4BBKA

Structural and functional characterisation of the kindlin-1 pleckstrin homology domain
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
128
structure length
121
Chain Sequence
PKLADYLKLFRACKQYWFVFKDTSIAYFKNKELEQGEPIEKLNLRGCEIVPDVNVSGRKFGIKLLIPVADGMNEVYLRCDHEDQYARWMAACILASKGKTMADSSYQPEVISILSFLKMKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural and Functional Characterisation of the Kindlin-1 Pleckstrin Homology Domain
pubmed doi rcsb
source organism Mus musculus
molecule tags Cell adhesion
molecule keywords FERMITIN FAMILY HOMOLOG 1
total genus 34
structure length 121
sequence length 128
ec nomenclature
pdb deposition date 2012-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4bbkA00
1N3HA 2GS0A 4ZRKA 2I5FA 1FGYA 1V61A 3AU4A 2ZPYA 2HTHB 1WVHA 1EAZA 1W1HA 3PSCA 5FI1A 2LULA 4HAWB 3DXEA 1H4RA 2OQBA 1I7AA 2ADZA 2EMSA 4DX90 3CXBB 2DX5A 1PLSA 4PQ0A 2VKIA 1U2BA 4GPTB 5DH9B 1EF1A 4KVGB 2RLOA 5C16A 2D4QA 4HATB 1KZ7A 2Z0PA 3OANA 4PNKA 2YS1A 3G9WA 2J59M 5HE3A 4MY6A 3MPXA 1ZC4B 1X05A 2RNRB 1J19A 1U5FA 3HW2B 2D9VA 3TO1A 2W2WA 2DKQA 5CLQB 1U5EA 1FHWA 1U27A 4A6KA 2DX1A 5JLJB 4ZRJA 4CHMA 4GXBA 2COCA 4K17A 2IFSA 5D3YA 2DHJA 3TCAA 4DX8A 1PFJA 2Z0OA 1MIXA 1DBHA 4KHOA 1NTVA 2J0KA 1WGUA 2N0YA 1XR0B 1RJ2A 2YS3A 3KY9A 3D8EA 5GOWB 2G35A 1XCGA 2QKLA 1P5TA 4YL8A 2YS5A 4P7IA 1NI2A 3KSYA 1KZGA 4Y94A 3P6AA 2CODA 4GN1A 3AJ4A 2DN6A 3PZDA 2D9YA 4HAUB 2GCJA 2DKPA 3N7CA 4GZUA 3RCPA 1WI1A 3KRXA 2I5CA 4NY0A 4HAXB 1TQZA 3ULCA 4BBKA 2RUKB 2N23A 1BTNA 1TJ6A 5KCVA 2DFKA 5C5BB 1MKEA 2KUPA 2AL6A 2NMBA 1Y5OA 3ML4A 3ODWA 4DBBA 4IAPA 1RRPB 4HB4B 4F7HA 2CRFA 1LB1A 2LOXA 2YT0A 3AU5A 2RGNB 2D9XA 3ZVRA 3GYPA 2LYDA 2PZ1A 4KHBB 4TYZA 3TW1A 1XODA 2D9WA 3CIKA 1BTKA 1TXDA 3FEHA 3SYXA 2W2XD 4Z2NA 2I1KA 4YONA 1KI1B 5FI0A 2OTXA 4C0AA 2IYBA 2D11A 1FB8A 1DYNA 1FOEA 1BAKA 5L81A 2P0DA 2EC1A 1DDVA 5C79A 3BJIA 3KZ1A 4A6FA 3BINA 1EVHA 1FGZA 4K2OA 1MK9B 1OMWA 2Z0QA 3UZTA 2UZRA 2J0JA 4HAYB 5JHHA 4TKNA 1XKEA 3QIJA 2LOZA 5C6RA 2BCJA 4DXAB 3IVFA 4L6EA 1QQGA 1MAIA 1WGQA 4EKUA 2ELAA 4EMOA 4KAXB 2K2UA 2YRYA 1J0WA 2NZ8B 1MK7B 1MIZB 2JP2A 4IOYX 1DDMA 2Y8FA 3F0WA 5DIFB 1ZC3B 2YT1A 2ELBA 3A98B 1BWNA 2H7DA 4F7GA 2DYNA 2DLWA 3WA0A 2YSZA 1OY2A 4ZRIA 1P3RA 1GC7A 4GMVA 3ZDTA 2KGXB 5J3QA 1B55A 3KRWA 5HE2A 2LKOA 1H10A 5LONB 1WG7A 1X86A 3HQCA 2RVBB 3A8PA 4EJNA 4D0NB 2W2XC 1FAOA 2L1CA 1SHCA 3ODOA 2V76A 3HK0A 1P6SA 1U5GA 3QBVB 1M7EA 2J0MA 1X11A 4HB0B 2CAYA 2P0HA 1V88A 1Z87A 2VRWB 4A5KA 4HDOA 3V5WA 5J3TA 1AQCA 1XX0A 1X1FA 1MPHA 2LG1A 1ZVRA 4H8SA 3FM8C 4K2PA 1W1DA 3PP2A 1UNQA 2E2XA 3NSUA 4KHAA 4HAZB 2K00A 2I1JA 2M14A 4MT7A 2EMTA 5HE1A 2CY4A 1ISNA 3ULBA 2UVMA 1Y19B 2R0DA 3SV1A 1V89A 5HE0A 3PVUA 2MKRA 5D27A 1DDWA 5J3YA 2CY5A 5KQ4A 4IFSA 3GYOA 4HAVB 5CLLB 2DYQA 5D3XA 1FHXA 1U5DA 5DHAB 2X18A 5DHFB 4CYEA 3WYFB 5D3WA 2DA0A 2Y7BA 2K2JA 4XWXA 3SUZA 2DTCA 1SGHA 2COAA 4WJ7A 2H7EA 3MDBC 1V5MA 4WVFB 1OQNA 2D10A 1W1GA 3X23A 1X1GA 