4BBKA

Structural and functional characterisation of the kindlin-1 pleckstrin homology domain
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
128
structure length
121
Chain Sequence
PKLADYLKLFRACKQYWFVFKDTSIAYFKNKELEQGEPIEKLNLRGCEIVPDVNVSGRKFGIKLLIPVADGMNEVYLRCDHEDQYARWMAACILASKGKTMADSSYQPEVISILSFLKMKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Cell adhesion
molecule keywords FERMITIN FAMILY HOMOLOG 1
publication title Structural and Functional Characterisation of the Kindlin-1 Pleckstrin Homology Domain
pubmed doi rcsb
source organism Mus musculus
total genus 34
structure length 121
sequence length 128
ec nomenclature
pdb deposition date 2012-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4bbkA00
1MK9B 5DHFB 3HW2B 4GPTB 1NTVA 5C16A 1RRPB 1DDVA 2VSZA 4D0NB 2YF0A 3FEHA 1U29A 2DHKA 4H8SA 1EAZA 1UNPA 1E5WA 1KZ7A 4K81A 5C79A 2YT1A 3N7CA 2D10A 2UVMA 1KZGA 1OQNA 1I2HA 2I5FA 4IAPA 5C5BB 2MWNB 2DLWA 1I7AA 1NTYA 1WG7A 2CODA 2X18A 4Z2NA 3DXCA 1BTKA 2D9YA 4A6FB 1PFJA 1TJ6A 2GJYA 2I1KA 3AU4A 2VKIA 1WJMA 3SNHA 4TKNA 3TW1A 3G9WA 3CXBB 2J59M 2CRFA 5D3VA 1H10A 4ZRKA 2RSGA 2XQNM 3KY9A 1U27A 3RCPA 3CIKA 5JHGA 4ZRJA 5HE0A 2YS1A 2D9XA 1DBHA 3SUZA 1FHWA 2DN6A 2PZ1A 3SYXA 2FJLA 2UZRA 1Z87A 2W2XD 2Z0OA 1KI1B 2LOZA 2RNRB 2LYDA 1Y5OA 4CYEA 2DHJA 2HE7A 4KAXB 1SGHA 2COAA 3OANA 1XX0A 1MPHA 5HE1A 3A8QA 4B6HA 1X11A 1XODA 2D11A 3GYOA 3ODWA 5J3QA 3VIAA 5KCVA 3DXDA 1PLSA 1AQCA 1BWNA 3X23A 2Z0PA 5J3YA 1OY2A 1UNQA 4DBBA 3HQCA 2Y8FA 5FI0A 4F7UP 2UZSA 1J0WA 2K2UA 5C6RA 2JP2A 1V5MA 2HTHB 4YONA 2IFSA 4CHJA 2EMTA 2P0FA 1MAIA 4K17A 2K00A 2QKMA 4GN1A 1MIXA 2AEHA 5EFXA 4HAWB 2CY4A 5JP4A 2LOXA 3LJUX 2COCA 2CY5A 5LONB 2DYNA 1ISNA 1GC7A 3M1IB 3WYFB 1UPQA 4WJ7A 5JLJB 4Y94A 3QWMA 4IFSA 2ADZA 1EGXA 2LKOA 4EKUA 1FHXA 3D8DA 4F7HA 4TYZA 3V5WA 2I1JA 4NSWA 2GCLA 3ZDTA 3KSYA 4GMXB 3MPXA 1W1GA 5C5BA 2YT0A 3U8ZA 2H7EA 2OTXA 3ML4A 1FGYA 3A98B 3ULBA 3KRWA 2YRYA 4A6FA 1MK7B 4L6EA 1DROA 2DFKA 2Q13A 1GC6A 2J0MA 3PG7A 1K5DB 4K2OA 1UPRA 2DA0A 3D8FA 1PMSA 1P5TA 3TFMA 4HAUB 2MKRA 1IRSA 1FB8A 1U5EA 1QQGA 4PNKA 2E2XA 1QC6A 1OMWA 3PVWA 1Q67A 2ELBA 1V61A 2J0KA 1MKEA 3FM8C 3PSCA 1GG3A 4MK0A 1U5DA 1W1DA 3DXEA 4DXAB 1BAKA 5KQ4A 2YVCA 4HDQA 2KCJA 1P6SA 5D3YA 2M38A 5DI9B 1N3HA 5DH9B 1WVHA 4HAZB 1XR0B 1ZC4B 2VRWB 2MDXA 2Y7BA 1X05A 4BBKA 3SO6A 1LW3A 2EC1A 2BCJA 2RGNB 3QBVB 2DHIA 1UNRA 4F7GA 2EMSA 2GS0A 1P3RA 4MT7A 1V5UA 4A6KA 5DHAB 1DDWA 2DKQA 2P8VA 3P6AA 2R09A 2V76A 1V88A 2GCJA 2D9VA 5D3WA 2P0DA 2QKLA 3F0WA 3F5RA 2NZ8B 1WGQA 1SHCA 4HDOA 1FGZA 4HATB 5LOPB 3HK0A 1DDMA 3BINA 3PZDA 1WGUA 2W2XC 2DTCA 3KRXA 3BJIA 4KHOA 1XD4A 2EJ8A 4CHMA 1WJ1A 3T06A 3TCAA 2I5CA 1XKEA 2RVBB 1U5FA 3KZ1A 1BTNA 2NMBA 2RLOA 1FOEA 3QIJA 2RUKB 3ULCA 3AJ4A 1K5GB 4WSFA 2Y8GA 2K2JA 2DX5A 1M7EA 4HHVA 3P7ZA 3MDBC 3PVLA 2D2QA 4A5KA 4EMOA 1J19A 2ROVA 1XCGA 4HB0B 2LG1A 1U2BA 2H7DA 1AWEA 2J0JA 3AU5A 3PEGA 4NY0A 4ZRIA 1DYNA 1ZM0A 4HAXB 2YS3A 5CLLB 2YSZA 