4BBKA

Structural and functional characterisation of the kindlin-1 pleckstrin homology domain
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
128
structure length
121
Chain Sequence
PKLADYLKLFRACKQYWFVFKDTSIAYFKNKELEQGEPIEKLNLRGCEIVPDVNVSGRKFGIKLLIPVADGMNEVYLRCDHEDQYARWMAACILASKGKTMADSSYQPEVISILSFLKMKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords FERMITIN FAMILY HOMOLOG 1
publication title Structural and Functional Characterisation of the Kindlin-1 Pleckstrin Homology Domain
pubmed doi rcsb
source organism Mus musculus
molecule tags Cell adhesion
total genus 34
structure length 121
sequence length 128
ec nomenclature
pdb deposition date 2012-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4bbkA00
2COFA 5C16A 2CY4A 2YS5A 4HAUB 3KRXA 4MT7A 1WGUA 3NSUA 3U7DA 2LKOA 3O96A 1K5GB 4L6EA 3ZVRA 1XODA 2W2XC 3TCAA 2Q13A 5J3TA 5CLQB 3WA0A 2D9XA 1MAIA 1MPHA 1UPRA 1EF1A 4A5KA 2DX5A 1DBHA 1B55A 1WJMA 4ZRIA 2L2IA 2R09A 1J19A 5GOWB 2ADZA 1IRSA 3GYPA 1FOEA 3QIJA 3TO1A 1DDMA 1ZM0A 1MK7B 2COCA 1V5PA 3TW1A 5J3QA 2XQNM 4GMXB 4K81A 1M7EA 1WGQA 1U5EA 2GCLA 2DYNA 4GZUA 1W1HA 3ULBA 2CODA 1GC7A 1OY2A 2YT0A 5D3WA 2RSGA 1XX0A 1X1FA 1U29A 2P0FA 2HE7A 2GS0A 4HB4B 2VKIA 3CXBB 4K2PA 1NTYA 1X86A 1ZC4B 2DFKA 4GN1A 4CHJA 3DXDA 2L1CA 1Z87A 4GPTB 3OANA 4F7UP 4HDQA 2UZSA 1V5UA 3KZ1A 4KHBB 1OQNA 5JHGA 4DXAB 1V88A 4MY6A 2OQBA 2K2JA 2RVBB 2K2UA 2W2XD 1UNRA 4KVGB 1PLSA 4PQ0A 3N7CA 1UNQA 4CHMA 5HE2A 5CLLB 5J3YA 2ELAA 4GXBA 3GYOA 1UNPA 1XR0B 4TKNA 2Y7BA 4C0AA 5D27A 3UZTA 1K5DB 2D9YA 2GCJA 2IYBA 3SYXA 1FGZA 1W1DA 5DI9B 3TFMA 5D3XA 3HW2B 2J0MA 4K17A 3SV1A 2P0HA 2DA0A 2YS1A 5C6RA 2DKQA 2D4QA 2QKMA 1U27A 1NI2A 1V89A 3RCPA 4EKUA 3AU4A 4HAYB 3MPXA 5C5BA 2Y8FA 2AEHA 2D9ZA 1ZSQA 2Z0PA 2BCJA 2V76A 2Y8GA 3SO6A 2MWNB 4KAXB 5LONB 1AWEA 2MKRA 2YRYA 4A6HA 3SUZA 5DH9B 1FHOA 3PVUA 4P7IA 3SNHA 4Z2MB 4EMOA 3QBVB 1QQGA 4HB3B 2LOXA 1SGHA 3D8EA 2J0KA 2YF0A 2M38A 2HTHB 1J0WA 1EAZA 2YS3A 5LOPB 5JP4A 4F7HA 1MIXA 2EC1A 2J59M 1WG7A 1TJ6A 4HHVA 5D3VA 3BINA 4A6KA 2N0YA 2D10A 2KUPA 4HB2B 3A8PA 2COAA 2MFQA 1Y19B 3FM8C 2RGNB 1U2BA 3ODXA 3ZDTA 3HQCA 3LJUX 2UVMA 2I5FA 2P0DA 3BJIA 1DDWA 1XD4A 2N23A 2ROZB 4IOYX 1I7AA 1PFJA 3HK0A 2DHJA 1NU2A 1XCGA 3QWMA 5KCVA 2DTCA 1U5GA 1XKEA 1DDVA 3KSYA 4Z2NA 2X18A 3PVWA 2FJLA 2DN6A 2D9WA 1V5MA 1EVHA 3V5WA 4YL8A 3D8FA 1KZGA 2UZRA 1WJ1A 2NZ8B 3VIAA 1H4RA 3T06A 2ROVA 1TQZA 4PNKA 1LB1A 3DXEA 2DHIA 3CIKA 1TXDA 2EMSA 1U5FA 2MDXA 3WYFB 5HE3A 5FI1A 5KQ1A 4HAWB 3PEGA 1E5WA 3M1IB 5JLJB 1X11A 2I1JA 5C5BB 3A8QA 1SHCA 3F5RA 4WSFA 1LW3A 5DHFB 2JP2A 3X23A 4BBKA 4DX8A 2RLOA 4HAXB 3FEHA 5HE1A 1X05A 3KRWA 2CY5A 1DROA 1ZC3B 2J0JA 5KQ4A 2DHKA 1GC6A 4NY0A 1QC6A 2CAYA 2OTXA 3ODWA 1BTKA 3KY9A 1UPQA 2YVCA 4WJ7A 2EJ8A 5JHHA 2K00A 3PVLA 4K2OA 4MK0A 1ISNA 1X1GA 5DIFB 2H7EA 4WVFB 1FHWA 2CRFA 3P6AA 3G9WA 4EJNA 4HDOA 4ZRJA 2ELBA 5DHAB 5L81A 2RNRB 1OMWA 4IFSA 1NTVA 2LG1A 1MK9B 1FHXA 2LYDA 2D11A 2I5CA 1I2HA 2E2XA 