3ODXA 2GJYA 3VIAA 5LOPB 2Q13A 2FJLA 1UNRA 2M38A 2P8VA 3TVVA 2D9ZA 3A8QA 2DHKA 1WJ1A 5KQ1A 1QC6A 3T06A 2QKMA 1V5PA 2DHIA 2RSGA 2HE7A 3U8ZA 3U7DA 5JP4A 3TFMA 4HB2B 4B6HA 4K81A 2YVCA 3VOQA 4NSWA 3LJUX 4A6HA 4CHJA 1UPQA 2MWNB 5D3VA 4Z2MB 1IRSA 3O96A 1I2HA 2GCLA 3FSSA 5C5BA 3SO6A 2ROZB 4HDQA 3PVLA 4WSFA 4F7UP 2UZSA 3PEGA 3PG7A 4MK0A 1ZSQA 1GC6A 1UEFA 2KCJA 3F5RA 4GMXB 2YF0A 2MDXA 3SNHA 3DXCA 1DROA 1M7RA 2R09A 1NU2A 3PVWA 1AWEA 4HB3B 3D8FA 2VSZA 1EGXA 1UPRA 4A6FB 1K5GB 3QWMA 5DI9B 2ROVA 2MFQA 1FHOA 1NTYA 1E5WA 1U29A 5EFXA 1UNPA 2XQNM 1XD4A 3M1IB 2P0FA 2L2IA 3P7ZA 1V5UA 1GG3A 1Q67A 1PMSA 2COFA 2AEHA 2EJ8A 5JHGA 1WJMA 1ZM0A 4HHVA 1LW3A 3DXDA 3D8DA 2D2QA 2Y8GA 1K5DB
chains in the Genus database with same CATH superfamily
1N3HA 2GS0A 4ZRKA 2I5FA 1FGYA 1V61A 3AU4A 4CSQA 2ZPYA 2HTHB 1WVHA 1EAZA 1W1HA 3PSCA 2KIEA 5FI1A 2LULA 4HAWB 3DXEA 1H4RA 2OQBA 1I7AA 2ADZA 3NWDA 2EMSA 4DX90 3CXBB 2DX5A 1PLSA 4PQ0A 2VKIA 1U2BA 4GPTB 5DH9B 1EF1A 4KVGB 2RLOA 5C16A 2D4QA 4L1RA 4HATB 1KZ7A 2Z0PA 3A58A 3OANA 2KIGA 4PNKA 2YS1A 3G9WA 2J59M 5HE3A 3OHMB 4QJ3B 4MY6A 3MPXA 1ZC4B 1X05A 2RNRB 1J19A 3HW2B 1U5FA 2D9VA 3TO1A 2W2WA 2DKQA 2KR0A 5CLQB 1U5EA 1FHWA 1U27A 4GOUA 4A6KA 2DX1A 5JLJB 4ZRJA 4CHMA 4GXBA 2COCA 4K17A 2Z59A 2IFSA 2FJUB 5D3YA 2DHJA 2GUMA 3TCAA 5LG4B 4DX8A 1PFJA 2Z0OA 3NWFA 1MIXA 1DBHA 4KHOA 1NTVA 2J0KA 1WGUA 2N0YA 1XR0B 1RJ2A 2YS3A 3KY9A 3B77A 3D8EA 5GOWB 2G35A 3U12A 1XCGA 2QKLA 1P5TA 4YL8A 2YS5A 4P7IA 1NI2A 3KSYA 1KZGA 4Y94A 3P6AA 5M4YB 2CODA 4GN1A 3AJ4A 2DN6A 3PZDA 1MI1A 2D9YA 4HAUB 2GCJA 2DKPA 2K8EA 3N7CA 4GZUA 5I2SA 3RCPA 1WI1A 3KRXA 2I5CA 2K49A 4NY0A 4HAXB 1TQZA 3ULCA 4BBKA 2RUKB 2N23A 1BTNA 1TJ6A 5KCVA 2DFKA 5C5BB 1MKEA 2KUPA 2AL6A 2NMBA 1Y5OA 3ML4A 2KUQA 3ODWA 4D6WA 4DBBA 4IAPA 1T77A 1RRPB 4HB4B 4F7HA 2CRFA 1LB1A 2LOXA 2YT0A 3AU5A 2RGNB 2D9XA 3ZVRA 3GYPA 2LYDA 2PZ1A 4KHBB 4TYZA 3TW1A 1XODA 4OT1A 2D9WA 3CIKA 1BTKA 1TXDA 3FEHA 3SYXA 2W2XD 4Z2NA 2I1KA 4YONA 1KI1B 5FI0A 2OTXA 4C0AA 2IYBA 2D11A 1FB8A 1DYNA 1FOEA 1BAKA 5L81A 2P0DA 2EC1A 1DDVA 5C79A 3BJIA 3KZ1A 4A6FA 3BINA 1EVHA 1FGZA 4K2OA 1MK9B 1OMWA 2Z0QA 3UZTA 2UZRA 2J0JA 4HAYB 5JHHA 4TKNA 1XKEA 3QIJA 2LOZA 5C6RA 2BCJA 4DXAB 3IVFA 4L6EA 1QQGA 1MAIA 1WGQA 3FVCA 4EKUA 2ELAA 4EMOA 4KAXB 2K2UA 2YRYA 1J0WA 2NZ8B 1MK7B 1MIZB 2JP2A 4IOYX 1DDMA 2Y8FA 3F0WA 5DIFB 1ZC3B 2YT1A 2ELBA 3A98B 1BWNA 2H7DA 4F7GA 2DYNA 2DLWA 3WA0A 2YSZA 1OY2A 4ZRIA 2YT2A 1P3RA 1GC7A 4GMVA 3ZDTA 2KGXB 5J3QA 1B55A 3KRWA 5HE2A 2LKOA 1H10A 5LONB 1WG7A 1X86A 3HQCA 2RVBB 3A8PA 4EJNA 4D0NB 2W2XC 1FAOA 2L1CA 4QJ4B 1SHCA 3ODOA 2V76A 3HK0A 1P6SA 1U5GA 3QBVB 1M7EA 2J0MA 1X11A 4HB0B 2Z4DA 2CAYA 2P0HA 1V88A 1Z87A 2VRWB 4A5KA 4HDOA 3V5WA 5J3TA 1AQCA 1XX0A 1X1FA 1ZYIA 1MPHA 2LG1A 1ZVRA 4H8SA 3FM8C 4K2PA 1W1DA 3PP2A 1UNQA 2E2XA 3NSUA 4KHAA 4HAZB 2K00A 4QXAB 2I1JA 2M14A 4MT7A 2EMTA 5HE1A 2CY4A 1ISNA 3ULBA 2UVMA 1Y19B 5I2MA 2R0DA 3SV1A 1V89A 5HE0A 3PVUA 2MKRA 2Z13A 5D27A 1DDWA 5J3YA 