4BBKA

Structural and functional characterisation of the kindlin-1 pleckstrin homology domain
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
128
structure length
121
Chain Sequence
b'PKLADYLKLFRACKQYWFVFKDTSIAYFKNKELEQGEPIEKLNLRGCEIVPDVNVSGRKFGIKLLIPVADGMNEVYLRCDHEDQYARWMAACILASKGKTMADSSYQPEVISILSFLKMKN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords FERMITIN FAMILY HOMOLOG 1
publication title Structural and Functional Characterisation of the Kindlin-1 Pleckstrin Homology Domain
pubmed doi rcsb
source organism Mus musculus
molecule tags Cell adhesion
total genus 34
structure length 121
sequence length 128
ec nomenclature
pdb deposition date 2012-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4bbkA00
3AU4A 2M38A 1U5DA 3F5RA 2R0DA 1B55A 2N0YA 2Y8GA 2LG1A 4EKUA 4IOYX 4WVFB 2D4QA 2UZRA 1GG3A 4IAPA 2AEHA 5CLQB 3A8PA 2KGXB 4K81A 2LULA 5J3YA 3X23A 4DBBA 3LJUX 5JHGA 1QQGA 3G9WA 4K2PA 3PP2A 3CIKA 3AJ4A 4F7UP 2COFA 2P8VA 5J3QA 1UPQA 2YT0A 3MPXA 4GN1A 4A5KA 4HB3B 1UNPA 4K2OA 4NY0A 5C6RA 3PZDA 1SGHA 4C0AA 2PZ1A 1FHOA 4KHBB 2EC1A 1MAIA 2YS5A 1Y19B 2DKQA 2H7DA 4HB0B 1U29A 5DI9B 4PNKA 2X18A 2Z0OA 4YL8A 1I7AA 1X05A 1WGUA 2IFSA 1V61A 3ODWA 5HE1A 4KHAA 2NZ8B 3KSYA 5HE3A 2Y8FA 2Z0PA 4IFSA 2I5FA 3MDBC 1Q67A 1PFJA 1W1DA 1UPRA 1X86A 2DLWA 2CY5A 5C79A 2UZSA 5J3TA 4KAXB 2K2UA 3AU5A 1RJ2A 1ISNA 2UVMA 1N3HA 2D11A 3PVLA 1GC6A 3A98B 4HAZB 3SNHA 1AWEA 1W1HA 1PMSA 3DXDA 1NTVA 3CXBB 3SO6A 2D9ZA 5KQ4A 2GCJA 1X11A 2L2IA 2YRYA 5EFXA 5LOPB 1ZSQA 1FOEA 1EGXA 2RUKB 3HW2B 1DBHA 2W2XC 1WVHA 2R09A 3RCPA 3SYXA 2DA0A 1ZM0A 5KCVA 2RVBB 2DYQA 3U8ZA 1MIXA 1KZGA 3A8QA 5C5BB 2LKOA 3OANA 4TKNA 4GXBA 4B6HA 1J19A 3BINA 2COAA 1FAOA 2Z0QA 4H8SA 5D27A 3PG7A 2E2XA 4DXAB 4XWXA 4HAXB 4A6FB 2GCLA 1NTYA 1PLSA 2DHJA 2COCA 4D0NB 2J0MA 1DROA 1ZVRA 3ODXA 4TYZA 4L6EA 1J0WA 4GMVA 3U7DA 1TJ6A 2P0DA 1K5GB 2EMTA 1P5TA 3O96A 1P3RA 2YSZA 2ZPYA 3F0WA 1LB1A 4GMXB 2J0KA 2I1JA 1M7RA 1V5MA 1EVHA 1E5WA 2DHIA 2VKIA 3TO1A 4CHMA 2BCJA 5D3YA 2IYBA 5D3XA 2ELBA 2KCJA 3WYFB 4ZRIA 2RGNB 2ADZA 2LYDA 1XD4A 2MWNB 4HB2B 1AQCA 3N7CA 3TW1A 2CRFA 1BWNA 3D8DA 4MY6A 3QWMA 2CAYA 5HE2A 2OQBA 1NU2A 4DX8A 2Q13A 4A6KA 2QKLA 4KVGB 1EAZA 2D9YA 5JHHA 4HAYB 3QBVB 2CODA 4GPTB 2K00A 4CHJA 2D9WA 2K2JA 2MDXA 1BTNA 3UZTA 3IVFA 3VOQA 2W2WA 2YF0A 1UNRA 2J0JA 2MFQA 3TFMA 1X1FA 3ULBA 3D8EA 3P7ZA 2VRWB 3HK0A 1H10A 4MT7A 2DTCA 5DHAB 3KRWA 1TXDA 2Y7BA 2RNRB 2D2QA 2HE7A 2VSZA 3V5WA 1SHCA 2YS1A 5FI1A 2EJ8A 2DX5A 2CY4A 4HAUB 1WJMA 1OQNA 4HB4B 3SV1A 4HDQA 5JLJB 1FHWA 2EMSA 2G35A 2KUPA 5D3WA 4YONA 2XQNM 5L81A 3ZVRA 1LW3A 2D9VA 1I2HA 1Y5OA 2RSGA 1QC6A 4HATB 3DXEA 4BBKA 2LOXA 1WJ1A 1U5FA 3P6AA 3ODOA 4EJNA 4ZRKA 4WJ7A 4NSWA 1MPHA 4P7IA 4HDOA 1P6SA 1MIZB 1GC7A 5CLLB 2DHKA 5KQ1A 3ULCA 2JP2A 2ELAA 1BAKA 3BJIA 2V76A 3FSSA 1V5PA 1XKEA 1W1GA 3D8FA 1FGZA 2YVCA 5C16A 3WA0A 4DX90 2P0FA 2W2XD 2YS3A 1WG7A 3DXCA 1UNQA 4A6FA 1UEFA 5DH9B 1U5EA 3VIAA 2FJLA 2P0HA 2GJYA 