1X1GA 3SV1A 1EVHA 2D9ZA 5KQ1A 2DX1A 3U7DA 2KUPA 1ZC3B 4WVFB 2CAYA 1B55A 2DKPA 2ROZB 5HE3A 2AL6A 1ZSQA 2M14A 1FHOA 1Y19B 4K2PA 4C0AA 4DX90 3ODOA 2DYQA 4IOYX 1UEFA 1V5PA 4HAYB 1EF1A 3O96A 1MIZB 4KHAA 4PQ0A 3PVUA 3NSUA 2N0YA 1V89A 3VOQA 2Z0QA 1TXDA 4GMVA 4A6HA 5JHHA 2ZPYA 3WA0A 2W2WA 3FSSA 5DIFB 3GYPA 2P0HA 2D9WA 3ODXA 4HB3B 4EJNA 4KHBB 4YL8A 2L2IA 4HB2B 1M7RA 1TQZA 5HE2A 1X86A 2IYBA 4KVGB 5FI1A 5D27A 5D3XA 4GXBA 2LULA 1WI1A 2OQBA 1W1HA 3TVVA 1U5GA 1H4RA 3UZTA 2MFQA 2L1CA 3D8EA 4HB4B 4HAVB 2N23A 5J3TA 2G35A 1LB1A 4DX8A 2D4QA 2YS5A 4GZUA 4Z2MB 2COFA 3ZVRA 5GOWB 3A8PA 5L81A 2KGXB 3IVFA 3PP2A 4MY6A 1NI2A 3TO1A 2R0DA 1FAOA 1NU2A 2ELAA 1X1FA 4XWXA 1ZVRA 1RJ2A 4P7IA 5CLQB
chains in the Genus database with same CATH superfamily
1MK9B 5DHFB 2KR0A 1ZYIA 3HW2B 4GPTB 1NTVA 5C16A 1RRPB 1DDVA 2VSZA 4D0NB 2YF0A 3FEHA 1U29A 2DHKA 4H8SA 1EAZA 1UNPA 1E5WA 1KZ7A 4K81A 4QXAB 5C79A 2YT1A 3N7CA 2D10A 2UVMA 1KZGA 2R2YA 1OQNA 1I2HA 2I5FA 4IAPA 5IRSA 5C5BB 2MWNB 2DLWA 2Z59A 1I7AA 1NTYA 1WG7A 2CODA 2X18A 4Z2NA 3DXCA 1BTKA 2D9YA 4A6FB 1PFJA 1TJ6A 2GJYA 2I1KA 3AU4A 2VKIA 1WJMA 3SNHA 4TKNA 3TW1A 3G9WA 3CXBB 2J59M 2CRFA 5D3VA 1H10A 4ZRKA 2RSGA 2XQNM 3KY9A 1U27A 3RCPA 3CIKA 5JHGA 4ZRJA 5HE0A 2YS1A 2D9XA 1DBHA 3SUZA 1FHWA 2DN6A 2PZ1A 3SYXA 2FJLA 2UZRA 1Z87A 2W2XD 2Z0OA 1KI1B 2LOZA 2RNRB 2LYDA 3A58A 1Y5OA 4CYEA 2DHJA 2HE7A 4KHBA 4KAXB 1SGHA 2COAA 3OANA 4GNKB 5M4YB 1XX0A 2Z14A 1MPHA 5HE1A 3A8QA 4B6HA 1X11A 1XODA 2D11A 3GYOA 3ODWA 2NBVA 5J3QA 3VIAA 5KCVA 3DXDA 1PLSA 1AQCA 1BWNA 3FVCA 3X23A 3HSAA 2Z0PA 5J3YA 1OY2A 1UNQA 4DBBA 3HQCA 2Y8FA 5FI0A 4F7UP 2UZSA 3NWAA 1J0WA 2K2UA 2Z13A 5C6RA 2JP2A 1V5MA 2HTHB 4YONA 2IFSA 4CHJA 2EMTA 2P0FA 4OT1A 1MAIA 4K17A 2K00A 2QKMA 4GN1A 2GUMA 1MIXA 2AEHA 5EFXA 4HAWB 2CY4A 5JP4A 2LOXA 3LJUX 2COCA 2CY5A 5LONB 2DYNA 1ISNA 1GC7A 3M1IB 3WYFB 1UPQA 4WJ7A 5JLJB 4Y94A 3QWMA 4IFSA 2ADZA 1EGXA 2LKOA 4EKUA 1FHXA 3D8DA 1MI1A 3NWFA 4F7HA 4TYZA 3V5WA 2I1JA 4NSWA 2GCLA 3ZDTA 3KSYA 4GMXB 2Z4DA 3MPXA 1W1GA 5C5BA 2YT0A 3U8ZA 2H7EA 2OTXA 3ML4A 1FGYA 3A98B 3ULBA 3KRWA 2YRYA 4A6FA 1MK7B 4L6EA 1DROA 2DFKA 2Q13A 1GC6A 2J0MA 3PG7A 1K5DB 4K2OA 1T77A 1UPRA 4GOUA 2DA0A 3D8FA 1PMSA 1P5TA 3TFMA 3OHMB 4HAUB 5I2SA 2MKRA 1IRSA 1FB8A 1U5EA 1QQGA 4PNKA 2E2XA 1QC6A 3B77A 1OMWA 3PVWA 1Q67A 2ELBA 1V61A 2J0KA 1MKEA 3FM8C 3PSCA 1GG3A 4MK0A 1U5DA 1W1DA 3DXEA 4DXAB 1BAKA 4HSIA 5KQ4A 4CSQA 2YVCA 4HDQA 3NWDA 2KCJA 1P6SA 5D3YA 2M38A 5DI9B 1N3HA 5DH9B 1WVHA 4HAZB 1XR0B 4D6WA 1ZC4B 2VRWB 2MDXA 2Y7BA 1X05A 4BBKA 3SO6A 1LW3A 2FJUB 2EC1A 2BCJA 2RGNB 3QBVB 2DHIA 1UNRA 5LG4B 4F7GA 2EMSA 2GS0A 3U12A 1P3RA 4MT7A 1V5UA 4A6KA 5DHAB 1DDWA 2ZKMX 2DKQA 2P8VA 3P6AA 2R09A 2V76A 1V88A 2GCJA 2D9VA 5D3WA 2P0DA 2QKLA 3HIEA 3F0WA 3F5RA 2NZ8B 1WGQA 1SHCA 4HDOA 1FGZA 4HATB 5LOPB 3HK0A 1DDMA 3BINA 3PZDA 1WGUA 2W2XC 2DTCA 3KRXA 3BJIA 4KHOA 1XD4A 2EJ8A 4CHMA 2KIGA 1WJ1A 3T06A 3TCAA 2I5CA 1XKEA 2RVBB 1U5FA 3KZ1A 1BTNA 2NMBA 2RLOA 1FOEA 