1U5DA 2VRWB 4HATB 2Z0OA 1M7RA 1RJ2A 2EMTA 2G35A 1EGXA 2NMBA 4CYEA 2H7DA 2DLWA 2M14A 1MKEA 2KGXB 4KHAA 1PMSA 2QKLA 3FSSA 2YSZA 3D8DA 1FB8A 1Q67A 2GJYA 2DKPA 4H8SA 4D0NB 1ZVRA 2R0DA 5C79A 2P8VA 3PZDA 3TVVA 2LULA 5EFXA 1WI1A 3MDBC 1BAKA 2D9VA 3ODOA 4Y94A 2KCJA 4DX90 1P3RA 4B6HA 5FI0A 3PP2A 1WVHA 3VOQA 2RUKB 1KZ7A 3A98B 2ZPYA 4TYZA 5D3YA 4HAVB 1FAOA 1V61A 2YT1A 4A6FB 1DYNA 3AJ4A 3PSCA 3PG7A 4KHOA 1AQCA 1MIZB 3U8ZA 2DYQA 1RRPB 2DX1A 4NSWA 4XWXA 1P5TA 1Y5OA 3IVFA 4A6FA 4F7GA 1UEFA 2D2QA 2W2WA 3F0WA 1N3HA 4IAPA 4YONA 1GG3A 1KI1B 3P7ZA 4GMVA 5HE0A 3ULCA 2I1KA 4DBBA 4ZRKA 3DXCA 2VSZA 2PZ1A 3ML4A 4HAZB 2LOZA 3AU5A 2Z0QA 1BTNA 2IFSA 2AL6A 1H10A 1BWNA 1FGYA 4HB0B 1W1GA 1P6SA
chains in the Genus database with same CATH superfamily
2COFA 5C16A 2CY4A 2YS5A 4HAUB 3KRXA 4MT7A 1WGUA 3NSUA 3U7DA 2LKOA 3O96A 1K5GB 4L6EA 3ZVRA 1XODA 2W2XC 3TCAA 2Q13A 5J3TA 5CLQB 3WA0A 2D9XA 1MAIA 1MPHA 1UPRA 1EF1A 4A5KA 2DX5A 4CSQA 1DBHA 1B55A 1WJMA 4ZRIA 2L2IA 2R09A 1J19A 5GOWB 2ADZA 3NWAA 1IRSA 3GYPA 1FOEA 3QIJA 3TO1A 1DDMA 1ZM0A 1MK7B 2COCA 1V5PA 3TW1A 5J3QA 2XQNM 4GMXB 4K81A 4D6WA 1M7EA 1WGQA 1U5EA 2GCLA 2DYNA 4GZUA 1W1HA 3ULBA 2CODA 1GC7A 1OY2A 2YT0A 2K8EA 2RSGA 5D3WA 1XX0A 1X1FA 1U29A 2P0FA 2HE7A 2GS0A 4HB4B 2VKIA 3CXBB 4K2PA 1NTYA 1X86A 1ZC4B 2DFKA 4GN1A 4CHJA 3DXDA 2L1CA 2RRFA 1Z87A 4GPTB 3OANA 2K49A 3OHMB 4F7UP 4HDQA 2UZSA 1V5UA 3KZ1A 4KHBB 1OQNA 3HIEA 5JHGA 2Z14A 2NBVA 3NWDA 4DXAB 1V88A 4MY6A 2OQBA 2K2JA 2RVBB 2K2UA 2W2XD 1UNRA 4KVGB 1PLSA 4PQ0A 3N7CA 1UNQA 4CHMA 5M4YB 5HE2A 5CLLB 2ZKMX 5J3YA 2ELAA 4GXBA 1MI1A 4OT1A 3GYOA 1UNPA 1XR0B 4TKNA 5I2MA 2Y7BA 4C0AA 5D27A 3UZTA 1K5DB 2D9YA 2GCJA 2IYBA 3SYXA 1FGZA 1W1DA 5DI9B 3TFMA 5D3XA 3HW2B 2J0MA 4K17A 3SV1A 2P0HA 3NW8A 2DA0A 2YS1A 4QJ3B 2DKQA 5C6RA 2D4QA 2QKMA 1U27A 2KIGA 1NI2A 1V89A 3RCPA 4EKUA 3AU4A 4HAYB 3MPXA 5C5BA 2Y8FA 2AEHA 2D9ZA 4QJ4B 1ZSQA 2Z0PA 2BCJA 2V76A 2Y8GA 3A58A 3SO6A 2MWNB 4KAXB 5LONB 1AWEA 2MKRA 2YRYA 4A6HA 3SUZA 5DH9B 1FHOA 3PVUA 4P7IA 3SNHA 4Z2MB 4EMOA 3QBVB 4GOUA 1QQGA 4HB3B 2LOXA 1SGHA 3D8EA 2J0KA 2YF0A 2M38A 2HTHB 1J0WA 2FJUB 1EAZA 2YS3A 5LOPB 5JP4A 4F7HA 1MIXA 2EC1A 2J59M 1WG7A 1TJ6A 4HHVA 5D3VA 3BINA 4A6KA 2N0YA 2D10A 2KUPA 4HB2B 3A8PA 2COAA 2MFQA 1Y19B 3FM8C 2RGNB 1U2BA 3ODXA 3ZDTA 3HQCA 4HSIA 3LJUX 2UVMA 2I5FA 2P0DA 3BJIA 3FVCA 1DDWA 1XD4A 2N23A 2ROZB 4IOYX 1I7AA 1PFJA 3HK0A 2DHJA 1NU2A 1XCGA 3QWMA 5KCVA 2DTCA 1U5GA 1XKEA 3NWFA 1DDVA 3KSYA 4Z2NA 2X18A 3PVWA 2FJLA 2DN6A 2D9WA 1V5MA 1EVHA 3V5WA 4YL8A 3D8FA 1KZGA 2UZRA 1WJ1A 2NZ8B 3VIAA 1H4RA 3T06A 2ROVA 1TQZA 4PNKA 1LB1A 3DXEA 2DHIA 3CIKA 1TXDA 2EMSA 1T77A 1U5FA 2MDXA 3WYFB 5HE3A 5FI1A 5KQ1A 4HAWB 3PEGA 4OSNA 2Z59A 1E5WA 3M1IB 5JLJB 1X11A 2I1JA 5C5BB 3A8QA 1SHCA 2Z13A 3U12A 3F5RA 4WSFA 1LW3A 5DHFB 2JP2A 3X23A 3DCXA 4BBKA 4DX8A 2RLOA 4HAXB 3FEHA 5HE1A 1X05A 3KRWA 2CY5A 1DROA 1ZC3B 2J0JA 5KQ4A 2DHKA 4GNKB 3B77A 1GC6A 4NY0A 1QC6A 2CAYA 2OTXA 3ODWA 1BTKA 3KY9A 1UPQA 2YVCA 