2CY5A 5KQ4A 3HSAA 4IFSA 3GYOA 4HAVB 4DIXA 2NBVA 5CLLB 2DYQA 5D3XA 1FHXA 1U5DA 5DHAB 2X18A 5DHFB 4CYEA 3WYFB 5D3WA 2DA0A 2RRFA 2Y7BA 2K2JA 4XWXA 3SUZA 2DTCA 1SGHA 2COAA 2ZKMX 3HIEA 4WJ7A 2H7EA 3MDBC 1V5MA 4WVFB 1OQNA 2D10A 1W1GA 3X23A 1X1GA 3ODXA 2GJYA 3VIAA 5LOPB 4KHBA 2Q13A 2FJLA 1UNRA 2M38A 2P8VA 3TVVA 2D9ZA 3A8QA 2DHKA 1WJ1A 5KQ1A 1QC6A 3NW8A 3T06A 2QKMA 1V5PA 2DHIA 2RSGA 4QJ5B 2HE7A 3U8ZA 3U7DA 5JP4A 3TFMA 4HB2B 4B6HA 4GNKB 4K81A 2YVCA 3VOQA 4NSWA 3LJUX 4A6HA 4CHJA 1UPQA 5IRSA 2MWNB 5D3VA 4Z2MB 1IRSA 3DCXA 3O96A 1I2HA 2GCLA 3FSSA 5C5BA 3SO6A 2ROZB 4HDQA 4OSNA 2R2YA 3PVLA 4WSFA 4F7UP 2UZSA 3PEGA 3PG7A 4MK0A 2Z14A 1ZSQA 1GC6A 1UEFA 2KCJA 3F5RA 4GMXB 2YF0A 2MDXA 3SNHA 4HSIA 3DXCA 1DROA 1M7RA 2R09A 1NU2A 3PVWA 1AWEA 4HB3B 3D8FA 2VSZA 1EGXA 1UPRA 4A6FB 1K5GB 3QWMA 5DI9B 2ROVA 2MFQA 1FHOA 1NTYA 1E5WA 3NWAA 1U29A 5EFXA 1UNPA 2XQNM 1XD4A 3M1IB 2P0FA 2L2IA 3P7ZA 1GG3A 1V5UA 1Q67A 1PMSA 2COFA 2AEHA 2EJ8A 5JHGA 1WJMA 1ZM0A 3DXDA 1LW3A 4HHVA 3D8DA 2D2QA 2Y8GA 1K5DB
chains in the Genus database with same CATH topology
1N3HA 2GS0A 4ZRKA 2I5FA 1FGYA 1V61A 3AU4A 2ZPYA 2HTHB 1WVHA 1EAZA 1W1HA 3PSCA 5FI1A 2LULA 4HAWB 3DXEA 1H4RA 2OQBA 1I7AA 2ADZA 2EMSA 4DX90 3CXBB 2DX5A 1PLSA 4PQ0A 2VKIA 1U2BA 4GPTB 5DH9B 1EF1A 4KVGB 2RLOA 5C16A 2D4QA 4HATB 1KZ7A 2Z0PA 3OANA 4PNKA 2YS1A 3G9WA 2J59M 5HE3A 4MY6A 3MPXA 1ZC4B 1X05A 2RNRB 1J19A 1U5FA 3HW2B 2D9VA 3TO1A 2W2WA 2DKQA 5CLQB 1U5EA 1FHWA 1U27A 4A6KA 2DX1A 5JLJB 4ZRJA 4CHMA 4GXBA 2COCA 4K17A 2IFSA 5D3YA 2DHJA 3TCAA 4DX8A 1PFJA 2Z0OA 1MIXA 1DBHA 4KHOA 1NTVA 2J0KA 1WGUA 2N0YA 1XR0B 1RJ2A 2YS3A 3KY9A 3D8EA 5GOWB 2G35A 1XCGA 2QKLA 1P5TA 4YL8A 2YS5A 4P7IA 1NI2A 3KSYA 1KZGA 4Y94A 3P6AA 2CODA 4GN1A 3AJ4A 2DN6A 3PZDA 2D9YA 4HAUB 2GCJA 2DKPA 3N7CA 4GZUA 3RCPA 1WI1A 3KRXA 2I5CA 4NY0A 4HAXB 1TQZA 3ULCA 4BBKA 2RUKB 2N23A 1BTNA 1TJ6A 5KCVA 2DFKA 5C5BB 1MKEA 2KUPA 2AL6A 2NMBA 1Y5OA 3ML4A 3ODWA 4DBBA 4IAPA 1RRPB 4HB4B 4F7HA 2CRFA 1LB1A 2LOXA 2YT0A 3AU5A 2RGNB 2D9XA 3ZVRA 3GYPA 2LYDA 2PZ1A 4KHBB 4TYZA 3TW1A 1XODA 2D9WA 3CIKA 1BTKA 1TXDA 3FEHA 3SYXA 2W2XD 4Z2NA 2I1KA 4YONA 1KI1B 5FI0A 2OTXA 4C0AA 2IYBA 2D11A 1FB8A 1DYNA 1FOEA 1BAKA 5L81A 2P0DA 2EC1A 1DDVA 5C79A 3BJIA 3KZ1A 4A6FA 3BINA 1EVHA 1FGZA 4K2OA 1MK9B 1OMWA 2Z0QA 3UZTA 2UZRA 2J0JA 4HAYB 5JHHA 4TKNA 1XKEA 3QIJA 2LOZA 5C6RA 2BCJA 4DXAB 3IVFA 4L6EA 1QQGA 1MAIA 1WGQA 4EKUA 2ELAA 4EMOA 4KAXB 2K2UA 2YRYA 1J0WA 2NZ8B 1MK7B 1MIZB 2JP2A 4IOYX 1DDMA 2Y8FA 3F0WA 5DIFB 1ZC3B 2YT1A 2ELBA 3A98B 1BWNA 2H7DA 4F7GA 2DYNA 2DLWA 3WA0A 2YSZA 1OY2A 4ZRIA 1P3RA 1GC7A 4GMVA 3ZDTA 2KGXB 5J3QA 1B55A 3KRWA 5HE2A 2LKOA 1H10A 5LONB 1WG7A 1X86A 3HQCA 2RVBB 3A8PA 4EJNA 4D0NB 2W2XC 1FAOA 2L1CA 1SHCA 3ODOA 2V76A 3HK0A 1P6SA 1U5GA 3QBVB 1M7EA 2J0MA 1X11A 4HB0B 2CAYA 2P0HA 1V88A 1Z87A 2VRWB 4A5KA 4HDOA 3V5WA 5J3TA 1AQCA 1XX0A 1X1FA 1MPHA 2LG1A 1ZVRA 4H8SA 3FM8C 4K2PA 1W1DA 3PP2A 1UNQA 2E2XA 3NSUA 4KHAA 4HAZB 2K00A 2I1JA 2M14A 