1WGQA 3PVWA 3NSUA 2I1KA 1OY2A 1BTKA 2N23A 3GYPA 4EMOA 3QIJA 2AL6A 3ZDTA 4PQ0A 5D3VA 4GZUA 2DKPA 1X1GA 5DHFB 1KZ7A 1XR0B 2NMBA 1H4RA 4KHOA 1WI1A 1XX0A 5JP4A 1DDMA 1DYNA 3TVVA 2LOZA 4K17A 2ROZB 1NI2A 4A6HA 1XODA 1V88A 2DN6A 3T06A 1RRPB 1EF1A 2HTHB 5FI0A 2D10A 4F7GA 4Z2NA 2RLOA 2QKMA 4HAVB 1XCGA 3FM8C 2YT1A 1U5GA 4MK0A 1FHXA 1K5DB 2GS0A 2DFKA 1FB8A 2MKRA 1M7EA 3KZ1A 1MK9B 1KI1B 1U27A 2DX1A 5DIFB 2M14A 2D9XA 2H7EA 3TCAA 5GOWB 1DDWA 3KY9A 4F7HA 5HE0A 1V5UA 2ROVA 2DYNA 3PVUA 3M1IB 4HHVA 4ZRJA 1FGYA 1OMWA 3KRXA 4CYEA 3HQCA 4Z2MB 4Y94A 2L1CA 3PSCA 5LONB 1IRSA 1U2BA 1V89A 2I5CA 1ZC4B 1DDVA 4HAWB 3PEGA 1ZC3B 1TQZA 1Z87A 1MK7B 1MKEA 4WSFA 3ML4A 2OTXA 3FEHA 5C5BA 2J59M 3GYOA 3SUZA
chains in the Genus database with same CATH superfamily
3AU4A 2M38A 1U5DA 3F5RA 4CSQA 2R0DA 1B55A 2N0YA 2Y8GA 2Z59A 2LG1A 4EKUA 4IOYX 4WVFB 2D4QA 2UZRA 4OSNA 1GG3A 4IAPA 2AEHA 5CLQB 3A8PA 2KGXB 4K81A 2LULA 5J3YA 3X23A 4DBBA 3LJUX 5JHGA 1QQGA 3HIEA 3G9WA 4DIXA 4K2PA 3PP2A 3CIKA 3AJ4A 4F7UP 5I2MA 2COFA 2P8VA 5J3QA 1UPQA 2YT0A 3MPXA 4GN1A 4A5KA 4HB3B 1UNPA 4K2OA 4NY0A 5C6RA 3PZDA 2KIEA 1SGHA 2K49A 4C0AA 2PZ1A 1FHOA 4KHBB 2EC1A 1MAIA 2YS5A 1Y19B 2ZKMX 2DKQA 2H7DA 4HB0B 1U29A 5DI9B 4PNKA 2X18A 2Z0OA 4YL8A 1I7AA 1X05A 1WGUA 2IFSA 1V61A 3ODWA 4D6WA 5HE1A 4KHAA 2Z13A 5M4YB 2NZ8B 2Z4DA 3KSYA 5HE3A 2Y8FA 2Z0PA 4IFSA 2I5FA 3MDBC 1Q67A 1PFJA 1W1DA 1UPRA 1X86A 2DLWA 2CY5A 5C79A 2UZSA 5J3TA 4KAXB 2K2UA 3AU5A 5I2SA 1RJ2A 1ISNA 2UVMA 1N3HA 2D11A 3PVLA 1GC6A 3A98B 4HAZB 3SNHA 1AWEA 1W1HA 1PMSA 3DXDA 1NTVA 3CXBB 3SO6A 2D9ZA 5KQ4A 2GCJA 1X11A 2L2IA 2YRYA 5EFXA 5LOPB 5IRSA 1ZSQA 1FOEA 4GNKB 1EGXA 2RUKB 3HW2B 1DBHA 2W2XC 1WVHA 2R09A 3RCPA 3SYXA 2DA0A 1ZM0A 5KCVA 2RVBB 2DYQA 3U8ZA 1MIXA 1KZGA 3A8QA 5C5BB 2LKOA 3OANA 4TKNA 4GXBA 4B6HA 1J19A 3BINA 3B77A 2COAA 1FAOA 2KR0A 5LG4B 4L1RA 2Z0QA 4H8SA 5D27A 3PG7A 2E2XA 4DXAB 4XWXA 4HAXB 4A6FB 2GCLA 1NTYA 1PLSA 2DHJA 2COCA 4D0NB 2J0MA 3U12A 1DROA 1ZVRA 3ODXA 4TYZA 4L6EA 1J0WA 3NWAA 4GMVA 3U7DA 1TJ6A 2P0DA 1K5GB 2EMTA 1ZYIA 1P5TA 3O96A 1P3RA 2YSZA 2ZPYA 3F0WA 1LB1A 4GMXB 2J0KA 2I1JA 1M7RA 1V5MA 1EVHA 1E5WA 2K8EA 2NBVA 2DHIA 2VKIA 3TO1A 4CHMA 2BCJA 5D3YA 2IYBA 5D3XA 2ELBA 2KCJA 3WYFB 4HSIA 4ZRIA 2RGNB 2ADZA 2LYDA 1XD4A 2MWNB 4HB2B 1AQCA 1MI1A 3N7CA 3TW1A 2CRFA 1BWNA 3D8DA 4MY6A 3QWMA 2CAYA 5HE2A 2OQBA 1NU2A 4DX8A 2Q13A 4A6KA 2QKLA 4KVGB 1EAZA 2D9YA 5JHHA 4HAYB 3QBVB 2CODA 4GPTB 2K00A 3GYOA 4CHJA 2D9WA 2K2JA 2MDXA 1BTNA 3UZTA 3IVFA 3VOQA 2KIGA 2W2WA 2YF0A 3FVCA 1UNRA 2J0JA 2MFQA 3TFMA 1X1FA 3ULBA 3D8EA 3P7ZA 2VRWB 3HK0A 1H10A 4MT7A 2DTCA 5DHAB 3KRWA 1TXDA 2Y7BA 2RNRB 2D2QA 2HE7A 2VSZA 3V5WA 1SHCA 2YS1A 5FI1A 2EJ8A 4QJ5B 2DX5A 2CY4A 4HAUB 1WJMA 1OQNA 3HSAA 4HB4B 3SV1A 4HDQA 5JLJB 1FHWA 2EMSA 2G35A 2KUPA 5D3WA 4YONA 2XQNM 5L81A 3ZVRA 1LW3A 2D9VA 1I2HA 1Y5OA 2RSGA 3A58A 1QC6A 4HATB 3DXEA 2RRFA 4BBKA 2LOXA 1WJ1A 1U5FA 3P6AA 3ODOA 4EJNA 4ZRKA 4WJ7A 4NSWA 1MPHA 4P7IA 4HDOA 3OHMB 1P6SA 