2DYQA

Crystal structure of the c-terminal phophotyrosine interaction domain of human apbb3
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
130
structure length
124
Chain Sequence
AQKYEALYMGTLPVTKAMGMDVLNEAIGTLTARGDRNAWVPTMLSVSDSLMTAHPIQEEPLWQCPVRLVTFIGVGRDPHTFGLIADLGRQSFQCAAFWCQPHAGGLSEAVQAACMVQYQKCLVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structure of the C-terminal Phophotyrosine Interaction Domain of Human APBB3
rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Amyloid beta A4 precursor protein-binding family B member 3
total genus 25
structure length 124
sequence length 130
ec nomenclature
pdb deposition date 2006-09-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2dyqA00
1PLSA 5CLLB 1V89A 1BAKA 1P3RA 4A6HA 2DN6A 3O96A 4KHBB 4DX90 2N0YA 2DKQA 3DXDA 1UEFA 4HATB 4MK0A 1ZC4B 2AEHA 2DYQA 1OQNA 1X1GA 2JP2A 2MFQA 1V88A 2YS1A 2G35A 1BTNA 1XCGA 4HAYB 1RJ2A 2QKMA 2GCJA 3PVWA 2E2XA 1SGHA 1BTKA 3ML4A 2N23A 5HE1A 2FJLA 4MY6A 1U5FA 3D8DA 1X1FA 4MT7A 3ODXA 3VOQA 2LYDA 2YS3A 5JHGA 1NI2A 4K17A 4HDOA 4PQ0A 1ISNA 5DHFB 3QBVB 1H4RA 1GG3A 2LKOA 5L81A 1TJ6A 3N7CA 2Y8FA 2ZPYA 3DXEA 2UVMA 3HK0A 4ZRKA 1V5UA 3MPXA 2KCJA 2PZ1A 2UZRA 1K5GB 1AWEA 1EF1A 2H7EA 2RGNB 2J0MA 2X18A 1W1DA 1ZM0A 1FB8A 3D8FA 2D4QA 1DDVA 1ZVRA 1DBHA 2YT0A 1WJ1A 1V5PA 2DHIA 1BWNA 3PZDA 4HB3B 2EJ8A 4IOYX 3LJUX 1LB1A 2ELAA 4WJ7A 3HW2B 4HB2B 1XODA 3WA0A 4K2OA 1NTVA 5C5BB 1M7RA 3BINA 3A98B 4D0NB 1TXDA 3GYOA 1DROA 2DHJA 1UNRA 2CRFA 1GC6A 3AU5A 2D9XA 3V5WA 4CHMA 2DKPA 5DIFB 4GPTB 2ADZA 2ROVA 1U5DA 3SO6A 4NY0A 2YSZA 2Z0QA 2RUKB 1WG7A 4ZRJA 2K2JA 1FHXA 1Y19B 4WSFA 1TQZA 2Y7BA 2M38A 4HB4B 1ZC3B 3FEHA 5JP4A 5FI0A 3ULBA 2VRWB 1KZ7A 4HAXB 4H8SA 5DH9B 3RCPA 2K2UA 4YONA 1PFJA 4IAPA 1K5DB 2W2XD 4KHAA 2MWNB 2COFA 2RNRB 1Y5OA 1P6SA 1AQCA 2P0DA 3QWMA 1U5GA 4XWXA 2CODA 3F0WA 3T06A 3FM8C 3ZDTA 2I1KA 1WJMA 1RRPB 1IRSA 2DA0A 4HAZB 4Z2NA 2GS0A 1M7EA 4GN1A 1FHWA 4DX8A 2IFSA 2GJYA 5J3TA 2QKLA 1OMWA 2R09A 5C5BA 2RLOA 1DDWA 1MK7B 2H7DA 4DBBA 3ULCA 1P5TA 1UPQA 4HB0B 4CHJA 2YVCA 3A8QA 2MDXA 2DX1A 3P7ZA 2GCLA 3ODOA 2Q13A 4IFSA 5J3QA 1FAOA 4A6KA 2D10A 3GYPA 1E5WA 1KZGA 1XR0B 4GMVA 2MKRA 4F7GA 2VSZA 1MIZB 3HQCA 4P7IA 4F7HA 1MKEA 2P8VA 4WVFB 