3QIJA 2RUKB 3ULCA 3AJ4A 1K5GB 4WSFA 2Y8GA 2K2JA 2DX5A 1M7EA 4HHVA 3P7ZA 3MDBC 3PVLA 2D2QA 4A5KA 4EMOA 1J19A 2ROVA 1XCGA 4HB0B 2LG1A 1U2BA 2K49A 2H7DA 1AWEA 2J0JA 3AU5A 3PEGA 4NY0A 4ZRIA 1DYNA 1ZM0A 4HAXB 2YS3A 5CLLB 2YSZA 1X1GA 3SV1A 1EVHA 2D9ZA 5KQ1A 2DX1A 3U7DA 2KUPA 1ZC3B 4WVFB 2CAYA 1B55A 2DKPA 2ROZB 5HE3A 2AL6A 1ZSQA 2M14A 1FHOA 1Y19B 4K2PA 4C0AA 4DX90 3ODOA 2DYQA 4IOYX 1UEFA 1V5PA 4HAYB 1EF1A 3O96A 1MIZB 4KHAA 4PQ0A 3DCXA 3PVUA 2YT2A 3NSUA 2N0YA 2K8EA 1V89A 5I2MA 3VOQA 2Z0QA 1TXDA 4GMVA 4A6HA 5JHHA 2ZPYA 3WA0A 2W2WA 3FSSA 5DIFB 3GYPA 2P0HA 2D9WA 3ODXA 4HB3B 4EJNA 4KHBB 4YL8A 2L2IA 4HB2B 4DIXA 2RRFA 1M7RA 1TQZA 5HE2A 4QJ5B 1X86A 2IYBA 4KVGB 5FI1A 2KIEA 3NW8A 5D27A 5D3XA 4GXBA 2LULA 1WI1A 2OQBA 1W1HA 3TVVA 1U5GA 1H4RA 4QJ3B 3UZTA 2MFQA 2L1CA 3D8EA 2KUQA 4HB4B 4HAVB 2N23A 5J3TA 2G35A 1LB1A 4DX8A 2D4QA 2YS5A 4GZUA 4Z2MB 2COFA 3ZVRA 5GOWB 3A8PA 5L81A 2KGXB 3IVFA 3PP2A 4MY6A 1NI2A 3TO1A 4QJ4B 2R0DA 1FAOA 1NU2A 2ELAA 1X1FA 4XWXA 4L1RA 4OSNA 1ZVRA 1RJ2A 4P7IA 5CLQB
chains in the Genus database with same CATH topology
1MK9B 5DHFB 3HW2B 4GPTB 1NTVA 5C16A 1RRPB 1DDVA 2VSZA 4D0NB 2YF0A 3FEHA 1U29A 2DHKA 4H8SA 1EAZA 1UNPA 1E5WA 1KZ7A 4K81A 5C79A 2YT1A 3N7CA 2D10A 2UVMA 1KZGA 1OQNA 1I2HA 2I5FA 4IAPA 5C5BB 2MWNB 2DLWA 1I7AA 1NTYA 1WG7A 2CODA 2X18A 4Z2NA 3DXCA 1BTKA 2D9YA 4A6FB 1PFJA 1TJ6A 2GJYA 2I1KA 3AU4A 2VKIA 1WJMA 3SNHA 4TKNA 3TW1A 3G9WA 3CXBB 2J59M 2CRFA 5D3VA 1H10A 4ZRKA 2RSGA 2XQNM 3KY9A 1U27A 3RCPA 3CIKA 5JHGA 4ZRJA 5HE0A 2YS1A 2D9XA 1DBHA 3SUZA 1FHWA 2DN6A 2PZ1A 3SYXA 2FJLA 2UZRA 1Z87A 2W2XD 2Z0OA 1KI1B 2LOZA 2RNRB 2LYDA 1Y5OA 4CYEA 2DHJA 2HE7A 4KAXB 1SGHA 2COAA 3OANA 1XX0A 1MPHA 5HE1A 3A8QA 4B6HA 1X11A 1XODA 2D11A 3GYOA 3ODWA 5J3QA 3VIAA 5KCVA 3DXDA 1PLSA 1AQCA 1BWNA 3X23A 2Z0PA 5J3YA 1OY2A 1UNQA 4DBBA 3HQCA 2Y8FA 5FI0A 4F7UP 2UZSA 1J0WA 2K2UA 5C6RA 2JP2A 1V5MA 2HTHB 4YONA 2IFSA 4CHJA 2EMTA 2P0FA 1MAIA 4K17A 2K00A 2QKMA 4GN1A 1MIXA 2AEHA 5EFXA 4HAWB 2CY4A 5JP4A 2LOXA 3LJUX 2COCA 2CY5A 5LONB 2DYNA 1ISNA 1GC7A 3M1IB 3WYFB 1UPQA 4WJ7A 5JLJB 4Y94A 3QWMA 4IFSA 2ADZA 1EGXA 2LKOA 4EKUA 1FHXA 3D8DA 4F7HA 4TYZA 3V5WA 2I1JA 4NSWA 2GCLA 3ZDTA 3KSYA 4GMXB 3MPXA 1W1GA 5C5BA 2YT0A 3U8ZA 2H7EA 2OTXA 3ML4A 1FGYA 3A98B 3ULBA 3KRWA 2YRYA 4A6FA 1MK7B 4L6EA 1DROA 2DFKA 2Q13A 1GC6A 2J0MA 3PG7A 1K5DB 4K2OA 1UPRA 2DA0A 3D8FA 1PMSA 1P5TA 3TFMA 4HAUB 2MKRA 1IRSA 1FB8A 1U5EA 1QQGA 4PNKA 2E2XA 1QC6A 1OMWA 3PVWA 1Q67A 2ELBA 1V61A 2J0KA 1MKEA 3FM8C 3PSCA 1GG3A 4MK0A 1U5DA 1W1DA 3DXEA 4DXAB 1BAKA 5KQ4A 2YVCA 4HDQA 2KCJA 1P6SA 5D3YA 2M38A 5DI9B 1N3HA 5DH9B 1WVHA 4HAZB 1XR0B 1ZC4B 2VRWB 2MDXA 2Y7BA 1X05A 4BBKA 3SO6A 1LW3A 2EC1A 2BCJA 2RGNB 3QBVB 2DHIA 1UNRA 4F7GA 2EMSA 2GS0A 1P3RA 4MT7A 1V5UA 4A6KA 5DHAB 1DDWA 2DKQA 2P8VA 3P6AA 2R09A 2V76A 1V88A 2GCJA 2D9VA 5D3WA 2P0DA 2QKLA 3F0WA 3F5RA 2NZ8B 1WGQA 1SHCA 4HDOA 1FGZA 4HATB 5LOPB 3HK0A 1DDMA 3BINA 3PZDA 1WGUA 2W2XC 2DTCA 3KRXA 3BJIA 4KHOA 