1MIZB 1GC7A 5CLLB 2DHKA 2R2YA 5KQ1A 3ULCA 2JP2A 2ELAA 1BAKA 2KUQA 3BJIA 2V76A 3FSSA 1V5PA 1XKEA 1W1GA 3D8FA 1FGZA 2YVCA 5C16A 3WA0A 4DX90 2P0FA 2W2XD 2YS3A 4GOUA 1WG7A 3DXCA 1UNQA 4A6FA 1UEFA 5DH9B 1U5EA 3VIAA 2FJLA 2P0HA 2GJYA 1WGQA 3PVWA 3NSUA 2I1KA 1OY2A 1BTKA 2N23A 3GYPA 4EMOA 3QIJA 2AL6A 3ZDTA 4PQ0A 5D3VA 4GZUA 2GUMA 2Z14A 2DKPA 3NWFA 1X1GA 5DHFB 1KZ7A 1XR0B 2NMBA 4QJ4B 1H4RA 4KHOA 1WI1A 1T77A 4KHBA 1XX0A 5JP4A 1DDMA 4QJ3B 1DYNA 3TVVA 2LOZA 4K17A 2ROZB 1NI2A 4A6HA 1XODA 1V88A 2DN6A 3T06A 1RRPB 1EF1A 2HTHB 5FI0A 2D10A 4F7GA 4Z2NA 2RLOA 2QKMA 4HAVB 1XCGA 3FM8C 2YT1A 1U5GA 4MK0A 3NWDA 1FHXA 1K5DB 2GS0A 2DFKA 1FB8A 2MKRA 1M7EA 3KZ1A 1MK9B 1KI1B 1U27A 2DX1A 5DIFB 2M14A 2D9XA 2H7EA 3TCAA 5GOWB 1DDWA 3KY9A 4F7HA 5HE0A 1V5UA 2ROVA 2DYNA 3PVUA 3M1IB 4HHVA 4ZRJA 1FGYA 1OMWA 3KRXA 4CYEA 3DCXA 3HQCA 4Z2MB 4Y94A 2L1CA 3PSCA 5LONB 1IRSA 1U2BA 1V89A 2I5CA 4OT1A 1ZC4B 1DDVA 4HAWB 2YT2A 4QXAB 3PEGA 3NW8A 1ZC3B 1TQZA 1Z87A 1MK7B 1MKEA 4WSFA 2OTXA 3ML4A 3FEHA 5C5BA 2J59M 2FJUB 3SUZA
chains in the Genus database with same CATH topology
3AU4A 2M38A 1U5DA 3F5RA 2R0DA 1B55A 2N0YA 2Y8GA 2LG1A 4EKUA 4IOYX 4WVFB 2D4QA 2UZRA 1GG3A 4IAPA 2AEHA 5CLQB 3A8PA 2KGXB 4K81A 2LULA 5J3YA 3X23A 4DBBA 3LJUX 5JHGA 1QQGA 3G9WA 4K2PA 3PP2A 3CIKA 3AJ4A 4F7UP 2COFA 2P8VA 5J3QA 1UPQA 2YT0A 3MPXA 4GN1A 4A5KA 4HB3B 1UNPA 4K2OA 4NY0A 5C6RA 3PZDA 1SGHA 4C0AA 2PZ1A 1FHOA 4KHBB 2EC1A 1MAIA 2YS5A 1Y19B 2DKQA 2H7DA 4HB0B 1U29A 5DI9B 4PNKA 2X18A 2Z0OA 4YL8A 1I7AA 1X05A 1WGUA 2IFSA 1V61A 3ODWA 5HE1A 4KHAA 2NZ8B 3KSYA 5HE3A 2Y8FA 2Z0PA 4IFSA 2I5FA 3MDBC 1Q67A 1PFJA 1W1DA 1UPRA 1X86A 2DLWA 2CY5A 5C79A 2UZSA 5J3TA 4KAXB 2K2UA 3AU5A 1RJ2A 1ISNA 2UVMA 1N3HA 2D11A 3PVLA 1GC6A 3A98B 4HAZB 3SNHA 1AWEA 1W1HA 1PMSA 3DXDA 1NTVA 3CXBB 3SO6A 2D9ZA 5KQ4A 2GCJA 1X11A 2L2IA 2YRYA 5EFXA 5LOPB 1ZSQA 1FOEA 1EGXA 2RUKB 3HW2B 1DBHA 2W2XC 1WVHA 2R09A 3RCPA 3SYXA 2DA0A 1ZM0A 5KCVA 2RVBB 2DYQA 3U8ZA 1MIXA 1KZGA 3A8QA 5C5BB 2LKOA 3OANA 4TKNA 4GXBA 4B6HA 1J19A 3BINA 2COAA 1FAOA 2Z0QA 4H8SA 5D27A 3PG7A 2E2XA 4DXAB 4XWXA 4HAXB 4A6FB 2GCLA 1NTYA 1PLSA 2DHJA 2COCA 4D0NB 2J0MA 1DROA 1ZVRA 3ODXA 4TYZA 4L6EA 1J0WA 4GMVA 3U7DA 1TJ6A 2P0DA 1K5GB 2EMTA 1P5TA 3O96A 1P3RA 2YSZA 2ZPYA 3F0WA 1LB1A 4GMXB 2J0KA 2I1JA 1M7RA 1V5MA 1EVHA 1E5WA 2DHIA 2VKIA 3TO1A 4CHMA 2BCJA 5D3YA 2IYBA 5D3XA 2ELBA 2KCJA 3WYFB 4ZRIA 2RGNB 2ADZA 2LYDA 1XD4A 2MWNB 4HB2B 1AQCA 3N7CA 3TW1A 2CRFA 1BWNA 3D8DA 4MY6A 3QWMA 2CAYA 5HE2A 2OQBA 1NU2A 4DX8A 2Q13A 4A6KA 2QKLA 4KVGB 1EAZA 2D9YA 5JHHA 4HAYB 3QBVB 2CODA 4GPTB 2K00A 4CHJA 2D9WA 2K2JA 2MDXA 1BTNA 3UZTA 3IVFA 3VOQA 2W2WA 2YF0A 1UNRA 2J0JA 2MFQA 3TFMA 1X1FA 3ULBA 3D8EA 3P7ZA 2VRWB 3HK0A 1H10A 4MT7A 2DTCA 5DHAB 3KRWA 1TXDA 2Y7BA 2RNRB 2D2QA 2HE7A 2VSZA 3V5WA 1SHCA 2YS1A 5FI1A 2EJ8A 2DX5A 2CY4A 4HAUB 1WJMA 1OQNA 4HB4B 3SV1A 4HDQA 5JLJB 1FHWA 2EMSA 2G35A 2KUPA 5D3WA 4YONA 2XQNM 5L81A 3ZVRA 1LW3A 2D9VA 1I2HA 1Y5OA 2RSGA 1QC6A 