5D3WA 2W2WA 3WYFB 5D3YA 3MDBC 3KRXA 5EFXA 1QC6A 4EJNA 3DXCA 2DLWA 1U27A 5DI9B 2YF0A 2HTHB 3U8ZA 1MPHA 1EAZA 4A5KA 2EC1A 3NSUA 3BJIA 3OANA 3SNHA 1I7AA 4Z2MB 1X86A 1FOEA 2XQNM 3M1IB 1X05A 2D9WA 2Z0OA 2RSGA 2EMTA 3P6AA 1V5MA 5KQ4A 2L1CA 1FHOA 1UPRA 5J3YA 2J0JA 4NSWA 3PP2A 5JLJB 2I1JA 1UNPA 3TW1A 1MAIA 3KSYA 4TKNA 1GC7A 2LULA 3PEGA 4C0AA 4K81A 4KVGB 5D3XA 5LONB 1N3HA 1PMSA 2DHKA 2D9VA 5C79A 2K00A 3A8PA 5HE2A 1W1GA 2DYNA 5DHAB 2RVBB 2YRYA 3KRWA 5JHHA 3CXBB 2D9ZA 1J19A 2DTCA 1WVHA 4GMXB 3KZ1A 2AL6A 4TYZA 3UZTA 2M14A 3VIAA 3PSCA 2D2QA 2VKIA 3ZVRA 4Y94A 1SHCA 2Z0PA 3ODWA 3SUZA 1FGZA 1LW3A 1Z87A 2IYBA 3TVVA 3FSSA 1ZSQA 2NZ8B 1KI1B 4EKUA 2P0FA 4DXAB 1Q67A 3CIKA 4HHVA 2NMBA 2UZSA 1FGYA 5KQ1A 5HE3A 4GXBA 3AU4A 4EMOA 2ROZB 2I5CA 1H10A 1NU2A 5C6RA 4A6FB 1WI1A 2D9YA 4KHOA 2DX5A 1MIXA 1U5EA 2DFKA 4CYEA 5FI1A 2COAA 2KUPA 5D27A 2YS5A 2ELBA 1DDMA 5GOWB 2L2IA 3X23A 2J59M 2D11A 3U7DA 4B6HA 4F7UP 2CY4A 3SV1A 2V76A 5KCVA 1MK9B 1WGUA 1B55A 1X11A 2CY5A 5CLQB 3F5RA 4PNKA 4HAVB 2OQBA 1NTYA 2BCJA 1QQGA 2R0DA 1XX0A 1U29A 3TFMA 1XD4A 2I5FA 1OY2A 2KGXB 4K2PA 2J0KA 4HDQA 5D3VA 3TO1A 1J0WA 5LOPB 2LOZA 3SYXA 2P0HA 1XKEA 1W1HA 5C16A 3TCAA 4BBKA 2LG1A 3D8EA 2OTXA 4YL8A 4GZUA 1I2HA 2CAYA 4ZRIA 3KY9A 2YT1A 4A6FA 1EGXA 3PVUA 1U2BA 2Y8GA 1EVHA 1WGQA 3QIJA 3PVLA 2COCA 2LOXA 2EMSA 2W2XC 4HAWB 5HE0A 1UNQA 1DYNA 4L6EA 2HE7A 1V61A 3AJ4A 4HAUB 4KAXB 3G9WA 3PG7A 3IVFA
chains in the Genus database with same CATH superfamily
1PLSA 5CLLB 1V89A 1BAKA 1P3RA 4A6HA 2DN6A 3O96A 4KHBB 4DX90 2N0YA 2DKQA 3DXDA 1UEFA 4HATB 2KR0A 4MK0A 1ZC4B 2AEHA 2DYQA 1OQNA 1X1GA 2JP2A 2MFQA 1V88A 2YS1A 2G35A 5M4YB 1BTNA 1XCGA 4HAYB 1RJ2A 2YT2A 2QKMA 2GCJA 3PVWA 2E2XA 1SGHA 1BTKA 3ML4A 2N23A 3NWDA 5HE1A 2FJUB 2FJLA 4MY6A 1U5FA 3D8DA 1X1FA 4MT7A 3ODXA 3VOQA 2LYDA 2YS3A 5JHGA 1NI2A 4K17A 4HDOA 4PQ0A 1ISNA 5DHFB 3QBVB 1H4RA 1GG3A 2LKOA 5L81A 1ZYIA 1TJ6A 3HIEA 3N7CA 2Y8FA 2ZPYA 3DXEA 2UVMA 3HK0A 3B77A 4ZRKA 1V5UA 3MPXA 2KCJA 2PZ1A 2UZRA 1K5GB 1AWEA 1EF1A 2H7EA 2RGNB 2J0MA 2X18A 1W1DA 1ZM0A 1FB8A 3D8FA 2D4QA 1DDVA 1ZVRA 1DBHA 2YT0A 1WJ1A 1V5PA 2DHIA 1BWNA 3PZDA 4HB3B 2EJ8A 4IOYX 3LJUX 1LB1A 2ELAA 4WJ7A 3HW2B 4HB2B 1XODA 3WA0A 4K2OA 1NTVA 5C5BB 1M7RA 3BINA 3A98B 