4MT7A 2EMTA 5HE1A 2CY4A 1ISNA 3ULBA 2UVMA 1Y19B 2R0DA 3SV1A 1V89A 5HE0A 3PVUA 2MKRA 5D27A 1DDWA 5J3YA 2CY5A 5KQ4A 4IFSA 3GYOA 4HAVB 5CLLB 2DYQA 5D3XA 1FHXA 1U5DA 5DHAB 2X18A 5DHFB 4CYEA 3WYFB 5D3WA 2DA0A 2Y7BA 2K2JA 4XWXA 3SUZA 2DTCA 1SGHA 2COAA 4WJ7A 2H7EA 3MDBC 1V5MA 4WVFB 1OQNA 2D10A 1W1GA 3X23A 1X1GA 3ODXA 2GJYA 3VIAA 5LOPB 2Q13A 2FJLA 1UNRA 2M38A 2P8VA 3TVVA 2D9ZA 3A8QA 2DHKA 1WJ1A 5KQ1A 1QC6A 3T06A 2QKMA 1V5PA 2DHIA 2RSGA 2HE7A 3U8ZA 3U7DA 5JP4A 3TFMA 4HB2B 4B6HA 4K81A 2YVCA 3VOQA 4NSWA 3LJUX 4A6HA 4CHJA 1UPQA 2MWNB 5D3VA 4Z2MB 1IRSA 3O96A 1I2HA 2GCLA 3FSSA 5C5BA 3SO6A 2ROZB 4HDQA 3PVLA 4WSFA 4F7UP 2UZSA 3PEGA 3PG7A 4MK0A 1ZSQA 1GC6A 1UEFA 2KCJA 3F5RA 4GMXB 2YF0A 2MDXA 3SNHA 3DXCA 1DROA 1M7RA 2R09A 1NU2A 3PVWA 1AWEA 4HB3B 3D8FA 2VSZA 1EGXA 1UPRA 4A6FB 1K5GB 3QWMA 5DI9B 2ROVA 2MFQA 1FHOA 1NTYA 1E5WA 1U29A 5EFXA 1UNPA 2XQNM 1XD4A 3M1IB 2P0FA 2L2IA 3P7ZA 1V5UA 1GG3A 1Q67A 1PMSA 2COFA 2AEHA 2EJ8A 5JHGA 1WJMA 1ZM0A 4HHVA 1LW3A 3DXDA 3D8DA 2D2QA 2Y8GA 1K5DB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N3H A;  2GS0 A;  4ZRK A;  2I5F A;  1FGY A;  1V61 A;  3AU4 A;  2ZPY A;  2HTH B;  1WVH A;  1EAZ A;  1W1H A;  3PSC A;  5FI1 A;  2LUL A;  4HAW B;  3DXE A;  1H4R A;  2OQB A;  1I7A A;  2ADZ A;  2EMS A;  4DX9 0;  3CXB B;  2DX5 A;  1PLS A;  4PQ0 A;  2VKI A;  1U2B A;  4GPT B;  5DH9 B;  1EF1 A;  4KVG B;  2RLO A;  5C16 A;  2D4Q A;  4HAT B;  1KZ7 A;  2Z0P A;  3OAN A;  4PNK A;  2YS1 A;  3G9W A;  2J59 M;  5HE3 A;  4MY6 A;  3MPX A;  1ZC4 B;  1X05 A;  2RNR B;  1J19 A;  1U5F A;  3HW2 B;  2D9V A;  3TO1 A;  2W2W A;  2DKQ A;  5CLQ B;  1U5E A;  1FHW A;  1U27 A;  4A6K A;  2DX1 A;  5JLJ B;  4ZRJ A;  4CHM A;  4GXB A;  2COC A;  4K17 A;  2IFS A;  5D3Y A;  2DHJ A;  3TCA A;  4DX8 A;  1PFJ A;  2Z0O A;  1MIX A;  1DBH A;  4KHO A;  1NTV A;  2J0K A;  1WGU A;  2N0Y A;  1XR0 B;  1RJ2 A;  2YS3 A;  3KY9 A;  3D8E A;  5GOW B;  2G35 A;  1XCG A;  2QKL A;  1P5T A;  4YL8 A;  2YS5 A;  4P7I A;  1NI2 A;  3KSY A;  1KZG A;  4Y94 A;  3P6A A;  2COD A;  4GN1 A;  3AJ4 A;  2DN6 A;  3PZD A;  2D9Y A;  4HAU B;  2GCJ A;  2DKP A;  3N7C A;  4GZU A;  3RCP A;  1WI1 A;  3KRX A;  2I5C A;  4NY0 A;  4HAX B;  1TQZ A;  3ULC A;  4BBK A;  2RUK B;  2N23 A;  1BTN A;  1TJ6 A;  5KCV A;  2DFK A;  5C5B B;  1MKE A;  2KUP A;  2AL6 A;  2NMB A;  1Y5O A;  3ML4 A;  3ODW A;  4DBB A;  4IAP A;  1RRP B;  4HB4 B;  4F7H A;  2CRF A;  1LB1 A;  2LOX A;  2YT0 A;  3AU5 A;  2RGN B;  2D9X A;  3ZVR A;  3GYP A;  2LYD A;  2PZ1 A;  4KHB B;  4TYZ A;  3TW1 A;  1XOD A;  2D9W A;  3CIK A;  1BTK A;  1TXD A;  3FEH A;  3SYX A;  2W2X D;  4Z2N A;  2I1K A;  4YON A;  1KI1 B;  5FI0 A;  2OTX A;  4C0A A;  2IYB A;  2D11 A;  1FB8 A;  1DYN A;  1FOE A;  1BAK A;  5L81 A;  2P0D A;  2EC1 A;  1DDV A;  5C79 A;  3BJI A;  3KZ1 A;  4A6F A;  3BIN A;  1EVH A;  1FGZ A;  4K2O A;  1MK9 B;  1OMW A;  2Z0Q A;  3UZT A;  2UZR A;  2J0J A;  4HAY B;  5JHH A;  4TKN A;  1XKE A;  3QIJ A;  2LOZ A;  5C6R A;  2BCJ A;  4DXA B;  3IVF A;  4L6E A;  1QQG A;  1MAI A;  1WGQ A;  4EKU A;  2ELA A;  4EMO A;  4KAX B;  2K2U A;  2YRY A;  1J0W A;  2NZ8 B;  1MK7 B;  1MIZ B;  2JP2 A;  4IOY X;  1DDM A;  2Y8F A;  3F0W A;  5DIF B;  1ZC3 B;  2YT1 A;  2ELB A;  3A98 B;  1BWN A;  2H7D A;  4F7G A;  2DYN A;  2DLW A;  3WA0 A;  2YSZ A;  1OY2 A;  4ZRI A;  1P3R A;  1GC7 A;  4GMV A;  3ZDT A;  2KGX B;  5J3Q A;  1B55 A;  3KRW A;  5HE2 A;  2LKO A;  1H10 A;  5LON B;  1WG7 A;  1X86 A;  3HQC A;  2RVB B;  3A8P A;  4EJN A;  4D0N B;  2W2X C;  1FAO A;  2L1C A;  1SHC A;  3ODO A;  2V76 A;  3HK0 A;  1P6S A;  1U5G A;  3QBV B;  1M7E A;  2J0M A;  1X11 A;  4HB0 B;  2CAY A;  2P0H A;  1V88 A;  1Z87 A;  2VRW B;  4A5K A;  4HDO A;  3V5W A;  5J3T A;  1AQC A;  1XX0 A;  1X1F A;  1MPH A;  2LG1 A;  1ZVR A;  4H8S A;  3FM8 C;  4K2P A;  1W1D A;  3PP2 A;  1UNQ A;  2E2X A;  3NSU A;  4KHA A;  4HAZ B;  2K00 A;  2I1J A;  2M14 A;  4MT7 A;  2EMT A;  5HE1 A;  2CY4 A;  1ISN A;  3ULB A;  2UVM A;  1Y19 B;  2R0D A;  3SV1 A;  1V89 A;  5HE0 A;  3PVU A;  2MKR A;  5D27 A;  1DDW A;  5J3Y A;  2CY5 A;  5KQ4 A;  4IFS A;  3GYO A;  4HAV B;  5CLL B;  2DYQ A;  5D3X A;  1FHX A;  1U5D A;  5DHA B;  2X18 A;  5DHF B;  4CYE A;  3WYF B;  5D3W A;  2DA0 A;  2Y7B A;  2K2J A;  4XWX A;  3SUZ A;  2DTC A;  1SGH A;  2COA A;  4WJ7 A;  2H7E A;  3MDB C;  1V5M A;  4WVF B;  1OQN A;  2D10 A;  1W1G A;  3X23 A;  1X1G A;  3ODX A;  2GJY A;  3VIA A;  5LOP B;  2Q13 A;  2FJL A;  1UNR A;  2M38 A;  2P8V A;  3TVV A;  2D9Z A;  3A8Q A;  2DHK A;  1WJ1 A;  5KQ1 A;  1QC6 A;  3T06 A;  2QKM A;  1V5P A;  2DHI A;  2RSG A;  2HE7 A;  3U8Z A;  3U7D A;  5JP4 A;  3TFM A;  4HB2 B;  4B6H A;  4K81 A;  2YVC A;  3VOQ A;  4NSW A;  3LJU X;  4A6H A;  4CHJ A;  1UPQ A;  2MWN B;  5D3V A;  4Z2M B;  1IRS A;  3O96 A;  1I2H A;  2GCL A;  3FSS A;  5C5B A;  3SO6 A;  2ROZ B;  4HDQ A;  3PVL A;  4WSF A;  4F7U P;  2UZS A;  3PEG A;  3PG7 A;  4MK0 A;  1ZSQ A;  1GC6 A;  1UEF A;  2KCJ A;  3F5R A;  4GMX B;  2YF0 A;  2MDX A;  3SNH A;  3DXC A;  1DRO A;  1M7R A;  2R09 A;  1NU2 A;  3PVW A;  1AWE A;  4HB3 B;  3D8F A;  2VSZ A;  1EGX A;  1UPR A;  4A6F B;  1K5G B;  3QWM A;  5DI9 B;  2ROV A;  2MFQ A;  1FHO A;  1NTY A;  1E5W A;  1U29 A;  5EFX A;  1UNP A;  2XQN M;  1XD4 A;  3M1I B;  2P0F A;  2L2I A;  3P7Z A;  1V5U A;  1GG3 A;  1Q67 A;  1PMS A;  2COF A;  2AEH A;  2EJ8 A;  5JHG A;  1WJM A;  1ZM0 A;  4HHV A;  1LW3 A;  3DXD A;  3D8D A;  2D2Q A;  2Y8G A;  1K5D B; 
#chains in the Genus database with same CATH topology