1XD4A 2EJ8A 4CHMA 1WJ1A 3T06A 3TCAA 2I5CA 1XKEA 2RVBB 1U5FA 3KZ1A 1BTNA 2NMBA 2RLOA 1FOEA 3QIJA 2RUKB 3ULCA 3AJ4A 1K5GB 4WSFA 2Y8GA 2K2JA 2DX5A 1M7EA 4HHVA 3P7ZA 3MDBC 3PVLA 2D2QA 4A5KA 4EMOA 1J19A 2ROVA 1XCGA 4HB0B 2LG1A 1U2BA 2H7DA 1AWEA 2J0JA 3AU5A 3PEGA 4NY0A 4ZRIA 1DYNA 1ZM0A 4HAXB 2YS3A 5CLLB 2YSZA 1X1GA 3SV1A 1EVHA 2D9ZA 5KQ1A 2DX1A 3U7DA 2KUPA 1ZC3B 4WVFB 2CAYA 1B55A 2DKPA 2ROZB 5HE3A 2AL6A 1ZSQA 2M14A 1FHOA 1Y19B 4K2PA 4C0AA 4DX90 3ODOA 2DYQA 4IOYX 1UEFA 1V5PA 4HAYB 1EF1A 3O96A 1MIZB 4KHAA 4PQ0A 3PVUA 3NSUA 2N0YA 1V89A 3VOQA 2Z0QA 1TXDA 4GMVA 4A6HA 5JHHA 2ZPYA 3WA0A 2W2WA 3FSSA 5DIFB 3GYPA 2P0HA 2D9WA 3ODXA 4HB3B 4EJNA 4KHBB 4YL8A 2L2IA 4HB2B 1M7RA 1TQZA 5HE2A 1X86A 2IYBA 4KVGB 5FI1A 5D27A 5D3XA 4GXBA 2LULA 1WI1A 2OQBA 1W1HA 3TVVA 1U5GA 1H4RA 3UZTA 2MFQA 2L1CA 3D8EA 4HB4B 4HAVB 2N23A 5J3TA 2G35A 1LB1A 4DX8A 2D4QA 2YS5A 4GZUA 4Z2MB 2COFA 3ZVRA 5GOWB 3A8PA 5L81A 2KGXB 3IVFA 3PP2A 4MY6A 1NI2A 3TO1A 2R0DA 1FAOA 1NU2A 2ELAA 1X1FA 4XWXA 1ZVRA 1RJ2A 4P7IA 5CLQB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MK9 B;  5DHF B;  3HW2 B;  4GPT B;  1NTV A;  5C16 A;  1RRP B;  1DDV A;  2VSZ A;  4D0N B;  2YF0 A;  3FEH A;  1U29 A;  2DHK A;  4H8S A;  1EAZ A;  1UNP A;  1E5W A;  1KZ7 A;  4K81 A;  5C79 A;  2YT1 A;  3N7C A;  2D10 A;  2UVM A;  1KZG A;  1OQN A;  1I2H A;  2I5F A;  4IAP A;  5C5B B;  2MWN B;  2DLW A;  1I7A A;  1NTY A;  1WG7 A;  2COD A;  2X18 A;  4Z2N A;  3DXC A;  1BTK A;  2D9Y A;  4A6F B;  1PFJ A;  1TJ6 A;  2GJY A;  2I1K A;  3AU4 A;  2VKI A;  1WJM A;  3SNH A;  4TKN A;  3TW1 A;  3G9W A;  3CXB B;  2J59 M;  2CRF A;  5D3V A;  1H10 A;  4ZRK A;  2RSG A;  2XQN M;  3KY9 A;  1U27 A;  3RCP A;  3CIK A;  5JHG A;  4ZRJ A;  5HE0 A;  2YS1 A;  2D9X A;  1DBH A;  3SUZ A;  1FHW A;  2DN6 A;  2PZ1 A;  3SYX A;  2FJL A;  2UZR A;  1Z87 A;  2W2X D;  2Z0O A;  1KI1 B;  2LOZ A;  2RNR B;  2LYD A;  1Y5O A;  4CYE A;  2DHJ A;  2HE7 A;  4KAX B;  1SGH A;  2COA A;  3OAN A;  1XX0 A;  1MPH A;  5HE1 A;  3A8Q A;  4B6H A;  1X11 A;  1XOD A;  2D11 A;  3GYO A;  3ODW A;  5J3Q A;  3VIA A;  5KCV A;  3DXD A;  1PLS A;  1AQC A;  1BWN A;  3X23 A;  2Z0P A;  5J3Y A;  1OY2 A;  1UNQ A;  4DBB A;  3HQC A;  2Y8F A;  5FI0 A;  4F7U P;  2UZS A;  1J0W A;  2K2U A;  5C6R A;  2JP2 A;  1V5M A;  2HTH B;  4YON A;  2IFS A;  4CHJ A;  2EMT A;  2P0F A;  1MAI A;  4K17 A;  2K00 A;  2QKM A;  4GN1 A;  1MIX A;  2AEH A;  5EFX A;  4HAW B;  2CY4 A;  5JP4 A;  2LOX A;  3LJU X;  2COC A;  2CY5 A;  5LON B;  2DYN A;  1ISN A;  1GC7 A;  3M1I B;  3WYF B;  1UPQ A;  4WJ7 A;  5JLJ B;  4Y94 A;  3QWM A;  4IFS A;  2ADZ A;  1EGX A;  2LKO A;  4EKU A;  1FHX A;  3D8D A;  4F7H A;  4TYZ A;  3V5W A;  2I1J A;  4NSW A;  2GCL A;  3ZDT A;  3KSY A;  4GMX B;  3MPX A;  1W1G A;  5C5B A;  2YT0 A;  3U8Z A;  2H7E A;  2OTX A;  3ML4 A;  1FGY A;  3A98 B;  3ULB A;  3KRW A;  2YRY A;  4A6F A;  1MK7 B;  4L6E A;  1DRO A;  2DFK A;  2Q13 A;  1GC6 A;  2J0M A;  3PG7 A;  1K5D