4D0NB 1TXDA 3NWAA 1T77A 3HSAA 3GYOA 1DROA 2DHJA 1UNRA 2CRFA 1GC6A 3AU5A 2D9XA 3V5WA 4CHMA 2DKPA 5DIFB 4QJ4B 4GPTB 2ADZA 2ROVA 1U5DA 3SO6A 4NY0A 3DCXA 2YSZA 2Z0QA 2RUKB 1WG7A 4ZRJA 2K2JA 1FHXA 4GNKB 1Y19B 4WSFA 1TQZA 2Y7BA 4OT1A 2M38A 4HB4B 1ZC3B 3FEHA 5JP4A 5FI0A 3ULBA 2VRWB 1KZ7A 2NBVA 4HAXB 4H8SA 5DH9B 3RCPA 2K2UA 4YONA 1PFJA 4IAPA 1K5DB 2W2XD 4KHAA 2GUMA 2MWNB 2COFA 2RNRB 1Y5OA 1P6SA 1AQCA 2P0DA 3QWMA 1U5GA 4XWXA 2CODA 3F0WA 3T06A 3FM8C 3ZDTA 2I1KA 1WJMA 1RRPB 1IRSA 2DA0A 5I2SA 4HAZB 4Z2NA 2GS0A 1M7EA 4GN1A 4OSNA 1FHWA 4DX8A 2IFSA 2GJYA 5J3TA 2QKLA 1OMWA 2R09A 5C5BA 2RLOA 1DDWA 1MK7B 2H7DA 4DBBA 3ULCA 1P5TA 1UPQA 4HB0B 2KUQA 4CHJA 2YVCA 3A8QA 2MDXA 2DX1A 2Z59A 3P7ZA 2GCLA 3ODOA 2Q13A 4IFSA 4KHBA 1FAOA 4A6KA 5J3QA 2D10A 3GYPA 1E5WA 1KZGA 1XR0B 4GMVA 2MKRA 4F7GA 2VSZA 1MIZB 3HQCA 4P7IA 4F7HA 1MKEA 2P8VA 4WVFB 5D3WA 2W2WA 3WYFB 5D3YA 3MDBC 3FVCA 3KRXA 5EFXA 1QC6A 4EJNA 3DXCA 2DLWA 1U27A 2KIEA 2ZKMX 5DI9B 2Z4DA 2YF0A 2HTHB 3U12A 3U8ZA 1MPHA 1EAZA 4A5KA 2EC1A 3NSUA 4HSIA 3BJIA 3OANA 3SNHA 1I7AA 4Z2MB 1X86A 1FOEA 2XQNM 3M1IB 1X05A 2D9WA 2Z0OA 2RSGA 2EMTA 3P6AA 1V5MA 5KQ4A 2L1CA 1FHOA 4QXAB 1UPRA 5J3YA 2J0JA 4NSWA 3PP2A 5JLJB 2I1JA 1UNPA 3TW1A 1MAIA 3NW8A 4GOUA 3KSYA 4TKNA 1GC7A 2LULA 3PEGA 4C0AA 4K81A 4KVGB 5D3XA 5LONB 1N3HA 4D6WA 2K49A 1PMSA 2DHKA 2D9VA 5C79A 2K00A 3A8PA 5HE2A 1W1GA 2DYNA 2K8EA 5DHAB 2RVBB 2YRYA 3OHMB 3KRWA 5JHHA 3CXBB 2D9ZA 2RRFA 1J19A 2DTCA 1WVHA 4GMXB 3KZ1A 2AL6A 4TYZA 3UZTA 2M14A 3VIAA 3PSCA 2D2QA 2VKIA 3ZVRA 4Y94A 1SHCA 2Z0PA 3ODWA 3SUZA 1FGZA 2Z14A 1LW3A 1Z87A 2IYBA 3TVVA 3FSSA 2Z13A 1ZSQA 2NZ8B 1KI1B 4EKUA 2P0FA 4DXAB 1Q67A 3CIKA 4HHVA 2NMBA 2UZSA 1FGYA 3NWFA 5KQ1A 5HE3A 4GXBA 3AU4A 4EMOA 2ROZB 2I5CA 4QJ3B 1H10A 1NU2A 5C6RA 4A6FB 1WI1A 2D9YA 4KHOA 2DX5A 1MIXA 1U5EA 2DFKA 4CYEA 5FI1A 2COAA 2KUPA 5D27A 2YS5A 5LG4B 2ELBA 1DDMA 5GOWB 2L2IA 3X23A 2J59M 2D11A 3U7DA 4B6HA 4L1RA 4F7UP 2CY4A 3SV1A 2V76A 5KCVA 1MK9B 1WGUA 1B55A 1X11A 2CY5A 5CLQB 2KIGA 3F5RA 4PNKA 4HAVB 2OQBA 1NTYA 2BCJA 1QQGA 2R0DA 1XX0A 1U29A 3TFMA 1XD4A 2I5FA 1OY2A 2KGXB 5IRSA 4K2PA 2J0KA 4HDQA 4DIXA 5D3VA 3TO1A 1J0WA 5LOPB 2LOZA 3SYXA 2P0HA 1XKEA 5I2MA 1W1HA 5C16A 3TCAA 4BBKA 2LG1A 3D8EA 2OTXA 3A58A 4YL8A 4GZUA 1I2HA 2CAYA 4ZRIA 4CSQA 3KY9A 2YT1A 4A6FA 4QJ5B 1EGXA 3PVUA 1U2BA 2Y8GA 1EVHA 1WGQA 3QIJA 3PVLA 2COCA 2LOXA 2EMSA 2W2XC 4HAWB 5HE0A 1UNQA 1DYNA 4L6EA 2HE7A 1V61A 3AJ4A 4HAUB 4KAXB 2R2YA 3G9WA 1MI1A 3PG7A 3IVFA