4WJ7A 2EJ8A 5JHHA 2K00A 3PVLA 4K2OA 4MK0A 1ISNA 1X1GA 1ZYIA 5DIFB 2H7EA 4WVFB 1FHWA 2CRFA 3P6AA 3G9WA 4EJNA 2KUQA 4HDOA 4ZRJA 2ELBA 5DHAB 5L81A 2RNRB 1OMWA 4IFSA 1NTVA 2LG1A 2R2YA 1MK9B 1FHXA 2LYDA 4QJ5B 2D11A 2I5CA 1I2HA 2E2XA 1U5DA 2VRWB 4HATB 2Z0OA 1M7RA 1RJ2A 2EMTA 2G35A 1EGXA 2NMBA 4CYEA 2H7DA 2DLWA 2M14A 1MKEA 2KGXB 4KHAA 1PMSA 2QKLA 3FSSA 2YSZA 3D8DA 4QXAB 1FB8A 1Q67A 2GJYA 2DKPA 4H8SA 4D0NB 1ZVRA 4L1RA 2GUMA 2R0DA 5C79A 2P8VA 3PZDA 3TVVA 2LULA 5EFXA 1WI1A 3MDBC 1BAKA 2KIEA 4DIXA 2D9VA 3ODOA 4Y94A 2KCJA 4DX90 1P3RA 4B6HA 5FI0A 3PP2A 4KHBA 5IRSA 1WVHA 3VOQA 2RUKB 1KZ7A 3A98B 2ZPYA 4TYZA 5D3YA 4HAVB 1FAOA 1V61A 2YT1A 4A6FB 1DYNA 5LG4B 3AJ4A 3PSCA 3PG7A 4KHOA 1AQCA 1MIZB 3U8ZA 2DYQA 1RRPB 2DX1A 4NSWA 4XWXA 1P5TA 1Y5OA 3HSAA 3IVFA 5I2SA 4A6FA 2Z4DA 4F7GA 1UEFA 2D2QA 2W2WA 3F0WA 1N3HA 4IAPA 2KR0A 4YONA 1GG3A 1KI1B 3P7ZA 4GMVA 5HE0A 2YT2A 2I1KA 3ULCA 4DBBA 4ZRKA 3DXCA 2VSZA 2PZ1A 3ML4A 4HAZB 2LOZA 3AU5A 2Z0QA 1BTNA 2IFSA 2AL6A 1H10A 1BWNA 1FGYA 4HB0B 1W1GA 1P6SA
chains in the Genus database with same CATH topology
2COFA 5C16A 2CY4A 2YS5A 4HAUB 3KRXA 4MT7A 1WGUA 3NSUA 3U7DA 2LKOA 3O96A 1K5GB 4L6EA 3ZVRA 1XODA 2W2XC 3TCAA 2Q13A 5J3TA 5CLQB 3WA0A 2D9XA 1MAIA 1MPHA 1UPRA 1EF1A 4A5KA 2DX5A 1DBHA 1B55A 1WJMA 4ZRIA 2L2IA 2R09A 1J19A 5GOWB 2ADZA 1IRSA 3GYPA 1FOEA 3QIJA 3TO1A 1DDMA 1ZM0A 1MK7B 2COCA 1V5PA 3TW1A 5J3QA 2XQNM 4GMXB 4K81A 1M7EA 1WGQA 1U5EA 2GCLA 2DYNA 4GZUA 1W1HA 3ULBA 2CODA 1GC7A 1OY2A 2YT0A 5D3WA 2RSGA 1XX0A 1X1FA 1U29A 2P0FA 2HE7A 2GS0A 4HB4B 2VKIA 3CXBB 4K2PA 1NTYA 1X86A 1ZC4B 2DFKA 4GN1A 4CHJA 3DXDA 2L1CA 1Z87A 4GPTB 3OANA 4F7UP 4HDQA 2UZSA 1V5UA 3KZ1A 4KHBB 1OQNA 5JHGA 4DXAB 1V88A 4MY6A 2OQBA 2K2JA 2RVBB 2K2UA 2W2XD 1UNRA 4KVGB 1PLSA 4PQ0A 3N7CA 1UNQA 4CHMA 5HE2A 5CLLB 5J3YA 2ELAA 4GXBA 3GYOA 1UNPA 1XR0B 4TKNA 2Y7BA 4C0AA 5D27A 3UZTA 1K5DB 2D9YA 2GCJA 2IYBA 3SYXA 1FGZA 1W1DA 5DI9B 3TFMA 5D3XA 3HW2B 2J0MA 4K17A 3SV1A 2P0HA 2DA0A 2YS1A 5C6RA 2DKQA 2D4QA 2QKMA 1U27A 1NI2A 1V89A 3RCPA 4EKUA 3AU4A 4HAYB 3MPXA 5C5BA 2Y8FA 2AEHA 2D9ZA 1ZSQA 2Z0PA 2BCJA 2V76A 2Y8GA 3SO6A 2MWNB 4KAXB 5LONB 1AWEA 2MKRA 2YRYA 4A6HA 3SUZA 5DH9B 1FHOA 3PVUA 4P7IA 3SNHA 4Z2MB 4EMOA 3QBVB 1QQGA 4HB3B 2LOXA 1SGHA 3D8EA 2J0KA 2YF0A 2M38A 2HTHB 1J0WA 1EAZA 2YS3A 5LOPB 5JP4A 4F7HA 1MIXA 2EC1A 2J59M 1WG7A 1TJ6A 4HHVA 5D3VA 3BINA 4A6KA 2N0YA 2D10A 2KUPA 4HB2B 3A8PA 2COAA 2MFQA 1Y19B 3FM8C 2RGNB 1U2BA 3ODXA 3ZDTA 3HQCA 3LJUX 2UVMA 2I5FA 2P0DA 3BJIA 1DDWA 1XD4A 2N23A 2ROZB 4IOYX 1I7AA 1PFJA 3HK0A 2DHJA 1NU2A 1XCGA 3QWMA 5KCVA 2DTCA 1U5GA 1XKEA 1DDVA 3KSYA 4Z2NA 2X18A 3PVWA 2FJLA 2DN6A 2D9WA 1V5MA 1EVHA 3V5WA 4YL8A 3D8FA 1KZGA 2UZRA 1WJ1A 2NZ8B 3VIAA 1H4RA 3T06A 2ROVA 1TQZA 4PNKA 1LB1A 3DXEA 2DHIA 3CIKA 1TXDA 2EMSA 1U5FA 2MDXA 3WYFB 5HE3A 5FI1A 5KQ1A 4HAWB 3PEGA 1E5WA 3M1IB 5JLJB 1X11A 2I1JA 5C5BB 3A8QA 1SHCA 3F5RA 4WSFA 1LW3A 5DHFB 2JP2A 3X23A 4BBKA 4DX8A 2RLOA 4HAXB 3FEHA 5HE1A 1X05A 