B;  4K2O A;  1UPR A;  2DA0 A;  3D8F A;  1PMS A;  1P5T A;  3TFM A;  4HAU B;  2MKR A;  1IRS A;  1FB8 A;  1U5E A;  1QQG A;  4PNK A;  2E2X A;  1QC6 A;  1OMW A;  3PVW A;  1Q67 A;  2ELB A;  1V61 A;  2J0K A;  1MKE A;  3FM8 C;  3PSC A;  1GG3 A;  4MK0 A;  1U5D A;  1W1D A;  3DXE A;  4DXA B;  1BAK A;  5KQ4 A;  2YVC A;  4HDQ A;  2KCJ A;  1P6S A;  5D3Y A;  2M38 A;  5DI9 B;  1N3H A;  5DH9 B;  1WVH A;  4HAZ B;  1XR0 B;  1ZC4 B;  2VRW B;  2MDX A;  2Y7B A;  1X05 A;  4BBK A;  3SO6 A;  1LW3 A;  2EC1 A;  2BCJ A;  2RGN B;  3QBV B;  2DHI A;  1UNR A;  4F7G A;  2EMS A;  2GS0 A;  1P3R A;  4MT7 A;  1V5U A;  4A6K A;  5DHA B;  1DDW A;  2DKQ A;  2P8V A;  3P6A A;  2R09 A;  2V76 A;  1V88 A;  2GCJ A;  2D9V A;  5D3W A;  2P0D A;  2QKL A;  3F0W A;  3F5R A;  2NZ8 B;  1WGQ A;  1SHC A;  4HDO A;  1FGZ A;  4HAT B;  5LOP B;  3HK0 A;  1DDM A;  3BIN A;  3PZD A;  1WGU A;  2W2X C;  2DTC A;  3KRX A;  3BJI A;  4KHO A;  1XD4 A;  2EJ8 A;  4CHM A;  1WJ1 A;  3T06 A;  3TCA A;  2I5C A;  1XKE A;  2RVB B;  1U5F A;  3KZ1 A;  1BTN A;  2NMB A;  2RLO A;  1FOE A;  3QIJ A;  2RUK B;  3ULC A;  3AJ4 A;  1K5G B;  4WSF A;  2Y8G A;  2K2J A;  2DX5 A;  1M7E A;  4HHV A;  3P7Z A;  3MDB C;  3PVL A;  2D2Q A;  4A5K A;  4EMO A;  1J19 A;  2ROV A;  1XCG A;  4HB0 B;  2LG1 A;  1U2B A;  2H7D A;  1AWE A;  2J0J A;  3AU5 A;  3PEG A;  4NY0 A;  4ZRI A;  1DYN A;  1ZM0 A;  4HAX B;  2YS3 A;  5CLL B;  2YSZ A;  1X1G A;  3SV1 A;  1EVH A;  2D9Z A;  5KQ1 A;  2DX1 A;  3U7D A;  2KUP A;  1ZC3 B;  4WVF B;  2CAY A;  1B55 A;  2DKP A;  2ROZ B;  5HE3 A;  2AL6 A;  1ZSQ A;  2M14 A;  1FHO A;  1Y19 B;  4K2P A;  4C0A A;  4DX9 0;  3ODO A;  2DYQ A;  4IOY X;  1UEF A;  1V5P A;  4HAY B;  1EF1 A;  3O96 A;  1MIZ B;  4KHA A;  4PQ0 A;  3PVU A;  3NSU A;  2N0Y A;  1V89 A;  3VOQ A;  2Z0Q A;  1TXD A;  4GMV A;  4A6H A;  5JHH A;  2ZPY A;  3WA0 A;  2W2W A;  3FSS A;  5DIF B;  3GYP A;  2P0H A;  2D9W A;  3ODX A;  4HB3 B;  4EJN A;  4KHB B;  4YL8 A;  2L2I A;  4HB2 B;  1M7R A;  1TQZ A;  5HE2 A;  1X86 A;  2IYB A;  4KVG B;  5FI1 A;  5D27 A;  5D3X A;  4GXB A;  2LUL A;  1WI1 A;  2OQB A;  1W1H A;  3TVV A;  1U5G A;  1H4R A;  3UZT A;  2MFQ A;  2L1C A;  3D8E A;  4HB4 B;  4HAV B;  2N23 A;  5J3T A;  2G35 A;  1LB1 A;  4DX8 A;  2D4Q A;  2YS5 A;  4GZU A;  4Z2M B;  2COF A;  3ZVR A;  5GOW B;  3A8P A;  5L81 A;  2KGX B;  3IVF A;  3PP2 A;  4MY6 A;  1NI2 A;  3TO1 A;  2R0D A;  1FAO A;  1NU2 A;  2ELA A;  1X1F A;  4XWX A;  1ZVR A;  1RJ2 A;  4P7I A;  5CLQ B; 
#chains in the Genus database with same CATH topology