chains in the Genus database with same CATH topology
1PLSA 5CLLB 1V89A 1BAKA 1P3RA 4A6HA 2DN6A 3O96A 4KHBB 4DX90 2N0YA 2DKQA 3DXDA 1UEFA 4HATB 4MK0A 1ZC4B 2AEHA 2DYQA 1OQNA 1X1GA 2JP2A 2MFQA 1V88A 2YS1A 2G35A 1BTNA 1XCGA 4HAYB 1RJ2A 2QKMA 2GCJA 3PVWA 2E2XA 1SGHA 1BTKA 3ML4A 2N23A 5HE1A 2FJLA 4MY6A 1U5FA 3D8DA 1X1FA 4MT7A 3ODXA 3VOQA 2LYDA 2YS3A 5JHGA 1NI2A 4K17A 4HDOA 4PQ0A 1ISNA 5DHFB 3QBVB 1H4RA 1GG3A 2LKOA 5L81A 1TJ6A 3N7CA 2Y8FA 2ZPYA 3DXEA 2UVMA 3HK0A 4ZRKA 1V5UA 3MPXA 2KCJA 2PZ1A 2UZRA 1K5GB 1AWEA 1EF1A 2H7EA 2RGNB 2J0MA 2X18A 1W1DA 1ZM0A 1FB8A 3D8FA 2D4QA 1DDVA 1ZVRA 1DBHA 2YT0A 1WJ1A 1V5PA 2DHIA 1BWNA 3PZDA 4HB3B 2EJ8A 4IOYX 3LJUX 1LB1A 2ELAA 4WJ7A 3HW2B 4HB2B 1XODA 3WA0A 4K2OA 1NTVA 5C5BB 1M7RA 3BINA 3A98B 4D0NB 1TXDA 3GYOA 1DROA 2DHJA 1UNRA 2CRFA 1GC6A 3AU5A 2D9XA 3V5WA 4CHMA 2DKPA 5DIFB 4GPTB 2ADZA 2ROVA 1U5DA 3SO6A 4NY0A 2YSZA 2Z0QA 2RUKB 1WG7A 4ZRJA 2K2JA 1FHXA 1Y19B 4WSFA 1TQZA 2Y7BA 2M38A 4HB4B 1ZC3B 3FEHA 5JP4A 5FI0A 3ULBA 2VRWB 1KZ7A 4HAXB 4H8SA 5DH9B 3RCPA 2K2UA 4YONA 1PFJA 4IAPA 1K5DB 2W2XD 4KHAA 2MWNB 2COFA 2RNRB 1Y5OA 1P6SA 1AQCA 2P0DA 3QWMA 1U5GA 4XWXA 2CODA 3F0WA 3T06A 3FM8C 3ZDTA 2I1KA 1WJMA 1RRPB 1IRSA 2DA0A 4HAZB 4Z2NA 2GS0A 1M7EA 4GN1A 1FHWA 4DX8A 2IFSA 2GJYA 5J3TA 2QKLA 1OMWA 2R09A 5C5BA 2RLOA 1DDWA 1MK7B 2H7DA 4DBBA 3ULCA 1P5TA 1UPQA 4HB0B 4CHJA 2YVCA 3A8QA 2MDXA 2DX1A 3P7ZA 2GCLA 3ODOA 2Q13A 4IFSA 5J3QA 1FAOA 4A6KA 2D10A 3GYPA 1E5WA 1KZGA 1XR0B 4GMVA 2MKRA 4F7GA 2VSZA 1MIZB 3HQCA 4P7IA 4F7HA 1MKEA 2P8VA 4WVFB 5D3WA 2W2WA 3WYFB 5D3YA 3MDBC 3KRXA 5EFXA 1QC6A 4EJNA 3DXCA 2DLWA 1U27A 5DI9B 2YF0A 2HTHB 3U8ZA 1MPHA 1EAZA 4A5KA 2EC1A 3NSUA 3BJIA 3OANA 3SNHA 1I7AA 4Z2MB 1X86A 1FOEA 2XQNM 3M1IB 1X05A 2D9WA 2Z0OA 2RSGA 2EMTA 3P6AA 1V5MA 5KQ4A 2L1CA 1FHOA 1UPRA 5J3YA 2J0JA 4NSWA 3PP2A 5JLJB 2I1JA 1UNPA 3TW1A 1MAIA 3KSYA 4TKNA 1GC7A 2LULA 3PEGA 4C0AA 4K81A 4KVGB 5D3XA 5LONB 1N3HA 1PMSA 2DHKA 2D9VA 5C79A 2K00A 3A8PA 5HE2A 1W1GA 2DYNA 5DHAB 2RVBB 2YRYA 3KRWA 