;  5GOW B;  2EJ8 A;  1GG3 A;  1KI1 B;  3HK0 A;  1N3H A;  3WA0 A;  3FEH A;  5DHA B;  4GMV A;  1V5M A;  3NWF A;  1AQC A;  2KCJ A;  2RSG A;  1ZSQ A;  4IAP A;  4DBB A;  1MAI A;  2AEH A;  1UEF A;  2W2X D;  2QKM A;  1X86 A;  4CHJ A;  2IYB A;  2D11 A;  2DN6 A;  3ODO A;  2DYN A;  4GZU A;  2J0M A;  5I2M A;  2GUM A;  1WGQ A;  4GN1 A;  4MT7 A;  4ZRJ A;  4MY6 A;  1P6S A;  4YON A;  2GCL A;  2R2Y A;  3FM8 C;  2D10 A;  3CXB B;  3D8F A;  1TXD A;  5JHH A;  2Z13 A;  1DBH A;  1LW3 A;  2Z59 A;  5L81 A;  1BAK A;  4HAZ B;  5HE2 A;  3A8P A;  2ELA A;  1DYN A;  4EKU A;  3ML4 A;  1OY2 A;  2W2X C;  4IFS A;  2DTC A;  3NWA A;  4XWX A;  4CSQ A;  4HHV A;  2YS5 A;  1DDV A;  1X11 A;  1DDW A;  1V89 A;  5J3Q A;  1IRS A;  2RLO A;  3DXD A;  5DHF B;  1FGZ A;  2UZR A;  4A6H A;  3B77 A;  4DX8 A;  2DFK A;  2FJU B;  5C5B B;  1BWN A;  3LJU X;  4Z2M B;  2DHI A;  2EMT A;  4HAW B;  2CAY A;  1FAO A;  1Q67 A;  2DKQ A;  3GYO A;  3MDB C;  2M38 A;  2ZKM X;  3ZDT A;  2Y8F A;  4WSF A;  1NI2 A;  4TYZ A;  3P6A A;  3VIA A;  1V88 A;  2D9V A;  1X05 A;  4YL8 A;  2L1C A;  4A6F B;  2J59 M;  4GOU A;  3PSC A;  4ZRI A;  4HB4 B;  3ZVR A;  3NW8 A;  2I1K A;  4QJ5 B;  5LOP B;  2D9Y A;  1H10 A;  2UZS A;  1RJ2 A;  3N7C A;  1U5G A;  2I5F A;  3G9W A;  5FI1 A;  3SO6 A;  2Y8G A;  1W1D A;  4B6H A;  4KHB A;  1MI1 A;  5HE3 A;  2ROZ B;  2VSZ A;  1J0W A;  3M1I B;  4KAX B;  2NMB A;  3AJ4 A;  1ZYI A;  4PQ0 A;  3KRW A;  3ODW A;  2GS0 A;  4TKN A;  1PMS A;  2K00 A;  1UPR A;  2MDX A;  2W2W A;  1XD4 A;  3ULC A;  1TQZ A;  2X18 A;  1XKE A;  4HSI A;  2R09 A;  5CLQ B;  1MK9 B;  1P3R A;  1GC6 A;  1FHX A;  3ODX A;  2ELB A;  2Q13 A;  1NTY A;  2YT2 A;  1X1G A;  1Y5O A;  3TO1 A;  4H8S A;  1ZM0 A;  2DX5 A;  2D9W A;  5C79 A;  1I7A A;  2VKI A;  3ULB A;  1U2B A;  4EJN A;  1V5P A;  4HB3 B; 
#chains in the Genus database with same CATH homology