 1N3H A;  2GS0 A;  4ZRK A;  2I5F A;  1FGY A;  1V61 A;  3AU4 A;  4CSQ A;  2ZPY A;  2HTH B;  1WVH A;  1EAZ A;  1W1H A;  3PSC A;  2KIE A;  5FI1 A;  2LUL A;  4HAW B;  3DXE A;  1H4R A;  2OQB A;  1I7A A;  2ADZ A;  3NWD A;  2EMS A;  4DX9 0;  3CXB B;  2DX5 A;  1PLS A;  4PQ0 A;  2VKI A;  1U2B A;  4GPT B;  5DH9 B;  1EF1 A;  4KVG B;  2RLO A;  5C16 A;  2D4Q A;  4L1R A;  4HAT B;  1KZ7 A;  2Z0P A;  3A58 A;  3OAN A;  2KIG A;  4PNK A;  2YS1 A;  3G9W A;  2J59 M;  5HE3 A;  3OHM B;  4QJ3 B;  4MY6 A;  3MPX A;  1ZC4 B;  1X05 A;  2RNR B;  1J19 A;  3HW2 B;  1U5F A;  2D9V A;  3TO1 A;  2W2W A;  2DKQ A;  2KR0 A;  5CLQ B;  1U5E A;  1FHW A;  1U27 A;  4GOU A;  4A6K A;  2DX1 A;  5JLJ B;  4ZRJ A;  4CHM A;  4GXB A;  2COC A;  4K17 A;  2Z59 A;  2IFS A;  2FJU B;  5D3Y A;  2DHJ A;  2GUM A;  3TCA A;  5LG4 B;  4DX8 A;  1PFJ A;  2Z0O A;  3NWF A;  1MIX A;  1DBH A;  4KHO A;  1NTV A;  2J0K A;  1WGU A;  2N0Y A;  1XR0 B;  1RJ2 A;  2YS3 A;  3KY9 A;  3B77 A;  3D8E A;  5GOW B;  2G35 A;  3U12 A;  1XCG A;  2QKL A;  1P5T A;  4YL8 A;  2YS5 A;  4P7I A;  1NI2 A;  3KSY A;  1KZG A;  4Y94 A;  3P6A A;  5M4Y B;  2COD A;  4GN1 A;  3AJ4 A;  2DN6 A;  3PZD A;  1MI1 A;  2D9Y A;  4HAU B;  2GCJ A;  2DKP A;  2K8E A;  3N7C A;  4GZU A;  5I2S A;  3RCP A;  1WI1 A;  3KRX A;  2I5C A;  2K49 A;  4NY0 A;  4HAX B;  1TQZ A;  3ULC A;  4BBK A;  2RUK B;  2N23 A;  1BTN A;  1TJ6 A;  5KCV A;  2DFK A;  5C5B B;  1MKE A;  2KUP A;  2AL6 A;  2NMB A;  1Y5O A;  3ML4 A;  2KUQ A;  3ODW A;  4D6W A;  4DBB A;  4IAP A;  1T77 A;  1RRP B;  4HB4 B;  4F7H A;  2CRF A;  1LB1 A;  2LOX A;  2YT0 A;  3AU5 A;  2RGN B;  2D9X A;  3ZVR A;  3GYP A;  2LYD A;  2PZ1 A;  4KHB B;  4TYZ A;  3TW1 A;  1XOD A;  4OT1 A;  2D9W A;  3CIK A;  1BTK A;  1TXD A;  3FEH A;  3SYX A;  2W2X D;  4Z2N A;  2I1K A;  4YON A;  1KI1 B;  5FI0 A;  2OTX A;  4C0A A;  2IYB A;  2D11 A;  1FB8 A;  1DYN A;  1FOE A;  1BAK A;  5L81 A;  2P0D A;  2EC1 A;  1DDV A;  5C79 A;  3BJI A;  3KZ1 A;  4A6F A;  3BIN A;  1EVH A;  1FGZ A;  4K2O A;  1MK9 B;  1OMW A;  2Z0Q A;  3UZT A;  2UZR A;  2J0J A;  4HAY B;  5JHH A;  4TKN A;  1XKE A;  3QIJ A;  2LOZ A;  5C6R A;  2BCJ A;  4DXA B;  3IVF A;  4L6E A;  1QQG A;  1MAI A;  1WGQ A;  3FVC A;  4EKU A;  2ELA A;  4EMO A;  4KAX B;  2K2U A;  2YRY A;  1J0W A;  2NZ8 B;  1MK7 B;  1MIZ B;  2JP2 A;  4IOY X;  1DDM A;  2Y8F A;  3F0W A;  5DIF B;  1ZC3 B;  2YT1 A;  2ELB A;  3A98 B;  1BWN A;  2H7D A;  4F7G A;  2DYN A;  2DLW A;  3WA0 A;  2YSZ A;  1OY2 A;  4ZRI A;  2YT2 A;  1P3R A;  1GC7 A;  4GMV A;  3ZDT A;  2KGX B;  5J3Q A;  1B55 A;  3KRW A;  5HE2 A;  2LKO A;  1H10 A;  5LON B;  1WG7 A;  1X86 A;  3HQC A;  2RVB B;  3A8P A;  4EJN A;  4D0N B;  2W2X C;  1FAO A;  2L1C A;  4QJ4 B;  1SHC A;  3ODO A;  2V76 A;  3HK0 A;  1P6S A;  1U5G A;  3QBV B;  1M7E A;  2J0M A;  1X11 A;  4HB0 B;  2Z4D A;  2CAY A;  2P0H A;  1V88 A;  1Z87 A;  2VRW B;  4A5K A;  4HDO A;  3V5W A;  5J3T A;  1AQC A;  1XX0 A;  1X1F A;  1ZYI A;  1MPH A;  2LG1 A;  1ZVR A;  4H8S A;  3FM8 C;  4K2P A;  1W1D A;  3PP2 A;  1UNQ A;  2E2X A;  3NSU A;  4KHA A;  4HAZ B;  2K00 A;  4QXA B;  2I1J A;  2M14 A;  4MT7 A;  2EMT A;  5HE1 A;  2CY4 A;  1ISN A;  3ULB A;  2UVM A;  1Y19 B;  5I2M A;  2R0D A;  3SV1 A;  1V89 A;  5HE0 A;  3PVU A;  2MKR A;  2Z13 A;  5D27 A;  1DDW A;  5J3Y A;  2CY5 A;  5KQ4 A;  3HSA A;  4IFS A;  3GYO A;  4HAV B;  4DIX A;  2NBV A;  5CLL B;  