5JHHA 3CXBB 2D9ZA 1J19A 2DTCA 1WVHA 4GMXB 3KZ1A 2AL6A 4TYZA 3UZTA 2M14A 3VIAA 3PSCA 2D2QA 2VKIA 3ZVRA 4Y94A 1SHCA 2Z0PA 3ODWA 3SUZA 1FGZA 1LW3A 1Z87A 2IYBA 3TVVA 3FSSA 1ZSQA 2NZ8B 1KI1B 4EKUA 2P0FA 4DXAB 1Q67A 3CIKA 4HHVA 2NMBA 2UZSA 1FGYA 5KQ1A 5HE3A 4GXBA 3AU4A 4EMOA 2ROZB 2I5CA 1H10A 1NU2A 5C6RA 4A6FB 1WI1A 2D9YA 4KHOA 2DX5A 1MIXA 1U5EA 2DFKA 4CYEA 5FI1A 2COAA 2KUPA 5D27A 2YS5A 2ELBA 1DDMA 5GOWB 2L2IA 3X23A 2J59M 2D11A 3U7DA 4B6HA 4F7UP 2CY4A 3SV1A 2V76A 5KCVA 1MK9B 1WGUA 1B55A 1X11A 2CY5A 5CLQB 3F5RA 4PNKA 4HAVB 2OQBA 1NTYA 2BCJA 1QQGA 2R0DA 1XX0A 1U29A 3TFMA 1XD4A 2I5FA 1OY2A 2KGXB 4K2PA 2J0KA 4HDQA 5D3VA 3TO1A 1J0WA 5LOPB 2LOZA 3SYXA 2P0HA 1XKEA 1W1HA 5C16A 3TCAA 4BBKA 2LG1A 3D8EA 2OTXA 4YL8A 4GZUA 1I2HA 2CAYA 4ZRIA 3KY9A 2YT1A 4A6FA 1EGXA 3PVUA 1U2BA 2Y8GA 1EVHA 1WGQA 3QIJA 3PVLA 2COCA 2LOXA 2EMSA 2W2XC 4HAWB 5HE0A 1UNQA 1DYNA 4L6EA 2HE7A 1V61A 3AJ4A 4HAUB 4KAXB 3G9WA 3PG7A 3IVFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PLS A;  5CLL B;  1V89 A;  1BAK A;  1P3R A;  4A6H A;  2DN6 A;  3O96 A;  4KHB B;  4DX9 0;  2N0Y A;  2DKQ A;  3DXD A;  1UEF A;  4HAT B;  4MK0 A;  1ZC4 B;  2AEH A;  2DYQ A;  1OQN A;  1X1G A;  2JP2 A;  2MFQ A;  1V88 A;  2YS1 A;  2G35 A;  1BTN A;  1XCG A;  4HAY B;  1RJ2 A;  2QKM A;  2GCJ A;  3PVW A;  2E2X A;  1SGH A;  1BTK A;  3ML4 A;  2N23 A;  5HE1 A;  2FJL A;  4MY6 A;  1U5F A;  3D8D A;  1X1F A;  4MT7 A;  3ODX A;  3VOQ A;  2LYD A;  2YS3 A;  5JHG A;  1NI2 A;  4K17 A;  4HDO A;  4PQ0 A;  1ISN A;  5DHF B;  3QBV B;  1H4R A;  1GG3 A;  2LKO A;  5L81 A;  1TJ6 A;  3N7C A;  2Y8F A;  2ZPY A;  3DXE A;  2UVM A;  3HK0 A;  4ZRK A;  1V5U A;  3MPX A;  2KCJ A;  2PZ1 A;  2UZR A;  1K5G B;  1AWE A;  1EF1 A;  2H7E A;  2RGN B;  2J0M A;  2X18 A;  1W1D A;  1ZM0 A;  1FB8 A;  3D8F A;  2D4Q A;  1DDV A;  1ZVR A;  1DBH A;  2YT0 A;  1WJ1 A;  1V5P A;  2DHI A;  1BWN A;  3PZD A;  4HB3 B;  2EJ8 A;  4IOY X;  3LJU X;  1LB1 A;  2ELA A;  4WJ7 A;  3HW2 B;  4HB2 B;  1XOD A;  3WA0 A;  4K2O A;  1NTV A;  5C5B B;  1M7R A;  3BIN A;  3A98 B;  4D0N B;  1TXD A;  3GYO A;  1DRO A;  2DHJ A;  1UNR A;  2CRF A;  1GC6 A;  3AU5 A;  2D9X A;  3V5W A;  4CHM A;  2DKP A;  5DIF B;  4GPT B;  2ADZ A;  2ROV A;  1U5D A;  