 1MK9 B;  5DHF B;  2KR0 A;  1ZYI A;  3HW2 B;  4GPT B;  1NTV A;  5C16 A;  1RRP B;  1DDV A;  2VSZ A;  4D0N B;  2YF0 A;  3FEH A;  1U29 A;  2DHK A;  4H8S A;  1EAZ A;  1UNP A;  1E5W A;  1KZ7 A;  4K81 A;  4QXA B;  5C79 A;  2YT1 A;  3N7C A;  2D10 A;  2UVM A;  1KZG A;  2R2Y A;  1OQN A;  1I2H A;  2I5F A;  4IAP A;  5IRS A;  5C5B B;  2MWN B;  2DLW A;  2Z59 A;  1I7A A;  1NTY A;  1WG7 A;  2COD A;  2X18 A;  4Z2N A;  3DXC A;  1BTK A;  2D9Y A;  4A6F B;  1PFJ A;  1TJ6 A;  2GJY A;  2I1K A;  3AU4 A;  2VKI A;  1WJM A;  3SNH A;  4TKN A;  3TW1 A;  3G9W A;  3CXB B;  2J59 M;  2CRF A;  5D3V A;  1H10 A;  4ZRK A;  2RSG A;  2XQN M;  3KY9 A;  1U27 A;  3RCP A;  3CIK A;  5JHG A;  4ZRJ A;  5HE0 A;  2YS1 A;  2D9X A;  1DBH A;  3SUZ A;  1FHW A;  2DN6 A;  2PZ1 A;  3SYX A;  2FJL A;  2UZR A;  1Z87 A;  2W2X D;  2Z0O A;  1KI1 B;  2LOZ A;  2RNR B;  2LYD A;  3A58 A;  1Y5O A;  4CYE A;  2DHJ A;  2HE7 A;  4KHB A;  4KAX B;  1SGH A;  2COA A;  3OAN A;  4GNK B;  5M4Y B;  1XX0 A;  2Z14 A;  1MPH A;  5HE1 A;  3A8Q A;  4B6H A;  1X11 A;  1XOD A;  2D11 A;  3GYO A;  3ODW A;  2NBV A;  5J3Q A;  3VIA A;  5KCV A;  3DXD A;  1PLS A;  1AQC A;  1BWN A;  3FVC A;  3X23 A;  3HSA A;  2Z0P A;  5J3Y A;  1OY2 A;  1UNQ A;  4DBB A;  3HQC A;  2Y8F A;  5FI0 A;  4F7U P;  2UZS A;  3NWA A;  1J0W A;  2K2U A;  2Z13 A;  5C6R A;  2JP2 A;  1V5M A;  2HTH B;  4YON A;  2IFS A;  4CHJ A;  2EMT A;  2P0F A;  4OT1 A;  1MAI A;  4K17 A;  2K00 A;  2QKM A;  4GN1 A;  2GUM A;  1MIX A;  2AEH A;  5EFX A;  4HAW B;  2CY4 A;  5JP4 A;  2LOX A;  3LJU X;  2COC A;  2CY5 A;  5LON B;  2DYN A;  1ISN A;  1GC7 A;  3M1I B;  3WYF B;  1UPQ A;  4WJ7 A;  5JLJ B;  4Y94 A;  3QWM A;  4IFS A;  2ADZ A;  1EGX A;  2LKO A;  4EKU A;  1FHX A;  3D8D A;  1MI1 A;  3NWF A;  4F7H A;  4TYZ A;  3V5W A;  2I1J A;  4NSW A;  2GCL A;  3ZDT A;  3KSY A;  4GMX B;  2Z4D A;  3MPX A;  1W1G A;  5C5B A;  2YT0 A;  3U8Z A;  2H7E A;  2OTX A;  3ML4 A;  1FGY A;  3A98 B;  3ULB A;  3KRW A;  2YRY A;  4A6F A;  1MK7 B;  4L6E A;  1DRO A;  2DFK A;  2Q13 A;  1GC6 A;  2J0M A;  3PG7 A;  1K5D B;  4K2O A;  1T77 A;  1UPR A;  4GOU A;  2DA0 A;  3D8F A;  1PMS A;  1P5T A;  3TFM A;  3OHM B;  4HAU B;  5I2S A;  2MKR A;  1IRS A;  1FB8 A;  1U5E A;  1QQG A;  4PNK A;  2E2X A;  1QC6 A;  3B77 A;  1OMW A;  3PVW A;  1Q67 A;  2ELB A;  1V61 A;  2J0K A;  1MKE A;  3FM8 C;  3PSC A;  1GG3 A;  4MK0 A;  1U5D A;  1W1D A;  3DXE A;  4DXA B;  1BAK A;  4HSI A;  5KQ4 A;  4CSQ A;  2YVC A;  4HDQ A;  3NWD A;  2KCJ A;  1P6S A;  5D3Y A;  2M38 A;  5DI9 B;  1N3H A;  5DH9 B;  1WVH A;  4HAZ B;  1XR0 B;  4D6W A;  1ZC4 B;  2VRW B;  2MDX A;  2Y7B A;  1X05 A;  4BBK A;  3SO6 A;  1LW3 A;  2FJU B;  2EC1 A;  2BCJ A;  2RGN B;  3QBV B;  2DHI A;  1UNR A;  5LG4 B;  4F7G A;  2EMS A;  2GS0 A;  3U12 A;  1P3R A;  4MT7 A;  1V5U A;  4A6K A;  5DHA B;  1DDW A;  2ZKM X;  2DKQ A;  2P8V A;  3P6A A;  2R09 A;  2V76 A;  1V88 A;  2GCJ A;  2D9V A;  5D3W A;  2P0D A;  2QKL A;  3HIE A;  3F0W A;  3F5R A;  2NZ8 B;  1WGQ A;  1SHC A;  4HDO A;  1FGZ A;  4HAT B;  5LOP B;  3HK0 A;  1DDM A;  3BIN A;  3PZD A;  1WGU A;  2W2X C;  2DTC A;  3KRX A;  3BJI A;  4KHO A;  1XD4 A;  2EJ8 A;  4CHM A;  2KIG A;  1WJ1 A;  3T06 A;  3TCA A;  2I5C A;  1XKE A;  2RVB B;  1U5F A;  3KZ1 A;  1BTN A;  2NMB A;  2RLO A;  1FOE A;  3QIJ A;  2RUK B;  3ULC A;  3AJ4 A;  1K5G B;  4WSF A;  2Y8G A;  2K2J A;  2DX5 A;  1M7E