 1Z87 A;  4KVG B;  2D2Q A;  1GC7 A;  4A6F A;  2LYD A;  3X23 A;  5D3Y A;  2MWN B;  4PNK A;  1FOE A;  2RNR B;  4DX9 0;  4NY0 A;  3PZD A;  1U5F A;  3GYP A;  1U5E A;  3QWM A;  2P0H A;  3P7Z A;  5D27 A;  1KZ7 A;  2FJL A;  2KGX B;  2P0D A;  4C0A A;  1K5G B;  1WG7 A;  4KHA A;  1M7E A;  3V5W A;  3F0W A;  2UVM A;  3KZ1 A;  3OAN A;  4KHO A;  1UNQ A;  4HAU B;  4EMO A;  5D3V A;  4IOY X;  1XOD A;  4BBK A;  3TFM A;  2YS1 A;  1MKE A;  2K2J A;  2QKL A;  3PVU A;  2COA A;  1ZVR A;  2EMS A;  3RCP A;  4HAV B;  3QIJ A;  4K2P A;  3PVW A;  3D8D A;  1K5D B;  2KUP A;  2E2X A;  2JP2 A;  1OQN A;  3CIK A;  2GJY A;  3FSS A;  5KQ4 A;  2LOZ A;  2RGN B;  3IVF A;  2H7E A;  3A8Q A;  2Z0P A;  3A98 B;  3PVL A;  1U27 A;  1FB8 A;  1PLS A;  4CHM A;  2YVC A;  2Z0O A;  1NTV A;  2P0F A;  1EF1 A;  5FI0 A;  1WJM A;  1EGX A;  1W1G A;  3PG7 A;  3O96 A;  2MKR A;  3HW2 B;  5J3T A;  2AL6 A;  2YRY A;  3BJI A;  2HTH B;  3TW1 A;  2LKO A;  3U8Z A;  3NSU A;  5JLJ B;  4ZRK A;  3PEG A;  2RVB B;  1UPQ A;  4HAT B;  5DH9 B;  5JHG A;  5LON B;  1Y19 B;  2YF0 A;  2ROV A;  2N0Y A;  1DDM A;  4D0N B;  3KRX A;  2D4Q A;  2J0J A;  4A6K A;  3QBV B;  2I1J A;  2LOX A;  3KSY A;  4HAY B;  1UNP A;  2R0D A;  2MFQ A;  4HAX B;  4HB0 B;  4NSW A;  4A5K A;  5DIF B;  5C5B A;  2H7D A;  2COD A;  5C6R A;  1XR0 B;  4P7I A;  3SV1 A;  3D8E A;  4L6E A;  3T06 A;  1H4R A;  2YS3 A;  1SGH A;  5HE1 A;  4K17 A;  4MK0 A;  1NU2 A;  2CRF A;  1MK7 B;  2COF A;  1WGU A;  3HQC A;  1J19 A;  4HB2 B;  1WVH A;  3SUZ A;  1V61 A;  1MIZ B;  2YSZ A;  4K2O A;  2J0K A;  1BTN A;  1U29 A;  1LB1 A;  3WYF B;  2G35 A;  5J3Y A;  1FHW A;  2LG1 A;  2P8V A;  4KHB B;  1V5U A;  1TJ6 A;  4F7G A;  1QC6 A;  3AU4 A;  1WI1 A;  1OMW A;  3VOQ A;  4Y94 A;  2DA0 A;  2DYQ A;  1DRO A;  3SNH A;  3UZT A;  4GXB A;  1EAZ A;  3TCA A;  2GCJ A;  2ZPY A;  3DXE A;  3SYX A;  2DX1 A;  2DKP A;  4Z2N A;  2YT0 A;  2DHJ A;  2XQN M;  5CLL B;  3AU5 A;  5JP4 A;  1I2H A;  4K81 A;  2VRW B;  2IFS A;  4WJ7 A;  2HE7 A;  1W1H A;  4DXA B;  1PFJ A;  1E5W A;  1M7R A;  4WVF B;  5KQ1 A;  1FHO A;  5C16 A;  3BIN A;  2ADZ A;  2I5C A;  4F7U P;  2M14 A;  2EC1 A;  4CYE A;  1ZC3 B;  3F5R A;  3PP2 A;  1ISN A;  1WJ1 A;  4GMX B;  4GPT B;  2D9Z A;  1MPH A;  1ZC4 B;  2OTX A;  5D3X A;  2V76 A;  2YT1 A;  2DLW A;  1XX0 A;  3TVV A;  