3SO6 A;  4NY0 A;  2YSZ A;  2Z0Q A;  2RUK B;  1WG7 A;  4ZRJ A;  2K2J A;  1FHX A;  1Y19 B;  4WSF A;  1TQZ A;  2Y7B A;  2M38 A;  4HB4 B;  1ZC3 B;  3FEH A;  5JP4 A;  5FI0 A;  3ULB A;  2VRW B;  1KZ7 A;  4HAX B;  4H8S A;  5DH9 B;  3RCP A;  2K2U A;  4YON A;  1PFJ A;  4IAP A;  1K5D B;  2W2X D;  4KHA A;  2MWN B;  2COF A;  2RNR B;  1Y5O A;  1P6S A;  1AQC A;  2P0D A;  3QWM A;  1U5G A;  4XWX A;  2COD A;  3F0W A;  3T06 A;  3FM8 C;  3ZDT A;  2I1K A;  1WJM A;  1RRP B;  1IRS A;  2DA0 A;  4HAZ B;  4Z2N A;  2GS0 A;  1M7E A;  4GN1 A;  1FHW A;  4DX8 A;  2IFS A;  2GJY A;  5J3T A;  2QKL A;  1OMW A;  2R09 A;  5C5B A;  2RLO A;  1DDW A;  1MK7 B;  2H7D A;  4DBB A;  3ULC A;  1P5T A;  1UPQ A;  4HB0 B;  4CHJ A;  2YVC A;  3A8Q A;  2MDX A;  2DX1 A;  3P7Z A;  2GCL A;  3ODO A;  2Q13 A;  4IFS A;  5J3Q A;  1FAO A;  4A6K A;  2D10 A;  3GYP A;  1E5W A;  1KZG A;  1XR0 B;  4GMV A;  2MKR A;  4F7G A;  2VSZ A;  1MIZ B;  3HQC A;  4P7I A;  4F7H A;  1MKE A;  2P8V A;  4WVF B;  5D3W A;  2W2W A;  3WYF B;  5D3Y A;  3MDB C;  3KRX A;  5EFX A;  1QC6 A;  4EJN A;  3DXC A;  2DLW A;  1U27 A;  5DI9 B;  2YF0 A;  2HTH B;  3U8Z A;  1MPH A;  1EAZ A;  4A5K A;  2EC1 A;  3NSU A;  3BJI A;  3OAN A;  3SNH A;  1I7A A;  4Z2M B;  1X86 A;  1FOE A;  2XQN M;  3M1I B;  1X05 A;  2D9W A;  2Z0O A;  2RSG A;  2EMT A;  3P6A A;  1V5M A;  5KQ4 A;  2L1C A;  1FHO A;  1UPR A;  5J3Y A;  2J0J A;  4NSW A;  3PP2 A;  5JLJ B;  2I1J A;  1UNP A;  3TW1 A;  1MAI A;  3KSY A;  4TKN A;  1GC7 A;  2LUL A;  3PEG A;  4C0A A;  4K81 A;  4KVG B;  5D3X A;  5LON B;  1N3H A;  1PMS A;  2DHK A;  2D9V A;  5C79 A;  2K00 A;  3A8P A;  5HE2 A;  1W1G A;  2DYN A;  5DHA B;  2RVB B;  2YRY A;  3KRW A;  5JHH A;  3CXB B;  2D9Z A;  1J19 A;  2DTC A;  1WVH A;  4GMX B;  3KZ1 A;  2AL6 A;  4TYZ A;  3UZT A;  2M14 A;  3VIA A;  3PSC A;  2D2Q A;  2VKI A;  3ZVR A;  4Y94 A;  1SHC A;  2Z0P A;  3ODW A;  3SUZ A;  1FGZ A;  1LW3 A;  1Z87 A;  2IYB A;  3TVV A;  3FSS A;  1ZSQ A;  2NZ8 B;  1KI1 B;  4EKU A;  2P0F A;  4DXA B;  1Q67 A;  3CIK A;  4HHV A;  2NMB A;  2UZS A;  1FGY A;  5KQ1 A;  5HE3 A;  4GXB A;  3AU4 A;  4EMO A;  2ROZ B;  2I5C A;  1H10 A;  1NU2 A;  5C6R A;  4A6F B;  1WI1 A;  2D9Y A;  4KHO A;  2DX5 A;  1MIX A;  1U5E A;  