A;  4HHV A;  3P7Z A;  3MDB C;  3PVL A;  2D2Q A;  4A5K A;  4EMO A;  1J19 A;  2ROV A;  1XCG A;  4HB0 B;  2LG1 A;  1U2B A;  2K49 A;  2H7D A;  1AWE A;  2J0J A;  3AU5 A;  3PEG A;  4NY0 A;  4ZRI A;  1DYN A;  1ZM0 A;  4HAX B;  2YS3 A;  5CLL B;  2YSZ A;  1X1G A;  3SV1 A;  1EVH A;  2D9Z A;  5KQ1 A;  2DX1 A;  3U7D A;  2KUP A;  1ZC3 B;  4WVF B;  2CAY A;  1B55 A;  2DKP A;  2ROZ B;  5HE3 A;  2AL6 A;  1ZSQ A;  2M14 A;  1FHO A;  1Y19 B;  4K2P A;  4C0A A;  4DX9 0;  3ODO A;  2DYQ A;  4IOY X;  1UEF A;  1V5P A;  4HAY B;  1EF1 A;  3O96 A;  1MIZ B;  4KHA A;  4PQ0 A;  3DCX A;  3PVU A;  2YT2 A;  3NSU A;  2N0Y A;  2K8E A;  1V89 A;  5I2M A;  3VOQ A;  2Z0Q A;  1TXD A;  4GMV A;  4A6H A;  5JHH A;  2ZPY A;  3WA0 A;  2W2W A;  3FSS A;  5DIF B;  3GYP A;  2P0H A;  2D9W A;  3ODX A;  4HB3 B;  4EJN A;  4KHB B;  4YL8 A;  2L2I A;  4HB2 B;  4DIX A;  2RRF A;  1M7R A;  1TQZ A;  5HE2 A;  4QJ5 B;  1X86 A;  2IYB A;  4KVG B;  5FI1 A;  2KIE A;  3NW8 A;  5D27 A;  5D3X A;  4GXB A;  2LUL A;  1WI1 A;  2OQB A;  1W1H A;  3TVV A;  1U5G A;  1H4R A;  4QJ3 B;  3UZT A;  2MFQ A;  2L1C A;  3D8E A;  2KUQ A;  4HB4 B;  4HAV B;  2N23 A;  5J3T A;  2G35 A;  1LB1 A;  4DX8 A;  2D4Q A;  2YS5 A;  4GZU A;  4Z2M B;  2COF A;  3ZVR A;  5GOW B;  3A8P A;  5L81 A;  2KGX B;  3IVF A;  3PP2 A;  4MY6 A;  1NI2 A;  3TO1 A;  4QJ4 B;  2R0D A;  1FAO A;  1NU2 A;  2ELA A;  1X1F A;  4XWX A;  4L1R A;  4OSN A;  1ZVR A;  1RJ2 A;  4P7I A;  5CLQ B; 
#chains in the Genus database with same CATH homology
 1MK9 B;  5DHF B;  3HW2 B;  4GPT B;  1NTV A;  5C16 A;  1RRP B;  1DDV A;  2VSZ A;  4D0N B;  2YF0 A;  3FEH A;  1U29 A;  2DHK A;  4H8S A;  1EAZ A;  1UNP A;  1E5W A;  1KZ7 A;  4K81 A;  5C79 A;  2YT1 A;  3N7C A;  2D10 A;  2UVM A;  1KZG A;  1OQN A;  1I2H A;  2I5F A;  4IAP A;  5C5B B;  2MWN B;  2DLW A;  1I7A A;  1NTY A;  1WG7 A;  2COD A;  2X18 A;  4Z2N A;  3DXC A;  1BTK A;  2D9Y A;  4A6F B;  1PFJ A;  1TJ6 A;  2GJY A;  2I1K A;  3AU4 A;  2VKI A;  1WJM A;  3SNH A;  4TKN A;  3TW1 A;  3G9W A;  3CXB B;  2J59 M;  2CRF A;  5D3V A;  1H10 A;  4ZRK A;  2RSG A;  2XQN M;  3KY9 A;  1U27 A;  3RCP A;  3CIK A;  5JHG A;  4ZRJ A;  5HE0 A;  2YS1 A;  2D9X A;  1DBH A;  3SUZ A;  1FHW A;  2DN6 A;  2PZ1 A;  3SYX A;  2FJL A;  2UZR A;  1Z87 A;  2W2X D;  2Z0O A;  1KI1 B;  2LOZ A;  2RNR B;  2LYD A;  1Y5O A;  4CYE A;  2DHJ A;  2HE7 A;  4KAX B;  1SGH A;  2COA A;  3OAN A;  1XX0 A;  1MPH A;  5HE1 A;  3A8Q A;  4B6H A;  1X11 A;  1XOD A;  2D11 A;  3GYO A;  3ODW A;  5J3Q A;  3VIA A;  5KCV A;  3DXD A;  1PLS A;  1AQC A;  1BWN A;  3X23 A;  2Z0P A;  5J3Y A;  1OY2 A;  1UNQ A;  4DBB A;  3HQC A;  2Y8F A;  5FI0 A;  4F7U P;  2UZS A;  1J0W A;  2K2U A;  5C6R A;  2JP2 A;  1V5M A;  2HTH B;  4YON A;  2IFS A;  4CHJ A;  2EMT A;  2P0F A;  1MAI A;  4K17 A;  2K00 A;  2QKM A;  4GN1 A;  1MIX A;  2AEH A;  5EFX A;  4HAW B;  2CY4 A;  5JP4 A;  2LOX A;  3LJU X;  2COC A;  2CY5 A;  5LON B;  2DYN A;  1ISN A;  1GC7 A;  3M1I