3KRWA 2CY5A 1DROA 1ZC3B 2J0JA 5KQ4A 2DHKA 1GC6A 4NY0A 1QC6A 2CAYA 2OTXA 3ODWA 1BTKA 3KY9A 1UPQA 2YVCA 4WJ7A 2EJ8A 5JHHA 2K00A 3PVLA 4K2OA 4MK0A 1ISNA 1X1GA 5DIFB 2H7EA 4WVFB 1FHWA 2CRFA 3P6AA 3G9WA 4EJNA 4HDOA 4ZRJA 2ELBA 5DHAB 5L81A 2RNRB 1OMWA 4IFSA 1NTVA 2LG1A 1MK9B 1FHXA 2LYDA 2D11A 2I5CA 1I2HA 2E2XA 1U5DA 2VRWB 4HATB 2Z0OA 1M7RA 1RJ2A 2EMTA 2G35A 1EGXA 2NMBA 4CYEA 2H7DA 2DLWA 2M14A 1MKEA 2KGXB 4KHAA 1PMSA 2QKLA 3FSSA 2YSZA 3D8DA 1FB8A 1Q67A 2GJYA 2DKPA 4H8SA 4D0NB 1ZVRA 2R0DA 5C79A 2P8VA 3PZDA 3TVVA 2LULA 5EFXA 1WI1A 3MDBC 1BAKA 2D9VA 3ODOA 4Y94A 2KCJA 4DX90 1P3RA 4B6HA 5FI0A 3PP2A 1WVHA 3VOQA 2RUKB 1KZ7A 3A98B 2ZPYA 4TYZA 5D3YA 4HAVB 1FAOA 1V61A 2YT1A 4A6FB 1DYNA 3AJ4A 3PSCA 3PG7A 4KHOA 1AQCA 1MIZB 3U8ZA 2DYQA 1RRPB 2DX1A 4NSWA 4XWXA 1P5TA 1Y5OA 3IVFA 4A6FA 4F7GA 1UEFA 2D2QA 2W2WA 3F0WA 1N3HA 4IAPA 4YONA 1GG3A 1KI1B 3P7ZA 4GMVA 5HE0A 3ULCA 2I1KA 4DBBA 4ZRKA 3DXCA 2VSZA 2PZ1A 3ML4A 4HAZB 2LOZA 3AU5A 2Z0QA 1BTNA 2IFSA 2AL6A 1H10A 1BWNA 1FGYA 4HB0B 1W1GA 1P6SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2COF A;  5C16 A;  2CY4 A;  2YS5 A;  4HAU B;  3KRX A;  4MT7 A;  1WGU A;  3NSU A;  3U7D A;  2LKO A;  3O96 A;  1K5G B;  4L6E A;  3ZVR A;  1XOD A;  2W2X C;  3TCA A;  2Q13 A;  5J3T A;  5CLQ B;  3WA0 A;  2D9X A;  1MAI A;  1MPH A;  1UPR A;  1EF1 A;  4A5K A;  2DX5 A;  1DBH A;  1B55 A;  1WJM A;  4ZRI A;  2L2I A;  2R09 A;  1J19 A;  5GOW B;  2ADZ A;  1IRS A;  3GYP A;  1FOE A;  3QIJ A;  3TO1 A;  1DDM A;  1ZM0 A;  1MK7 B;  2COC A;  1V5P A;  3TW1 A;  5J3Q A;  2XQN M;  4GMX B;  4K81 A;  1M7E A;  1WGQ A;  1U5E A;  2GCL A;  2DYN A;  4GZU A;  1W1H A;  3ULB A;  2COD A;  1GC7 A;  1OY2 A;  2YT0 A;  5D3W A;  2RSG A;  1XX0 A;  1X1F A;  1U29 A;  2P0F A;  2HE7 A;  2GS0 A;  4HB4 B;  2VKI A;  3CXB B;  4K2P A;  1NTY A;  1X86 A;  1ZC4 B;  2DFK A;  4GN1 A;  4CHJ A;  3DXD A;  2L1C A;  1Z87 A;  4GPT B;  3OAN A;  4F7U P;  4HDQ A;  2UZS A;  1V5U A;  3KZ1 A;  4KHB B;  1OQN A;  5JHG A;  4DXA B;  1V88 A;  4MY6 A;  2OQB A;  2K2J A;  2RVB B;  2K2U A;  2W2X D;  1UNR A;  4KVG B;  1PLS A;  4PQ0 A;  3N7C A;  1UNQ A;  4CHM A;  5HE2 A;  5CLL B;  5J3Y A;  2ELA A;  4GXB A;  3GYO A;  1UNP A;  1XR0 B;  4TKN A;  2Y7B A;  4C0A A;  5D27 A;  3UZT A;  1K5D B;  2D9Y A;  2GCJ A;  2IYB A;  3SYX A;  1FGZ A;  1W1D A;  5DI9 B;  3TFM A;  5D3X A;  3HW2 B;  2J0M A;  4K17 A;  3SV1 A;  2P0H A;  2DA0 A;  2YS1 A;  5C6R A;  2DKQ A;  2D4Q A;  2QKM A;  1U27 A;  1NI2 A;  1V89 A;  3RCP A;  4EKU A;  3AU4 A;  4HAY B;  3MPX A;  5C5B A;  2Y8F A;  2AEH A;  2D9Z A;  1ZSQ A;  2Z0P A;  2BCJ A;  2V76 A;  2Y8G A;  3SO6 A;  2MWN B;  4KAX B;  5LON B;  1AWE A;  2MKR A;  2YRY A;  4A6H A;  3SUZ A;  5DH9 B;  1FHO A;  3PVU A;  4P7I A;  3SNH A;  4Z2M B;  4EMO A;  3QBV B;  1QQG A;  4HB3 B;  2LOX A;  1SGH A;  3D8E A;  2J0K A;  2YF0 A;  2M38 A;  2HTH B;  1J0W A;  1EAZ A;  2YS3 A;  5LOP B;  5JP4 A;  4F7H A;  1MIX A;  2EC1 A;  2J59 M;  1WG7 A;  1TJ6 A;  4HHV A;  5D3V A;  3BIN A;  4A6K A;  2N0Y A;  2D10 A;  2KUP A;  4HB2 B;  3A8P A;  2COA A;  2MFQ A;  1Y19 B;  3FM8 C;  2RGN B;  1U2B A;  3ODX A;  3ZDT A;  3HQC A;  3LJU X;  2UVM A;  2I5F A;  2P0D A;  3BJI A;  1DDW A;  1XD4 A;  2N23 A;  2ROZ B;  4IOY X;  1I7A A;  1PFJ A;  3HK0 A;  2DHJ A;  1NU2 A;  1XCG A;  3QWM A;  5KCV A;  2DTC A;  1U5G A;  1XKE A;  1DDV A;  3KSY A;  4Z2N A;  2X18 A;  3PVW A;  2FJL A;  2DN6 A;  2D9W A;  1V5M A;  1EVH A;  3V5W A;  4YL8 A;  3D8F A;  1KZG A;  2UZR A;  1WJ1 A;  2NZ8 B;  3VIA A;  1H4R A;  3T06 A;  2ROV A;  1TQZ A;  4PNK A;  1LB1 A;  3DXE A;  2DHI A;  3CIK A;  1TXD A;  2EMS A;  1U5F A;  2MDX A;  3WYF B;  5HE3 A;  5FI1 A;  5KQ1 A;  4HAW B;  3PEG A;  1E5W A;  3M1I B;  5JLJ B;  1X11 A;  2I1J A;  5C5B B;  3A8Q A;  1SHC A;  3F5R A;  4WSF A;  1LW3 A;  5DHF B;  2JP2 A;  3X23 A;  4BBK A;  4DX8 A;  2RLO A;  4HAX B;  3FEH A;  5HE1 A;  1X05 A;  3KRW A;  2CY5 A;  1DRO A;  1ZC3 B;  2J0J A;  5KQ4 A;  2DHK A;  1GC6 A;  4NY0 A;  1QC6 A;  2CAY A;  2OTX A;  3ODW A;  1BTK A;  3KY9 A;  1UPQ A;  2YVC A;  4WJ7 A;  2EJ8 A;  5JHH A;  2K00 A;  3PVL A;  4K2O A;  4MK0 A;  1ISN A;  1X1G A;  5DIF B;  2H7E A;  4WVF B;  1FHW A;  2CRF A;  3P6A A;  3G9W A;  4EJN A;  4HDO A;  4ZRJ A;  2ELB A;  5DHA B;  5L81 A;  2RNR B;  1OMW A;  4IFS A;  1NTV A;  2LG1 A;  1MK9 B;  1FHX A;  2LYD A;  2D11 A;  2I5C A;  1I2H A;  2E2X A;  1U5D A;  2VRW B;  4HAT B;  2Z0O A;  1M7R A;  1RJ2 A;  2EMT A;  2G35 A;  1EGX A;  2NMB A;  4CYE A;  2H7D A;  2DLW A;  2M14 A;  1MKE A;  2KGX B;  4KHA A;  1PMS A;  2QKL A;  3FSS A;  2YSZ A;  3D8D A;  1FB8 A;  1Q67 A;  2GJY A;  2DKP A;  4H8S A;  4D0N B;  1ZVR A;  2R0D A;  5C79 A;  2P8V A;  3PZD A;  3TVV A;  2LUL A;  5EFX A;  1WI1 A;  3MDB C;  1BAK A;  2D9V A;  3ODO A;  4Y94 A;  2KCJ A;  4DX9 0;  1P3R A;  4B6H A;  5FI0 A;  3PP2 A;  1WVH A;  3VOQ A;  2RUK B;  1KZ7 A;  3A98 B;  2ZPY A;  4TYZ A;  5D3Y A;  4HAV B;  1FAO A;  1V61 A;  2YT1 A;  4A6F B;  1DYN A;  3AJ4 A;  3PSC A;  3PG7 A;  4KHO A;  1AQC A;  1MIZ B;  3U8Z A;  2DYQ A;  1RRP B;  2DX1 A;  4NSW A;  4XWX A;  1P5T A;  1Y5O A;  3IVF A;  4A6F A;  4F7G A;  1UEF A;  2D2Q A;  2W2W A;  3F0W A;  1N3H A;  4IAP A;  4YON A;  1GG3 A;  1KI1 B;  3P7Z A;  4GMV A;  5HE0 A;  3ULC A;  2I1K A;  4DBB A;  4ZRK A;  3DXC A;  2VSZ A;  2PZ1 A;  3ML4 A;  4HAZ B;  2LOZ A;  3AU5 A;  2Z0Q A;  1BTN A;  2IFS A;  2AL6 A;  1H10 A;  1BWN A;  1FGY A;  4HB0 B;  1W1G A;  1P6S A; 
#chains in the Genus database with same CATH topology