2DFK A;  4CYE A;  5FI1 A;  2COA A;  2KUP A;  5D27 A;  2YS5 A;  2ELB A;  1DDM A;  5GOW B;  2L2I A;  3X23 A;  2J59 M;  2D11 A;  3U7D A;  4B6H A;  4F7U P;  2CY4 A;  3SV1 A;  2V76 A;  5KCV A;  1MK9 B;  1WGU A;  1B55 A;  1X11 A;  2CY5 A;  5CLQ B;  3F5R A;  4PNK A;  4HAV B;  2OQB A;  1NTY A;  2BCJ A;  1QQG A;  2R0D A;  1XX0 A;  1U29 A;  3TFM A;  1XD4 A;  2I5F A;  1OY2 A;  2KGX B;  4K2P A;  2J0K A;  4HDQ A;  5D3V A;  3TO1 A;  1J0W A;  5LOP B;  2LOZ A;  3SYX A;  2P0H A;  1XKE A;  1W1H A;  5C16 A;  3TCA A;  4BBK A;  2LG1 A;  3D8E A;  2OTX A;  4YL8 A;  4GZU A;  1I2H A;  2CAY A;  4ZRI A;  3KY9 A;  2YT1 A;  4A6F A;  1EGX A;  3PVU A;  1U2B A;  2Y8G A;  1EVH A;  1WGQ A;  3QIJ A;  3PVL A;  2COC A;  2LOX A;  2EMS A;  2W2X C;  4HAW B;  5HE0 A;  1UNQ A;  1DYN A;  4L6E A;  2HE7 A;  1V61 A;  3AJ4 A;  4HAU B;  4KAX B;  3G9W A;  3PG7 A;  3IVF A; 
#chains in the Genus database with same CATH topology
 1PLS A;  5CLL B;  1V89 A;  1BAK A;  1P3R A;  4A6H A;  2DN6 A;  3O96 A;  4KHB B;  4DX9 0;  2N0Y A;  2DKQ A;  3DXD A;  1UEF A;  4HAT B;  2KR0 A;  4MK0 A;  1ZC4 B;  2AEH A;  2DYQ A;  1OQN A;  1X1G A;  2JP2 A;  2MFQ A;  1V88 A;  2YS1 A;  2G35 A;  5M4Y B;  1BTN A;  1XCG A;  4HAY B;  1RJ2 A;  2YT2 A;  2QKM A;  2GCJ A;  3PVW A;  2E2X A;  1SGH A;  1BTK A;  3ML4 A;  2N23 A;  3NWD A;  5HE1 A;  2FJU B;  2FJL A;  4MY6 A;  1U5F A;  3D8D A;  1X1F A;  4MT7 A;  3ODX A;  3VOQ A;  2LYD A;  2YS3 A;  5JHG A;  1NI2 A;  4K17 A;  4HDO A;  4PQ0 A;  1ISN A;  5DHF B;  3QBV B;  1H4R A;  1GG3 A;  2LKO A;  5L81 A;  1ZYI A;  1TJ6 A;  3HIE A;  3N7C A;  2Y8F A;  2ZPY A;  3DXE A;  2UVM A;  3HK0 A;  3B77 A;  4ZRK A;  1V5U A;  3MPX A;  2KCJ A;  2PZ1 A;  2UZR A;  1K5G B;  1AWE A;  1EF1 A;  2H7E A;  2RGN B;  2J0M A;  2X18 A;  1W1D A;  1ZM0 A;  1FB8 A;  3D8F A;  2D4Q A;  1DDV A;  1ZVR A;  1DBH A;  2YT0 A;  1WJ1 A;  1V5P A;  2DHI A;  1BWN A;  3PZD A;  4HB3 B;  2EJ8 A;  4IOY X;  3LJU X;  1LB1 A;  2ELA A;  4WJ7 A;  3HW2 B;  4HB2 B;  1XOD A;  3WA0 A;  4K2O A;  1NTV A;  5C5B B;  1M7R A;  3BIN A;  3A98 B;  4D0N B;  1TXD A;  3NWA A;  1T77 A;  3HSA A;  3GYO A;  1DRO A;  2DHJ A;  1UNR A;  2CRF A;  1GC6 A;  3AU5 A;  2D9X A;  3V5W A;  4CHM A;  2DKP A;  5DIF