4HATB 3DXEA 4BBKA 2LOXA 1WJ1A 1U5FA 3P6AA 3ODOA 4EJNA 4ZRKA 4WJ7A 4NSWA 1MPHA 4P7IA 4HDOA 1P6SA 1MIZB 1GC7A 5CLLB 2DHKA 5KQ1A 3ULCA 2JP2A 2ELAA 1BAKA 3BJIA 2V76A 3FSSA 1V5PA 1XKEA 1W1GA 3D8FA 1FGZA 2YVCA 5C16A 3WA0A 4DX90 2P0FA 2W2XD 2YS3A 1WG7A 3DXCA 1UNQA 4A6FA 1UEFA 5DH9B 1U5EA 3VIAA 2FJLA 2P0HA 2GJYA 1WGQA 3PVWA 3NSUA 2I1KA 1OY2A 1BTKA 2N23A 3GYPA 4EMOA 3QIJA 2AL6A 3ZDTA 4PQ0A 5D3VA 4GZUA 2DKPA 1X1GA 5DHFB 1KZ7A 1XR0B 2NMBA 1H4RA 4KHOA 1WI1A 1XX0A 5JP4A 1DDMA 1DYNA 3TVVA 2LOZA 4K17A 2ROZB 1NI2A 4A6HA 1XODA 1V88A 2DN6A 3T06A 1RRPB 1EF1A 2HTHB 5FI0A 2D10A 4F7GA 4Z2NA 2RLOA 2QKMA 4HAVB 1XCGA 3FM8C 2YT1A 1U5GA 4MK0A 1FHXA 1K5DB 2GS0A 2DFKA 1FB8A 2MKRA 1M7EA 3KZ1A 1MK9B 1KI1B 1U27A 2DX1A 5DIFB 2M14A 2D9XA 2H7EA 3TCAA 5GOWB 1DDWA 3KY9A 4F7HA 5HE0A 1V5UA 2ROVA 2DYNA 3PVUA 3M1IB 4HHVA 4ZRJA 1FGYA 1OMWA 3KRXA 4CYEA 3HQCA 4Z2MB 4Y94A 2L1CA 3PSCA 5LONB 1IRSA 1U2BA 1V89A 2I5CA 1ZC4B 1DDVA 4HAWB 3PEGA 1ZC3B 1TQZA 1Z87A 1MK7B 1MKEA 4WSFA 3ML4A 2OTXA 3FEHA 5C5BA 2J59M 3GYOA 3SUZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AU4 A;  2M38 A;  1U5D A;  3F5R A;  2R0D A;  1B55 A;  2N0Y A;  2Y8G A;  2LG1 A;  4EKU A;  4IOY X;  4WVF B;  2D4Q A;  2UZR A;  1GG3 A;  4IAP A;  2AEH A;  5CLQ B;  3A8P A;  2KGX B;  4K81 A;  2LUL A;  5J3Y A;  3X23 A;  4DBB A;  3LJU X;  5JHG A;  1QQG A;  3G9W A;  4K2P A;  3PP2 A;  3CIK A;  3AJ4 A;  4F7U P;  2COF A;  2P8V A;  5J3Q A;  1UPQ A;  2YT0 A;  3MPX A;  4GN1 A;  4A5K A;  4HB3 B;  1UNP A;  4K2O A;  4NY0 A;  5C6R A;  3PZD A;  1SGH A;  4C0A A;  2PZ1 A;  1FHO A;  4KHB B;  2EC1 A;  1MAI A;  2YS5 A;  1Y19 B;  2DKQ A;  2H7D A;  4HB0 B;  1U29 A;  5DI9 B;  4PNK A;  2X18 A;  2Z0O A;  4YL8 A;  1I7A A;  1X05 A;  1WGU A;  2IFS A;  1V61 A;  3ODW A;  5HE1 A;  4KHA A;  2NZ8 B;  3KSY A;  5HE3 A;  2Y8F A;  2Z0P A;  4IFS A;  2I5F A;  3MDB C;  1Q67 A;  1PFJ A;  1W1D A;  1UPR A;  1X86 A;  2DLW A;  2CY5 A;  5C79 A;  2UZS A;  5J3T A;  4KAX B;  2K2U A;  3AU5 A;  1RJ2 A;  1ISN A;  2UVM A;  1N3H A;  2D11 A;  3PVL A;  1GC6 A;  3A98 B;  4HAZ B;  3SNH A;  1AWE A;  1W1H A;  1PMS A;  3DXD A;  1NTV A;  3CXB B;  3SO6 A;  2D9Z A;  5KQ4 A;  2GCJ A;  1X11 A;  2L2I A;  2YRY A;  5EFX A;  5LOP B;  1ZSQ A;  1FOE A;  1EGX A;  2RUK B;  3HW2 B;  1DBH A;  2W2X C;  1WVH A;  2R09 A;  3RCP A;  3SYX A;  2DA0 A;  1ZM0 A;  5KCV A;  2RVB B;  2DYQ A;  3U8Z A;  1MIX A;  1KZG A;  3A8Q A;  5C5B B;  2LKO A;  3OAN A;  4TKN A;  4GXB A;  4B6H A;  1J19 A;  3BIN A;  2COA A;  1FAO A;  2Z0Q A;  4H8S A;  5D27 A;  3PG7 A;  2E2X A;  4DXA B;  4XWX A;  4HAX B;  4A6F B;  2GCL A;  1NTY A;  1PLS A;  2DHJ A;  2COC A;  4D0N B;  2J0M A;  1DRO A;  1ZVR A;  3ODX A;  4TYZ A;  4L6E A;  1J0W A;  4GMV A;  3U7D A;  1TJ6 A;  2P0D A;  1K5G B;  2EMT A;  1P5T A;  3O96 A;  1P3R A;  2YSZ A;  2ZPY A;  3F0W A;  1LB1 A;  4GMX B;  2J0K A;  2I1J A;  1M7R A;  1V5M A;  1EVH A;  1E5W A;  2DHI A;  2VKI A;  3TO1 A;  4CHM A;  2BCJ A;  5D3Y A;  2IYB A;  5D3X A;  2ELB A;  2KCJ A;  3WYF B;  4ZRI A;  2RGN B;  2ADZ A;  2LYD A;  1XD4 A;  2MWN B;  4HB2 B;  1AQC A;  3N7C A;  3TW1 A;  2CRF A;  1BWN A;  3D8D A;  4MY6 A;  3QWM A;  2CAY A;  5HE2 A;  2OQB A;  1NU2 A;  4DX8 A;  2Q13 A;  4A6K A;  2QKL A;  4KVG B;  1EAZ A;  2D9Y A;  5JHH A;  4HAY B;  3QBV B;  2COD A;  4GPT B;  2K00 A;  4CHJ A;  2D9W A;  2K2J A;  2MDX A;  1BTN A;  3UZT A;  3IVF A;  3VOQ A;  2W2W A;  2YF0 A;  1UNR A;  2J0J A;  2MFQ A;  3TFM A;  1X1F A;  3ULB A;  3D8E A;  3P7Z A;  2VRW B;  3HK0 A;  1H10 A;  4MT7 A;  2DTC A;  5DHA B;  3KRW A;  1TXD A;  2Y7B A;  2RNR B;  2D2Q A;  2HE7 A;  2VSZ A;  3V5W A;  1SHC A;  2YS1 A;  5FI1 A;  2EJ8 A;  2DX5 A;  2CY4 A;  4HAU B;  1WJM A;  1OQN A;  4HB4 B;  3SV1 A;  4HDQ A;  5JLJ B;  1FHW A;  2EMS A;  2G35 A;  2KUP A;  5D3W A;  4YON A;  2XQN M;  5L81 A;  3ZVR A;  1LW3 A;  2D9V A;  1I2H A;  1Y5O A;  2RSG A;  1QC6 A;  4HAT B;  3DXE A;  4BBK A;  2LOX A;  1WJ1 A;  1U5F A;  3P6A A;  3ODO A;  4EJN A;  4ZRK A;  4WJ7 A;  4NSW A;  1MPH A;  4P7I A;  4HDO A;  1P6S A;  1MIZ B;  1GC7 A;  5CLL B;  2DHK A;  5KQ1 A;  3ULC A;  2JP2 A;  2ELA A;  1BAK A;  3BJI A;  2V76 A;  3FSS A;  1V5P A;  1XKE A;  1W1G A;  3D8F A;  1FGZ A;  2YVC A;  5C16 A;  3WA0 A;  4DX9 0;  2P0F A;  2W2X D;  2YS3 A;  1WG7 A;  3DXC A;  1UNQ A;  4A6F A;  1UEF A;  5DH9 B;  1U5E A;  3VIA A;  2FJL A;  2P0H A;  2GJY A;  1WGQ A;  3PVW A;  3NSU A;  2I1K A;  1OY2 A;  1BTK A;  2N23 A;  3GYP A;  4EMO A;  3QIJ A;  2AL6 A;  3ZDT A;  4PQ0 A;  5D3V A;  4GZU A;  2DKP A;  1X1G A;  5DHF B;  1KZ7 A;  1XR0 B;  2NMB A;  1H4R A;  4KHO A;  1WI1 A;  1XX0 A;  5JP4 A;  1DDM A;  1DYN A;  3TVV A;  2LOZ A;  4K17 A;  2ROZ B;  1NI2 A;  4A6H A;  1XOD A;  1V88 A;  2DN6 A;  3T06 A;  1RRP B;  1EF1 A;  2HTH B;  5FI0 A;  2D10 A;  4F7G A;  4Z2N A;  2RLO A;  2QKM A;  4HAV B;  1XCG A;  3FM8 C;  2YT1 A;  1U5G A;  4MK0 A;  1FHX A;  1K5D B;  2GS0 A;  2DFK A;  1FB8 A;  2MKR A;  1M7E A;  3KZ1 A;  1MK9 B;  1KI1 B;  1U27 A;  2DX1 A;  5DIF B;  2M14 A;  2D9X A;  2H7E A;  3TCA A;  5GOW B;  1DDW A;  3KY9 A;  4F7H A;  5HE0 A;  1V5U A;  2ROV A;  2DYN A;  3PVU A;  3M1I B;  4HHV A;  4ZRJ A;  1FGY A;  1OMW A;  3KRX A;  4CYE A;  3HQC A;  4Z2M B;  4Y94 A;  2L1C A;  3PSC A;  5LON B;  1IRS A;  1U2B A;  1V89 A;  2I5C A;  1ZC4 B;  1DDV A;  4HAW B;  3PEG A;  1ZC3 B;  1TQZ A;  1Z87 A;  1MK7 B;  1MKE A;  4WSF A;  3ML4 A;  2OTX A;  3FEH A;  5C5B A;  2J59 M;  3GYO A;  3SUZ A; 
#chains in the Genus database with same CATH topology