 2COF A;  5C16 A;  2CY4 A;  2YS5 A;  4HAU B;  3KRX A;  4MT7 A;  1WGU A;  3NSU A;  3U7D A;  2LKO A;  3O96 A;  1K5G B;  4L6E A;  3ZVR A;  1XOD A;  2W2X C;  3TCA A;  2Q13 A;  5J3T A;  5CLQ B;  3WA0 A;  2D9X A;  1MAI A;  1MPH A;  1UPR A;  1EF1 A;  4A5K A;  2DX5 A;  4CSQ A;  1DBH A;  1B55 A;  1WJM A;  4ZRI A;  2L2I A;  2R09 A;  1J19 A;  5GOW B;  2ADZ A;  3NWA A;  1IRS A;  3GYP A;  1FOE A;  3QIJ A;  3TO1 A;  1DDM A;  1ZM0 A;  1MK7 B;  2COC A;  1V5P A;  3TW1 A;  5J3Q A;  2XQN M;  4GMX B;  4K81 A;  4D6W A;  1M7E A;  1WGQ A;  1U5E A;  2GCL A;  2DYN A;  4GZU A;  1W1H A;  3ULB A;  2COD A;  1GC7 A;  1OY2 A;  2YT0 A;  2K8E A;  2RSG A;  5D3W A;  1XX0 A;  1X1F A;  1U29 A;  2P0F A;  2HE7 A;  2GS0 A;  4HB4 B;  2VKI A;  3CXB B;  4K2P A;  1NTY A;  1X86 A;  1ZC4 B;  2DFK A;  4GN1 A;  4CHJ A;  3DXD A;  2L1C A;  2RRF A;  1Z87 A;  4GPT B;  3OAN A;  2K49 A;  3OHM B;  4F7U P;  4HDQ A;  2UZS A;  1V5U A;  3KZ1 A;  4KHB B;  1OQN A;  3HIE A;  5JHG A;  2Z14 A;  2NBV A;  3NWD A;  4DXA B;  1V88 A;  4MY6 A;  2OQB A;  2K2J A;  2RVB B;  2K2U A;  2W2X D;  1UNR A;  4KVG B;  1PLS A;  4PQ0 A;  3N7C A;  1UNQ A;  4CHM A;  5M4Y B;  5HE2 A;  5CLL B;  2ZKM X;  5J3Y A;  2ELA A;  4GXB A;  1MI1 A;  4OT1 A;  3GYO A;  1UNP A;  1XR0 B;  4TKN A;  5I2M A;  2Y7B A;  4C0A A;  5D27 A;  3UZT A;  1K5D B;  2D9Y A;  2GCJ A;  2IYB A;  3SYX A;  1FGZ A;  1W1D A;  5DI9 B;  3TFM A;  5D3X A;  3HW2 B;  2J0M A;  4K17 A;  3SV1 A;  2P0H A;  3NW8 A;  2DA0 A;  2YS1 A;  4QJ3 B;  2DKQ A;  5C6R A;  2D4Q A;  2QKM A;  1U27 A;  2KIG A;  1NI2 A;  1V89 A;  3RCP A;  4EKU A;  3AU4 A;  4HAY B;  3MPX A;  5C5B A;  2Y8F A;  2AEH A;  2D9Z A;  4QJ4 B;  1ZSQ A;  2Z0P A;  2BCJ A;  2V76 A;  2Y8G A;  3A58 A;  3SO6 A;  2MWN B;  4KAX B;  5LON B;  1AWE A;  2MKR A;  2YRY A;  4A6H A;  3SUZ A;  5DH9 B;  1FHO A;  3PVU A;  4P7I A;  3SNH A;  4Z2M B;  4EMO A;  3QBV B;  4GOU A;  1QQG A;  4HB3 B;  2LOX A;  1SGH A;  3D8E A;  2J0K A;  2YF0 A;  2M38 A;  2HTH B;  1J0W A;  2FJU B;  1EAZ A;  2YS3 A;  5LOP B;  5JP4 A;  4F7H A;  1MIX A;  2EC1 A;  2J59 M;  1WG7 A;  1TJ6 A;  4HHV A;  5D3V A;  3BIN A;  4A6K A;  2N0Y A;  2D10 A;  2KUP A;  4HB2 B;  3A8P A;  2COA A;  2MFQ A;  1Y19 B;  3FM8 C;  2RGN B;  1U2B A;  3ODX A;  3ZDT A;  3HQC A;  4HSI A;  3LJU X;  2UVM A;  2I5F A;  2P0D A;  3BJI A;  3FVC A;  1DDW A;  1XD4 A;  2N23 A;  2ROZ B;  4IOY X;  1I7A A;  1PFJ A;  3HK0 A;  2DHJ A;  1NU2 A;  1XCG A;  3QWM A;  5KCV A;  2DTC A;  1U5G A;  1XKE A;  3NWF A;  1DDV A;  3KSY A;  4Z2N A;  2X18 A;  3PVW A;  2FJL A;  2DN6 A;  2D9W A;  1V5M A;  1EVH A;  3V5W A;  4YL8 A;  3D8F A;  1KZG A;  2UZR A;  1WJ1 A;  2NZ8 B;  3VIA A;  1H4R A;  3T06 A;  2ROV A;  1TQZ A;  4PNK A;  1LB1 A;  3DXE A;  2DHI A;  3CIK A;  1TXD A;  2EMS A;  1T77 A;  1U5F A;  2MDX A;  3WYF B;  5HE3 A;  5FI1 A;  5KQ1 A;  4HAW B;  3PEG A;  4OSN A;  2Z59 A;  1E5W A;  3M1I B;  5JLJ B;  1X11 A;  2I1J A;  5C5B B;  3A8Q A;  1SHC A;  2Z13 A;  3U12 A;  3F5R A;  4WSF A;  1LW3 A;  5DHF B;  2JP2 A;  3X23 A;  3DCX A;  4BBK A;  4DX8 A;  2RLO A;  4HAX B;  3FEH A;  5HE1 A;  1X05 A;  3KRW A;  2CY5 A;  1DRO A;  1ZC3 B;  2J0J A;  5KQ4 A;  2DHK A;  4GNK B;  3B77 A;  1GC6 A;  4NY0 A;  1QC6 A;  2CAY A;  2OTX A;  3ODW A;  1BTK A;  3KY9 A;  1UPQ A;  2YVC A;  4WJ7 A;  2EJ8 A;  5JHH A;  2K00 A;  3PVL A;  4K2O A;  4MK0 A;  1ISN A;  1X1G A;  1ZYI