4HDO A;  1X1F A;  2Y7B A;  1B55 A;  2D9X A;  1BTK A;  3DXC A;  5KCV A;  2L2I A;  5D3W A;  2PZ1 A;  1MIX A;  5DI9 B;  2CY5 A;  1RRP B;  1EVH A;  2COC A;  1SHC A;  1KZG A;  2RUK B;  1FGY A;  4F7H A;  2BCJ A;  5EFX A;  2DHK A;  1QQG A;  1AWE A;  1UNR A;  2OQB A;  2N23 A;  2CY4 A;  4HDQ A;  1P5T A;  2K2U A;  2LUL A;  1XCG A;  3U7D A;  3KY9 A;  2Z0Q A;  3MPX A;  1U5D A;  5HE0 A;  2NZ8 B;  5GOW B;  2EJ8 A;  1GG3 A;  1KI1 B;  3HK0 A;  1N3H A;  3WA0 A;  3FEH A;  5DHA B;  4GMV A;  1V5M A;  1AQC A;  2KCJ A;  2RSG A;  1ZSQ A;  4IAP A;  4DBB A;  1MAI A;  2AEH A;  1UEF A;  2W2X D;  2QKM A;  1X86 A;  4CHJ A;  2IYB A;  2D11 A;  2DN6 A;  3ODO A;  2DYN A;  4GZU A;  2J0M A;  1WGQ A;  4GN1 A;  4MT7 A;  4ZRJ A;  4MY6 A;  1P6S A;  4YON A;  2GCL A;  3FM8 C;  2D10 A;  3CXB B;  3D8F A;  1TXD A;  5JHH A;  1DBH A;  1LW3 A;  5L81 A;  1BAK A;  4HAZ B;  5HE2 A;  3A8P A;  2ELA A;  1DYN A;  4EKU A;  3ML4 A;  1OY2 A;  2W2X C;  4IFS A;  2DTC A;  4XWX A;  4HHV A;  2YS5 A;  1DDV A;  1X11 A;  1DDW A;  1V89 A;  5J3Q A;  1IRS A;  2RLO A;  3DXD A;  5DHF B;  1FGZ A;  2UZR A;  4A6H A;  4DX8 A;  2DFK A;  5C5B B;  1BWN A;  3LJU X;  4Z2M B;  2DHI A;  2EMT A;  4HAW B;  2CAY A;  1FAO A;  1Q67 A;  2DKQ A;  3GYO A;  3MDB C;  2M38 A;  3ZDT A;  2Y8F A;  4WSF A;  1NI2 A;  4TYZ A;  3P6A A;  3VIA A;  1V88 A;  2D9V A;  1X05 A;  4YL8 A;  2L1C A;  4A6F B;  2J59 M;  3PSC A;  4ZRI A;  4HB4 B;  3ZVR A;  2I1K A;  5LOP B;  2D9Y A;  1H10 A;  2UZS A;  1RJ2 A;  3N7C A;  1U5G A;  2I5F A;  3G9W A;  5FI1 A;  3SO6 A;  2Y8G A;  1W1D A;  4B6H A;  5HE3 A;  2ROZ B;  2VSZ A;  1J0W A;  3M1I B;  4KAX B;  2NMB A;  3AJ4 A;  4PQ0 A;  3KRW A;  3ODW A;  2GS0 A;  4TKN A;  1PMS A;  2K00 A;  1UPR A;  2MDX A;  2W2W A;  1XD4 A;  3ULC A;  1TQZ A;  2X18 A;  1XKE A;  2R09 A;  5CLQ B;  1MK9 B;  1P3R A;  1GC6 A;  1FHX A;  3ODX A;  2ELB A;  2Q13 A;  1NTY A;  1X1G A;  1Y5O A;  3TO1 A;  4H8S A;  1ZM0 A;  2DX5 A;  2D9W A;  5C79 A;  1I7A A;  2VKI A;  3ULB A;  1U2B A;  4EJN A;  1V5P A;  4HB3 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...