 3AU4 A;  2M38 A;  1U5D A;  3F5R A;  4CSQ A;  2R0D A;  1B55 A;  2N0Y A;  2Y8G A;  2Z59 A;  2LG1 A;  4EKU A;  4IOY X;  4WVF B;  2D4Q A;  2UZR A;  4OSN A;  1GG3 A;  4IAP A;  2AEH A;  5CLQ B;  3A8P A;  2KGX B;  4K81 A;  2LUL A;  5J3Y A;  3X23 A;  4DBB A;  3LJU X;  5JHG A;  1QQG A;  3HIE A;  3G9W A;  4DIX A;  4K2P A;  3PP2 A;  3CIK A;  3AJ4 A;  4F7U P;  5I2M A;  2COF A;  2P8V A;  5J3Q A;  1UPQ A;  2YT0 A;  3MPX A;  4GN1 A;  4A5K A;  4HB3 B;  1UNP A;  4K2O A;  4NY0 A;  5C6R A;  3PZD A;  2KIE A;  1SGH A;  2K49 A;  4C0A A;  2PZ1 A;  1FHO A;  4KHB B;  2EC1 A;  1MAI A;  2YS5 A;  1Y19 B;  2ZKM X;  2DKQ A;  2H7D A;  4HB0 B;  1U29 A;  5DI9 B;  4PNK A;  2X18 A;  2Z0O A;  4YL8 A;  1I7A A;  1X05 A;  1WGU A;  2IFS A;  1V61 A;  3ODW A;  4D6W A;  5HE1 A;  4KHA A;  2Z13 A;  5M4Y B;  2NZ8 B;  2Z4D A;  3KSY A;  5HE3 A;  2Y8F A;  2Z0P A;  4IFS A;  2I5F A;  3MDB C;  1Q67 A;  1PFJ A;  1W1D A;  1UPR A;  1X86 A;  2DLW A;  2CY5 A;  5C79 A;  2UZS A;  5J3T A;  4KAX B;  2K2U A;  3AU5 A;  5I2S A;  1RJ2 A;  1ISN A;  2UVM A;  1N3H A;  2D11 A;  3PVL A;  1GC6 A;  3A98 B;  4HAZ B;  3SNH A;  1AWE A;  1W1H A;  1PMS A;  3DXD A;  1NTV A;  3CXB B;  3SO6 A;  2D9Z A;  5KQ4 A;  2GCJ A;  1X11 A;  2L2I A;  2YRY A;  5EFX A;  5LOP B;  5IRS A;  1ZSQ A;  1FOE A;  4GNK B;  1EGX A;  2RUK B;  3HW2 B;  1DBH A;  2W2X C;  1WVH A;  2R09 A;  3RCP A;  3SYX A;  2DA0 A;  1ZM0 A;  5KCV A;  2RVB B;  2DYQ A;  3U8Z A;  1MIX A;  1KZG A;  3A8Q A;  5C5B B;  2LKO A;  3OAN A;  4TKN A;  4GXB A;  4B6H A;  1J19 A;  3BIN A;  3B77 A;  2COA A;  1FAO A;  2KR0 A;  5LG4 B;  4L1R A;  2Z0Q A;  4H8S A;  5D27 A;  3PG7 A;  2E2X A;  4DXA B;  4XWX A;  4HAX B;  4A6F B;  2GCL A;  1NTY A;  1PLS A;  2DHJ A;  2COC A;  4D0N B;  2J0M A;  3U12 A;  1DRO A;  1ZVR A;  3ODX A;  4TYZ A;  4L6E A;  1J0W A;  3NWA A;  4GMV A;  3U7D A;  1TJ6 A;  2P0D A;  1K5G B;  2EMT A;  1ZYI A;  1P5T A;  3O96 A;  1P3R A;  2YSZ A;  2ZPY A;  3F0W A;  1LB1 A;  4GMX B;  2J0K A;  2I1J A;  1M7R A;  1V5M A;  1EVH A;  1E5W A;  2K8E A;  2NBV A;  2DHI A;  2VKI A;  3TO1 A;  4CHM A;  2BCJ A;  5D3Y A;  2IYB A;  5D3X A;  2ELB A;  2KCJ A;  3WYF B;  4HSI A;  4ZRI A;  2RGN B;  2ADZ A;  2LYD A;  1XD4 A;  2MWN B;  4HB2 B;  1AQC A;  1MI1 A;  3N7C A;  3TW1 A;  2CRF A;  1BWN A;  3D8D A;  4MY6 A;  3QWM A;  2CAY A;  5HE2 A;  2OQB A;  1NU2 A;  4DX8 A;  2Q13 A;  4A6K A;  2QKL A;  4KVG B;  1EAZ A;  2D9Y A;  5JHH A;  4HAY B;  3QBV B;  2COD A;  4GPT B;  2K00 A;  3GYO A;  4CHJ A;  2D9W A;  2K2J A;  2MDX A;  1BTN A;  3UZT A;  3IVF A;  3VOQ A;  2KIG A;  2W2W A;  2YF0 A;  3FVC A;  1UNR A;  2J0J A;  2MFQ A;  3TFM A;  1X1F A;  3ULB A;  3D8E A;  3P7Z A;  2VRW B;  3HK0 A;  1H10 A;  4MT7 A;  2DTC A;  5DHA B;  3KRW A;  1TXD A;  2Y7B A;  2RNR B;  2D2Q A;  2HE7 A;  2VSZ A;  3V5W A;  1SHC A;  2YS1 A;  5FI1 A;  2EJ8 A;  4QJ5 B;  2DX5 A;  2CY4 A;  4HAU B;  1WJM A;  1OQN A;  3HSA A;  4HB4 B;  3SV1 A;  4HDQ A;  5JLJ B;  1FHW A;  2EMS A;  2G35 A;  2KUP A;  5D3W A;  4YON A;  2XQN M;  5L81 A;  3ZVR A;  1LW3 A;  2D9V A;  1I2H A;  1Y5O A;  2RSG A;  3A58 A;  1QC6 A;  4HAT B;  3DXE A;  2RRF A;  4BBK A;  2LOX A;  1WJ1 A;  1U5F A;  3P6A A;  3ODO A;  4EJN A;  4ZRK A;  4WJ7 A;  4NSW A;  1MPH A;  4P7I A;  4HDO A;  3OHM B;  1P6S A;  1MIZ B;  1GC7 A;  5CLL B;  2DHK A;  2R2Y A;  5KQ1 A;  3ULC A;  2JP2 A;  2ELA A;  1BAK A;  2KUQ A;  3BJI A;  2V76 A;  3FSS A;  1V5P A;  1XKE A;  1W1G A;  3D8F A;  1FGZ A;  2YVC A;  5C16 A;  3WA0 A;  4DX9 0;  2P0F A;  2W2X D;  2YS3 A;  4GOU A;  1WG7 A;  3DXC A;  1UNQ A;  4A6F A;  1UEF A;  5DH9 B;  1U5E A;  3VIA A;  2FJL A;  2P0H A;  2GJY A;  1WGQ A;  3PVW A;  3NSU A;  2I1K A;  1OY2 A;  1BTK A;  2N23 A;  3GYP A;  4EMO A;  3QIJ A;  2AL6 A;  3ZDT A;  4PQ0 A;  5D3V A;  4GZU A;  2GUM A;  2Z14 A;  2DKP A;  3NWF A;  1X1G A;  5DHF B;  1KZ7 A;  1XR0 B;  2NMB A;  4QJ4 B;  1H4R A;  4KHO A;  1WI1 A;  1T77 A;  4KHB A;  1XX0 A;  5JP4 A;  1DDM A;  4QJ3 B;  1DYN A;  3TVV A;  2LOZ A;  4K17 A;  2ROZ B;  1NI2 A;  4A6H A;  1XOD A;  1V88 A;  2DN6 A;  3T06 A;  1RRP B;  1EF1 A;  2HTH B;  5FI0 A;  2D10 A;  4F7G A;  4Z2N A;  2RLO A;  2QKM A;  4HAV B;  1XCG A;  3FM8 C;  2YT1 A;  1U5G A;  4MK0 A;  3NWD A;  1FHX A;  1K5D B;  2GS0 A;  2DFK A;  1FB8 A;  2MKR A;  1M7E A;  3KZ1 A;  1MK9 B;  1KI1 B;  1U27 A;  2DX1 A;  5DIF B;  2M14 A;  2D9X A;  2H7E A;  3TCA A;  5GOW B;  1DDW A;  3KY9 A;  4F7H A;  5HE0 A;  1V5U A;  2ROV A;  2DYN A;  3PVU A;  3M1I B;  4HHV A;  4ZRJ A;  1FGY A;  1OMW A;  3KRX A;  4CYE A;  3DCX A;  3HQC A;  4Z2M B;  4Y94 A;  2L1C A;  3PSC A;  5LON B;  1IRS A;  1U2B A;  1V89 A;  2I5C A;  4OT1 A;  1ZC4 B;  1DDV A;  4HAW B;  2YT2 A;  4QXA B;  3PEG A;  3NW8 A;  1ZC3 B;  1TQZ A;  1Z87 A;  1MK7 B;  1MKE A;  4WSF A;  2OTX A;  3ML4 A;  3FEH A;  5C5B A;  2J59 M;  2FJU B;  3SUZ A; 
#chains in the Genus database with same CATH homology
 3AU4 A;  2M38 A;  1U5D A;  3F5R A;  2R0D A;  1B55 A;  2N0Y A;  2Y8G A;  2LG1 A;  4EKU A;  4IOY X;  4WVF B;  2D4Q A;  2UZR A;  1GG3 A;  4IAP A;  2AEH A;  5CLQ B;  3A8P A;  2KGX B;  4K81 A;  2LUL A;  5J3Y A;  3X23 A;  4DBB A;  3LJU X;  5JHG A;  1QQG A;  3G9W A;  4K2P A;  3PP2 A;  3CIK A;  3AJ4 A;  4F7U P;  2COF A;  2P8V A;  5J3Q A;  1UPQ A;  2YT0 A;  3MPX A;  4GN1 A;  4A5K A;  4HB3 B;  1UNP A;  4K2O A;  4NY0 A;  5C6R A;  3PZD A;  1SGH A;  4C0A A;  2PZ1 A;  1FHO A;  4KHB B;  2EC1 A;  1MAI A;  2YS5 A;  1Y19 B;  2DKQ A;  2H7D A;  4HB0 B;  1U29 A;  5DI9 B;  4PNK A;  2X18 A;  2Z0O A;  4YL8 A;  1I7A A;  1X05 A;  1WGU A;  2IFS A;  1V61 A;  3ODW A;  5HE1 A;  4KHA A;  2NZ8 B;  3KSY A;  5HE3 A;  2Y8F A;  2Z0P A;  4IFS A;  2I5F A;  3MDB C;  1Q67 A;  1PFJ A;  1W1D A;  1UPR A;  1X86 A;  2DLW A;  2CY5 A;  5C79 A;  2UZS A;  5J3T A;  4KAX B;  2K2U A;  3AU5 A;  1RJ2 A;  1ISN A;  2UVM A;  1N3H A;  2D11 A;  3PVL A;  1GC6 A;  3A98 B;  4HAZ B;  3SNH A;  1AWE A;  1W1H A;  1PMS A;  3DXD A;  1NTV A;  3CXB B;  3SO6 A;  2D9Z A;  5KQ4 A;  2GCJ A;  1X11 A;  2L2I A;  2YRY A;  5EFX A;  5LOP B;  1ZSQ A;  1FOE A;  1EGX A;  2RUK B;  3HW2 B;  1DBH A;  2W2X C;  1WVH A;  2R09 A;  3RCP A;  3SYX A;  2DA0 A;  1ZM0 A;  5KCV A;  2RVB B;  2DYQ A;  3U8Z A;  1MIX A;  1KZG A;  3A8Q A;  5C5B B;  2LKO A;  3OAN A;  4TKN A;  4GXB A;  4B6H A;  1J19 A;  3BIN A;  2COA A;  1FAO A;  2Z0Q A;  4H8S A;  5D27 