A;  5DIF B;  2H7E A;  4WVF B;  1FHW A;  2CRF A;  3P6A A;  3G9W A;  4EJN A;  2KUQ A;  4HDO A;  4ZRJ A;  2ELB A;  5DHA B;  5L81 A;  2RNR B;  1OMW A;  4IFS A;  1NTV A;  2LG1 A;  2R2Y A;  1MK9 B;  1FHX A;  2LYD A;  4QJ5 B;  2D11 A;  2I5C A;  1I2H A;  2E2X A;  1U5D A;  2VRW B;  4HAT B;  2Z0O A;  1M7R A;  1RJ2 A;  2EMT A;  2G35 A;  1EGX A;  2NMB A;  4CYE A;  2H7D A;  2DLW A;  2M14 A;  1MKE A;  2KGX B;  4KHA A;  1PMS A;  2QKL A;  3FSS A;  2YSZ A;  3D8D A;  4QXA B;  1FB8 A;  1Q67 A;  2GJY A;  2DKP A;  4H8S A;  4D0N B;  1ZVR A;  4L1R A;  2GUM A;  2R0D A;  5C79 A;  2P8V A;  3PZD A;  3TVV A;  2LUL A;  5EFX A;  1WI1 A;  3MDB C;  1BAK A;  2KIE A;  4DIX A;  2D9V A;  3ODO A;  4Y94 A;  2KCJ A;  4DX9 0;  1P3R A;  4B6H A;  5FI0 A;  3PP2 A;  4KHB A;  5IRS A;  1WVH A;  3VOQ A;  2RUK B;  1KZ7 A;  3A98 B;  2ZPY A;  4TYZ A;  5D3Y A;  4HAV B;  1FAO A;  1V61 A;  2YT1 A;  4A6F B;  1DYN A;  5LG4 B;  3AJ4 A;  3PSC A;  3PG7 A;  4KHO A;  1AQC A;  1MIZ B;  3U8Z A;  2DYQ A;  1RRP B;  2DX1 A;  4NSW A;  4XWX A;  1P5T A;  1Y5O A;  3HSA A;  3IVF A;  5I2S A;  4A6F A;  2Z4D A;  4F7G A;  1UEF A;  2D2Q A;  2W2W A;  3F0W A;  1N3H A;  4IAP A;  2KR0 A;  4YON A;  1GG3 A;  1KI1 B;  3P7Z A;  4GMV A;  5HE0 A;  2YT2 A;  2I1K A;  3ULC A;  4DBB A;  4ZRK A;  3DXC A;  2VSZ A;  2PZ1 A;  3ML4 A;  4HAZ B;  2LOZ A;  3AU5 A;  2Z0Q A;  1BTN A;  2IFS A;  2AL6 A;  1H10 A;  1BWN A;  1FGY A;  4HB0 B;  1W1G A;  1P6S A; 
#chains in the Genus database with same CATH homology
 2COF A;  5C16 A;  2CY4 A;  2YS5 A;  4HAU B;  3KRX A;  4MT7 A;  1WGU A;  3NSU A;  3U7D A;  2LKO A;  3O96 A;  1K5G B;  4L6E A;  3ZVR A;  1XOD A;  2W2X C;  3TCA A;  2Q13 A;  5J3T A;  5CLQ B;  3WA0 A;  2D9X A;  1MAI A;  1MPH A;  1UPR A;  1EF1 A;  4A5K A;  2DX5 A;  1DBH A;  1B55 A;  1WJM A;  4ZRI A;  2L2I A;  2R09 A;  1J19 A;  5GOW B;  2ADZ A;  1IRS A;  3GYP A;  1FOE A;  3QIJ A;  3TO1 A;  1DDM A;  1ZM0 A;  1MK7 B;  2COC A;  1V5P A;  3TW1 A;  5J3Q A;  2XQN M;  4GMX B;  4K81 A;  1M7E A;  1WGQ A;  1U5E A;  2GCL A;  2DYN A;  4GZU A;  1W1H A;  3ULB A;  2COD A;  1GC7 A;  1OY2 A;  2YT0 A;  5D3W A;  2RSG A;  1XX0 A;  1X1F A;  1U29 A;  2P0F A;  2HE7 A;  2GS0 A;  4HB4 B;  2VKI A;  3CXB B;  4K2P A;  1NTY A;  1X86 A;  1ZC4 B;  2DFK A;  4GN1 A;  4CHJ A;  3DXD A;  2L1C A;  1Z87 A;  4GPT B;  3OAN A;  4F7U P;  4HDQ A;  2UZS A;  1V5U A;  3KZ1 A;  4KHB B;  1OQN A;  5JHG A;  4DXA B;  1V88 A;  4MY6 A;  2OQB A;  2K2J A;  2RVB B;  2K2U A;  2W2X D;  1UNR A;  4KVG B;  1PLS A;  4PQ0 A;  3N7C A;  1UNQ A;  4CHM A;  5HE2 A;  5CLL B;  5J3Y A;  2ELA A;  4GXB A;  3GYO A;  1UNP A;  1XR0 B;  4TKN A;  2Y7B A;  4C0A A;  5D27 A;  3UZT A;  1K5D B;  2D9Y A;  2GCJ A;  2IYB A;  3SYX A;  1FGZ A;  1W1D A;  5DI9 B;  3TFM A;  5D3X A;  3HW2 B;  2J0M A;  4K17 A;  3SV1 A;  2P0H A;  2DA0 A;  2YS1 A;  5C6R A;  2DKQ A;  2D4Q A;  2QKM A;  1U27 A;  1NI2 A;  1V89 A;  3RCP A;  4EKU A;  3AU4 A;  4HAY B;  3MPX