B;  3WYF B;  1UPQ A;  4WJ7 A;  5JLJ B;  4Y94 A;  3QWM A;  4IFS A;  2ADZ A;  1EGX A;  2LKO A;  4EKU A;  1FHX A;  3D8D A;  4F7H A;  4TYZ A;  3V5W A;  2I1J A;  4NSW A;  2GCL A;  3ZDT A;  3KSY A;  4GMX B;  3MPX A;  1W1G A;  5C5B A;  2YT0 A;  3U8Z A;  2H7E A;  2OTX A;  3ML4 A;  1FGY A;  3A98 B;  3ULB A;  3KRW A;  2YRY A;  4A6F A;  1MK7 B;  4L6E A;  1DRO A;  2DFK A;  2Q13 A;  1GC6 A;  2J0M A;  3PG7 A;  1K5D B;  4K2O A;  1UPR A;  2DA0 A;  3D8F A;  1PMS A;  1P5T A;  3TFM A;  4HAU B;  2MKR A;  1IRS A;  1FB8 A;  1U5E A;  1QQG A;  4PNK A;  2E2X A;  1QC6 A;  1OMW A;  3PVW A;  1Q67 A;  2ELB A;  1V61 A;  2J0K A;  1MKE A;  3FM8 C;  3PSC A;  1GG3 A;  4MK0 A;  1U5D A;  1W1D A;  3DXE A;  4DXA B;  1BAK A;  5KQ4 A;  2YVC A;  4HDQ A;  2KCJ A;  1P6S A;  5D3Y A;  2M38 A;  5DI9 B;  1N3H A;  5DH9 B;  1WVH A;  4HAZ B;  1XR0 B;  1ZC4 B;  2VRW B;  2MDX A;  2Y7B A;  1X05 A;  4BBK A;  3SO6 A;  1LW3 A;  2EC1 A;  2BCJ A;  2RGN B;  3QBV B;  2DHI A;  1UNR A;  4F7G A;  2EMS A;  2GS0 A;  1P3R A;  4MT7 A;  1V5U A;  4A6K A;  5DHA B;  1DDW A;  2DKQ A;  2P8V A;  3P6A A;  2R09 A;  2V76 A;  1V88 A;  2GCJ A;  2D9V A;  5D3W A;  2P0D A;  2QKL A;  3F0W A;  3F5R A;  2NZ8 B;  1WGQ A;  1SHC A;  4HDO A;  1FGZ A;  4HAT B;  5LOP B;  3HK0 A;  1DDM A;  3BIN A;  3PZD A;  1WGU A;  2W2X C;  2DTC A;  3KRX A;  3BJI A;  4KHO A;  1XD4 A;  2EJ8 A;  4CHM A;  1WJ1 A;  3T06 A;  3TCA A;  2I5C A;  1XKE A;  2RVB B;  1U5F A;  3KZ1 A;  1BTN A;  2NMB A;  2RLO A;  1FOE A;  3QIJ A;  2RUK B;  3ULC A;  3AJ4 A;  1K5G B;  4WSF A;  2Y8G A;  2K2J A;  2DX5 A;  1M7E A;  4HHV A;  3P7Z A;  3MDB C;  3PVL A;  2D2Q A;  4A5K A;  4EMO A;  1J19 A;  2ROV A;  1XCG A;  4HB0 B;  2LG1 A;  1U2B A;  2H7D A;  1AWE A;  2J0J A;  3AU5 A;  3PEG A;  4NY0 A;  4ZRI A;  1DYN A;  1ZM0 A;  4HAX B;  2YS3 A;  5CLL B;  2YSZ A;  1X1G A;  3SV1 A;  1EVH A;  2D9Z A;  5KQ1 A;  2DX1 A;  3U7D A;  2KUP A;  1ZC3 B;  4WVF B;  2CAY A;  1B55 A;  2DKP A;  2ROZ B;  5HE3 A;  2AL6 A;  1ZSQ A;  2M14 A;  1FHO A;  1Y19 B;  4K2P A;  4C0A A;  4DX9 0;  3ODO A;  2DYQ A;  4IOY X;  1UEF A;  1V5P A;  4HAY B;  1EF1 A;  3O96 A;  1MIZ B;  4KHA A;  4PQ0 A;  3PVU A;  3NSU A;  2N0Y A;  1V89 A;  3VOQ A;  2Z0Q A;  1TXD A;  4GMV A;  4A6H A;  5JHH A;  2ZPY A;  3WA0 A;  2W2W A;  3FSS A;  5DIF B;  3GYP A;  2P0H A;  2D9W A;  3ODX A;  4HB3 B;  4EJN A;  4KHB B;  4YL8 A;  2L2I A;  4HB2 B;  1M7R A;  1TQZ A;  5HE2 A;  1X86 A;  2IYB A;  4KVG B;  5FI1 A;  5D27 A;  5D3X A;  4GXB A;  2LUL A;  1WI1 A;  2OQB A;  1W1H A;  3TVV A;  1U5G A;  1H4R A;  3UZT A;  2MFQ A;  2L1C A;  3D8E A;  4HB4 B;  4HAV B;  2N23 A;  5J3T A;  2G35 A;  1LB1 A;  4DX8 A;  2D4Q A;  2YS5 A;  4GZU A;  4Z2M B;  2COF A;  3ZVR A;  5GOW B;  3A8P A;  5L81 A;  2KGX B;  3IVF A;  3PP2 A;  4MY6 A;  1NI2 A;  3TO1 A;  2R0D A;  1FAO A;  1NU2 A;  2ELA A;  1X1F A;  4XWX A;  1ZVR A;  1RJ2 A;  4P7I A;  5CLQ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...