A;  3PG7 A;  2E2X A;  4DXA B;  4XWX A;  4HAX B;  4A6F B;  2GCL A;  1NTY A;  1PLS A;  2DHJ A;  2COC A;  4D0N B;  2J0M A;  1DRO A;  1ZVR A;  3ODX A;  4TYZ A;  4L6E A;  1J0W A;  4GMV A;  3U7D A;  1TJ6 A;  2P0D A;  1K5G B;  2EMT A;  1P5T A;  3O96 A;  1P3R A;  2YSZ A;  2ZPY A;  3F0W A;  1LB1 A;  4GMX B;  2J0K A;  2I1J A;  1M7R A;  1V5M A;  1EVH A;  1E5W A;  2DHI A;  2VKI A;  3TO1 A;  4CHM A;  2BCJ A;  5D3Y A;  2IYB A;  5D3X A;  2ELB A;  2KCJ A;  3WYF B;  4ZRI A;  2RGN B;  2ADZ A;  2LYD A;  1XD4 A;  2MWN B;  4HB2 B;  1AQC A;  3N7C A;  3TW1 A;  2CRF A;  1BWN A;  3D8D A;  4MY6 A;  3QWM A;  2CAY A;  5HE2 A;  2OQB A;  1NU2 A;  4DX8 A;  2Q13 A;  4A6K A;  2QKL A;  4KVG B;  1EAZ A;  2D9Y A;  5JHH A;  4HAY B;  3QBV B;  2COD A;  4GPT B;  2K00 A;  4CHJ A;  2D9W A;  2K2J A;  2MDX A;  1BTN A;  3UZT A;  3IVF A;  3VOQ A;  2W2W A;  2YF0 A;  1UNR A;  2J0J A;  2MFQ A;  3TFM A;  1X1F A;  3ULB A;  3D8E A;  3P7Z A;  2VRW B;  3HK0 A;  1H10 A;  4MT7 A;  2DTC A;  5DHA B;  3KRW A;  1TXD A;  2Y7B A;  2RNR B;  2D2Q A;  2HE7 A;  2VSZ A;  3V5W A;  1SHC A;  2YS1 A;  5FI1 A;  2EJ8 A;  2DX5 A;  2CY4 A;  4HAU B;  1WJM A;  1OQN A;  4HB4 B;  3SV1 A;  4HDQ A;  5JLJ B;  1FHW A;  2EMS A;  2G35 A;  2KUP A;  5D3W A;  4YON A;  2XQN M;  5L81 A;  3ZVR A;  1LW3 A;  2D9V A;  1I2H A;  1Y5O A;  2RSG A;  1QC6 A;  4HAT B;  3DXE A;  4BBK A;  2LOX A;  1WJ1 A;  1U5F A;  3P6A A;  3ODO A;  4EJN A;  4ZRK A;  4WJ7 A;  4NSW A;  1MPH A;  4P7I A;  4HDO A;  1P6S A;  1MIZ B;  1GC7 A;  5CLL B;  2DHK A;  5KQ1 A;  3ULC A;  2JP2 A;  2ELA A;  1BAK A;  3BJI A;  2V76 A;  3FSS A;  1V5P A;  1XKE A;  1W1G A;  3D8F A;  1FGZ A;  2YVC A;  5C16 A;  3WA0 A;  4DX9 0;  2P0F A;  2W2X D;  2YS3 A;  1WG7 A;  3DXC A;  1UNQ A;  4A6F A;  1UEF A;  5DH9 B;  1U5E A;  3VIA A;  2FJL A;  2P0H A;  2GJY A;  1WGQ A;  3PVW A;  3NSU A;  2I1K A;  1OY2 A;  1BTK A;  2N23 A;  3GYP A;  4EMO A;  3QIJ A;  2AL6 A;  3ZDT A;  4PQ0 A;  5D3V A;  4GZU A;  2DKP A;  1X1G A;  5DHF B;  1KZ7 A;  1XR0 B;  2NMB A;  1H4R A;  4KHO A;  1WI1 A;  1XX0 A;  5JP4 A;  1DDM A;  1DYN A;  3TVV A;  2LOZ A;  4K17 A;  2ROZ B;  1NI2 A;  4A6H A;  1XOD A;  1V88 A;  2DN6 A;  3T06 A;  1RRP B;  1EF1 A;  2HTH B;  5FI0 A;  2D10 A;  4F7G A;  4Z2N A;  2RLO A;  2QKM A;  4HAV B;  1XCG A;  3FM8 C;  2YT1 A;  1U5G A;  4MK0 A;  1FHX A;  1K5D B;  2GS0 A;  2DFK A;  1FB8 A;  2MKR A;  1M7E A;  3KZ1 A;  1MK9 B;  1KI1 B;  1U27 A;  2DX1 A;  5DIF B;  2M14 A;  2D9X A;  2H7E A;  3TCA A;  5GOW B;  1DDW A;  3KY9 A;  4F7H A;  5HE0 A;  1V5U A;  2ROV A;  2DYN A;  3PVU A;  3M1I B;  4HHV A;  4ZRJ A;  1FGY A;  1OMW A;  3KRX A;  4CYE A;  3HQC A;  4Z2M B;  4Y94 A;  2L1C A;  3PSC A;  5LON B;  1IRS A;  1U2B A;  1V89 A;  2I5C A;  1ZC4 B;  1DDV A;  4HAW B;  3PEG A;  1ZC3 B;  1TQZ A;  1Z87 A;  1MK7 B;  1MKE A;  4WSF A;  3ML4 A;  2OTX A;  3FEH A;  5C5B A;  2J59 M;  3GYO A;  3SUZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...