A;  5C5B A;  2Y8F A;  2AEH A;  2D9Z A;  1ZSQ A;  2Z0P A;  2BCJ A;  2V76 A;  2Y8G A;  3SO6 A;  2MWN B;  4KAX B;  5LON B;  1AWE A;  2MKR A;  2YRY A;  4A6H A;  3SUZ A;  5DH9 B;  1FHO A;  3PVU A;  4P7I A;  3SNH A;  4Z2M B;  4EMO A;  3QBV B;  1QQG A;  4HB3 B;  2LOX A;  1SGH A;  3D8E A;  2J0K A;  2YF0 A;  2M38 A;  2HTH B;  1J0W A;  1EAZ A;  2YS3 A;  5LOP B;  5JP4 A;  4F7H A;  1MIX A;  2EC1 A;  2J59 M;  1WG7 A;  1TJ6 A;  4HHV A;  5D3V A;  3BIN A;  4A6K A;  2N0Y A;  2D10 A;  2KUP A;  4HB2 B;  3A8P A;  2COA A;  2MFQ A;  1Y19 B;  3FM8 C;  2RGN B;  1U2B A;  3ODX A;  3ZDT A;  3HQC A;  3LJU X;  2UVM A;  2I5F A;  2P0D A;  3BJI A;  1DDW A;  1XD4 A;  2N23 A;  2ROZ B;  4IOY X;  1I7A A;  1PFJ A;  3HK0 A;  2DHJ A;  1NU2 A;  1XCG A;  3QWM A;  5KCV A;  2DTC A;  1U5G A;  1XKE A;  1DDV A;  3KSY A;  4Z2N A;  2X18 A;  3PVW A;  2FJL A;  2DN6 A;  2D9W A;  1V5M A;  1EVH A;  3V5W A;  4YL8 A;  3D8F A;  1KZG A;  2UZR A;  1WJ1 A;  2NZ8 B;  3VIA A;  1H4R A;  3T06 A;  2ROV A;  1TQZ A;  4PNK A;  1LB1 A;  3DXE A;  2DHI A;  3CIK A;  1TXD A;  2EMS A;  1U5F A;  2MDX A;  3WYF B;  5HE3 A;  5FI1 A;  5KQ1 A;  4HAW B;  3PEG A;  1E5W A;  3M1I B;  5JLJ B;  1X11 A;  2I1J A;  5C5B B;  3A8Q A;  1SHC A;  3F5R A;  4WSF A;  1LW3 A;  5DHF B;  2JP2 A;  3X23 A;  4BBK A;  4DX8 A;  2RLO A;  4HAX B;  3FEH A;  5HE1 A;  1X05 A;  3KRW A;  2CY5 A;  1DRO A;  1ZC3 B;  2J0J A;  5KQ4 A;  2DHK A;  1GC6 A;  4NY0 A;  1QC6 A;  2CAY A;  2OTX A;  3ODW A;  1BTK A;  3KY9 A;  1UPQ A;  2YVC A;  4WJ7 A;  2EJ8 A;  5JHH A;  2K00 A;  3PVL A;  4K2O A;  4MK0 A;  1ISN A;  1X1G A;  5DIF B;  2H7E A;  4WVF B;  1FHW A;  2CRF A;  3P6A A;  3G9W A;  4EJN A;  4HDO A;  4ZRJ A;  2ELB A;  5DHA B;  5L81 A;  2RNR B;  1OMW A;  4IFS A;  1NTV A;  2LG1 A;  1MK9 B;  1FHX A;  2LYD A;  2D11 A;  2I5C A;  1I2H A;  2E2X A;  1U5D A;  2VRW B;  4HAT B;  2Z0O A;  1M7R A;  1RJ2 A;  2EMT A;  2G35 A;  1EGX A;  2NMB A;  4CYE A;  2H7D A;  2DLW A;  2M14 A;  1MKE A;  2KGX B;  4KHA A;  1PMS A;  2QKL A;  3FSS A;  2YSZ A;  3D8D A;  1FB8 A;  1Q67 A;  2GJY A;  2DKP A;  4H8S A;  4D0N B;  1ZVR A;  2R0D A;  5C79 A;  2P8V A;  3PZD A;  3TVV A;  2LUL A;  5EFX A;  1WI1 A;  3MDB C;  1BAK A;  2D9V A;  3ODO A;  4Y94 A;  2KCJ A;  4DX9 0;  1P3R A;  4B6H A;  5FI0 A;  3PP2 A;  1WVH A;  3VOQ A;  2RUK B;  1KZ7 A;  3A98 B;  2ZPY A;  4TYZ A;  5D3Y A;  4HAV B;  1FAO A;  1V61 A;  2YT1 A;  4A6F B;  1DYN A;  3AJ4 A;  3PSC A;  3PG7 A;  4KHO A;  1AQC A;  1MIZ B;  3U8Z A;  2DYQ A;  1RRP B;  2DX1 A;  4NSW A;  4XWX A;  1P5T A;  1Y5O A;  3IVF A;  4A6F A;  4F7G A;  1UEF A;  2D2Q A;  2W2W A;  3F0W A;  1N3H A;  4IAP A;  4YON A;  1GG3 A;  1KI1 B;  3P7Z A;  4GMV A;  5HE0 A;  3ULC A;  2I1K A;  4DBB A;  4ZRK A;  3DXC A;  2VSZ A;  2PZ1 A;  3ML4 A;  4HAZ B;  2LOZ A;  3AU5 A;  2Z0Q A;  1BTN A;  2IFS A;  2AL6 A;  1H10 A;  1BWN A;  1FGY A;  4HB0 B;  1W1G A;  1P6S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...