2DYQ A;  5D3X A;  1FHX A;  1U5D A;  5DHA B;  2X18 A;  5DHF B;  4CYE A;  3WYF B;  5D3W A;  2DA0 A;  2RRF A;  2Y7B A;  2K2J A;  4XWX A;  3SUZ A;  2DTC A;  1SGH A;  2COA A;  2ZKM X;  3HIE A;  4WJ7 A;  2H7E A;  3MDB C;  1V5M A;  4WVF B;  1OQN A;  2D10 A;  1W1G A;  3X23 A;  1X1G A;  3ODX A;  2GJY A;  3VIA A;  5LOP B;  4KHB A;  2Q13 A;  2FJL A;  1UNR A;  2M38 A;  2P8V A;  3TVV A;  2D9Z A;  3A8Q A;  2DHK A;  1WJ1 A;  5KQ1 A;  1QC6 A;  3NW8 A;  3T06 A;  2QKM A;  1V5P A;  2DHI A;  2RSG A;  4QJ5 B;  2HE7 A;  3U8Z A;  3U7D A;  5JP4 A;  3TFM A;  4HB2 B;  4B6H A;  4GNK B;  4K81 A;  2YVC A;  3VOQ A;  4NSW A;  3LJU X;  4A6H A;  4CHJ A;  1UPQ A;  5IRS A;  2MWN B;  5D3V A;  4Z2M B;  1IRS A;  3DCX A;  3O96 A;  1I2H A;  2GCL A;  3FSS A;  5C5B A;  3SO6 A;  2ROZ B;  4HDQ A;  4OSN A;  2R2Y A;  3PVL A;  4WSF A;  4F7U P;  2UZS A;  3PEG A;  3PG7 A;  4MK0 A;  2Z14 A;  1ZSQ A;  1GC6 A;  1UEF A;  2KCJ A;  3F5R A;  4GMX B;  2YF0 A;  2MDX A;  3SNH A;  4HSI A;  3DXC A;  1DRO A;  1M7R A;  2R09 A;  1NU2 A;  3PVW A;  1AWE A;  4HB3 B;  3D8F A;  2VSZ A;  1EGX A;  1UPR A;  4A6F B;  1K5G B;  3QWM A;  5DI9 B;  2ROV A;  2MFQ A;  1FHO A;  1NTY A;  1E5W A;  3NWA A;  1U29 A;  5EFX A;  1UNP A;  2XQN M;  1XD4 A;  3M1I B;  2P0F A;  2L2I A;  3P7Z A;  1GG3 A;  1V5U A;  1Q67 A;  1PMS A;  2COF A;  2AEH A;  2EJ8 A;  5JHG A;  1WJM A;  1ZM0 A;  3DXD A;  1LW3 A;  4HHV A;  3D8D A;  2D2Q A;  2Y8G A;  1K5D B; 
#chains in the Genus database with same CATH homology
 1N3H A;  2GS0 A;  4ZRK A;  2I5F A;  1FGY A;  1V61 A;  3AU4 A;  2ZPY A;  2HTH B;  1WVH A;  1EAZ A;  1W1H A;  3PSC A;  5FI1 A;  2LUL A;  4HAW B;  3DXE A;  1H4R A;  2OQB A;  1I7A A;  2ADZ A;  2EMS A;  4DX9 0;  3CXB B;  2DX5 A;  1PLS A;  4PQ0 A;  2VKI A;  1U2B A;  4GPT B;  5DH9 B;  1EF1 A;  4KVG B;  2RLO A;  5C16 A;  2D4Q A;  4HAT B;  1KZ7 A;  2Z0P A;  3OAN A;  4PNK A;  2YS1 A;  3G9W A;  2J59 M;  5HE3 A;  4MY6 A;  3MPX A;  1ZC4 B;  1X05 A;  2RNR B;  1J19 A;  1U5F A;  3HW2 B;  2D9V A;  3TO1 A;  2W2W A;  2DKQ A;  5CLQ B;  1U5E A;  1FHW A;  1U27 A;  4A6K A;  2DX1 A;  5JLJ B;  4ZRJ A;  4CHM A;  4GXB A;  2COC A;  4K17 A;  2IFS A;  5D3Y A;  2DHJ A;  3TCA A;  4DX8 A;  1PFJ A;  2Z0O A;  1MIX A;  1DBH A;  4KHO A;  1NTV A;  2J0K A;  1WGU A;  2N0Y A;  1XR0 B;  1RJ2 A;  2YS3 A;  3KY9 A;  3D8E A;  5GOW B;  2G35 A;  1XCG A;  2QKL A;  1P5T A;  4YL8 A;  2YS5 A;  4P7I A;  1NI2 A;  3KSY A;  1KZG A;  4Y94 A;  3P6A A;  2COD A;  4GN1 A;  3AJ4 A;  2DN6 A;  3PZD A;  2D9Y A;  4HAU B;  2GCJ A;  2DKP A;  3N7C A;  4GZU A;  3RCP A;  1WI1 A;  3KRX A;  2I5C A;  4NY0 A;  4HAX B;  1TQZ A;  3ULC A;  4BBK A;  2RUK B;  2N23 A;  1BTN A;  1TJ6 A;  5KCV A;  2DFK A;  5C5B B;  1MKE A;  2KUP A;  2AL6 A;  2NMB A;  1Y5O A;  3ML4 A;  3ODW A;  4DBB A;  4IAP A;  1RRP B;  4HB4 B;  4F7H A;  2CRF A;  1LB1 A;  2LOX A;  2YT0 A;  3AU5 A;  2RGN B;  2D9X A;  3ZVR A;  3GYP A;  2LYD A;  2PZ1 A;  4KHB B;  4TYZ A;  3TW1 A;  1XOD A;  2D9W A;  3CIK A;  1BTK A;  1TXD A;  3FEH A;  3SYX A;  2W2X D;  4Z2N A;  2I1K A;  4YON A;  1KI1 B;  5FI0 A;  2OTX A;  4C0A A;  2IYB A;  2D11 A;  1FB8 A;  1DYN A;  1FOE A;  1BAK A;  5L81 A;  2P0D A;  2EC1 A;  1DDV A;  5C79 A;  3BJI A;  3KZ1 A;  4A6F A;  3BIN A;  1EVH A;  1FGZ A;  4K2O A;  1MK9 B;  1OMW A;  2Z0Q A;  3UZT A;  2UZR A;  2J0J A;  4HAY B;  5JHH A;  4TKN A;  1XKE A;  3QIJ A;  2LOZ A;  5C6R A;  2BCJ A;  4DXA B;  3IVF A;  4L6E A;  1QQG A;  1MAI A;  1WGQ A;  4EKU A;  2ELA A;  4EMO A;  4KAX B;  2K2U A;  2YRY A;  1J0W A;  2NZ8 B;  1MK7 B;  1MIZ B;  2JP2 A;  4IOY X;  1DDM A;  2Y8F A;  3F0W A;  5DIF B;  1ZC3 B;  2YT1 A;  2ELB A;  3A98 B;  1BWN A;  2H7D A;  4F7G A;  2DYN A;  2DLW A;  3WA0 A;  2YSZ A;  1OY2 A;  4ZRI A;  1P3R A;  1GC7 A;  4GMV A;  3ZDT A;  2KGX B;  5J3Q A;  1B55 A;  3KRW A;  5HE2 A;  2LKO A;  1H10 A;  5LON B;  1WG7 A;  1X86 A;  3HQC A;  2RVB B;  3A8P A;  4EJN A;  4D0N B;  2W2X C;  1FAO A;  2L1C A;  1SHC A;  3ODO A;  2V76 A;  3HK0 A;  1P6S A;  1U5G A;  3QBV B;  1M7E A;  2J0M A;  1X11 A;  4HB0 B;  2CAY A;  2P0H A;  1V88 A;  1Z87 A;  2VRW B;  4A5K A;  4HDO A;  3V5W A;  5J3T A;  1AQC A;  1XX0 A;  1X1F A;  1MPH A;  2LG1 A;  1ZVR A;  4H8S A;  3FM8 C;  4K2P A;  1W1D A;  3PP2 A;  1UNQ A;  2E2X A;  3NSU A;  4KHA A;  4HAZ B;  2K00 A;  2I1J A;  2M14 A;  4MT7 A;  2EMT A;  5HE1 A;  2CY4 A;  1ISN A;  3ULB A;  2UVM A;  1Y19 B;  2R0D A;  3SV1 A;  1V89 A;  5HE0 A;  3PVU A;  2MKR A;  5D27 A;  1DDW A;  5J3Y A;  2CY5 A;  5KQ4 A;  4IFS A;  3GYO A;  4HAV B;  5CLL B;  2DYQ A;  5D3X A;  1FHX A;  1U5D A;  5DHA B;  2X18 A;  5DHF B;  4CYE A;  3WYF B;  5D3W A;  2DA0 A;  2Y7B A;  2K2J A;  4XWX A;  3SUZ A;  2DTC A;  1SGH A;  2COA A;  4WJ7 A;  2H7E A;  3MDB C;  1V5M A;  4WVF B;  1OQN A;  2D10 A;  1W1G A;  3X23 A;  1X1G A;  3ODX A;  2GJY A;  3VIA A;  5LOP B;  2Q13 A;  2FJL A;  1UNR A;  2M38 A;  2P8V A;  3TVV A;  2D9Z A;  3A8Q A;  2DHK A;  1WJ1 A;  5KQ1 A;  1QC6 A;  3T06 A;  2QKM A;  1V5P A;  2DHI A;  2RSG A;  2HE7 A;  3U8Z A;  3U7D A;  5JP4 A;  3TFM A;  4HB2 B;  4B6H A;  4K81 A;  2YVC A;  3VOQ A;  4NSW A;  3LJU X;  4A6H A;  4CHJ A;  1UPQ A;  2MWN B;  5D3V A;  4Z2M B;  1IRS A;  3O96 A;  1I2H A;  2GCL A;  3FSS A;  5C5B A;  3SO6 A;  2ROZ B;  4HDQ A;  3PVL A;  4WSF A;  4F7U P;  2UZS A;  3PEG A;  3PG7 A;  4MK0 A;  1ZSQ A;  1GC6 A;  1UEF A;  2KCJ A;  3F5R A;  4GMX B;  2YF0 A;  2MDX A;  3SNH A;  3DXC A;  1DRO A;  1M7R A;  2R09 A;  1NU2 A;  3PVW A;  1AWE A;  4HB3 B;  3D8F A;  2VSZ A;  1EGX A;  1UPR A;  4A6F B;  1K5G B;  3QWM A;  5DI9 B;  2ROV A;  2MFQ A;  1FHO A;  1NTY A;  1E5W A;  1U29 A;  5EFX A;  1UNP A;  2XQN M;  1XD4 A;  3M1I B;  2P0F A;  2L2I A;  3P7Z A;  1V5U A;  1GG3 A;  1Q67 A;  1PMS A;  2COF A;  2AEH A;  2EJ8 A;  5JHG A;  1WJM A;  1ZM0 A;  4HHV A;  1LW3 A;  3DXD A;  3D8D A;  2D2Q A;  2Y8G A;  1K5D B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...