B;  4QJ4 B;  4GPT B;  2ADZ A;  2ROV A;  1U5D A;  3SO6 A;  4NY0 A;  3DCX A;  2YSZ A;  2Z0Q A;  2RUK B;  1WG7 A;  4ZRJ A;  2K2J A;  1FHX A;  4GNK B;  1Y19 B;  4WSF A;  1TQZ A;  2Y7B A;  4OT1 A;  2M38 A;  4HB4 B;  1ZC3 B;  3FEH A;  5JP4 A;  5FI0 A;  3ULB A;  2VRW B;  1KZ7 A;  2NBV A;  4HAX B;  4H8S A;  5DH9 B;  3RCP A;  2K2U A;  4YON A;  1PFJ A;  4IAP A;  1K5D B;  2W2X D;  4KHA A;  2GUM A;  2MWN B;  2COF A;  2RNR B;  1Y5O A;  1P6S A;  1AQC A;  2P0D A;  3QWM A;  1U5G A;  4XWX A;  2COD A;  3F0W A;  3T06 A;  3FM8 C;  3ZDT A;  2I1K A;  1WJM A;  1RRP B;  1IRS A;  2DA0 A;  5I2S A;  4HAZ B;  4Z2N A;  2GS0 A;  1M7E A;  4GN1 A;  4OSN A;  1FHW A;  4DX8 A;  2IFS A;  2GJY A;  5J3T A;  2QKL A;  1OMW A;  2R09 A;  5C5B A;  2RLO A;  1DDW A;  1MK7 B;  2H7D A;  4DBB A;  3ULC A;  1P5T A;  1UPQ A;  4HB0 B;  2KUQ A;  4CHJ A;  2YVC A;  3A8Q A;  2MDX A;  2DX1 A;  2Z59 A;  3P7Z A;  2GCL A;  3ODO A;  2Q13 A;  4IFS A;  4KHB A;  1FAO A;  4A6K A;  5J3Q A;  2D10 A;  3GYP A;  1E5W A;  1KZG A;  1XR0 B;  4GMV A;  2MKR A;  4F7G A;  2VSZ A;  1MIZ B;  3HQC A;  4P7I A;  4F7H A;  1MKE A;  2P8V A;  4WVF B;  5D3W A;  2W2W A;  3WYF B;  5D3Y A;  3MDB C;  3FVC A;  3KRX A;  5EFX A;  1QC6 A;  4EJN A;  3DXC A;  2DLW A;  1U27 A;  2KIE A;  2ZKM X;  5DI9 B;  2Z4D A;  2YF0 A;  2HTH B;  3U12 A;  3U8Z A;  1MPH A;  1EAZ A;  4A5K A;  2EC1 A;  3NSU A;  4HSI A;  3BJI A;  3OAN A;  3SNH A;  1I7A A;  4Z2M B;  1X86 A;  1FOE A;  2XQN M;  3M1I B;  1X05 A;  2D9W A;  2Z0O A;  2RSG A;  2EMT A;  3P6A A;  1V5M A;  5KQ4 A;  2L1C A;  1FHO A;  4QXA B;  1UPR A;  5J3Y A;  2J0J A;  4NSW A;  3PP2 A;  5JLJ B;  2I1J A;  1UNP A;  3TW1 A;  1MAI A;  3NW8 A;  4GOU A;  3KSY A;  4TKN A;  1GC7 A;  2LUL A;  3PEG A;  4C0A A;  4K81 A;  4KVG B;  5D3X A;  5LON B;  1N3H A;  4D6W A;  2K49 A;  1PMS A;  2DHK A;  2D9V A;  5C79 A;  2K00 A;  3A8P A;  5HE2 A;  1W1G A;  2DYN A;  2K8E A;  5DHA B;  2RVB B;  2YRY A;  3OHM B;  3KRW A;  5JHH A;  3CXB B;  2D9Z A;  2RRF A;  1J19 A;  2DTC A;  1WVH A;  4GMX B;  3KZ1 A;  2AL6 A;  4TYZ A;  3UZT A;  2M14 A;  3VIA A;  3PSC A;  2D2Q A;  2VKI A;  3ZVR A;  4Y94 A;  1SHC A;  2Z0P A;  3ODW A;  3SUZ A;  1FGZ A;  2Z14 A;  1LW3 A;  1Z87 A;  2IYB A;  3TVV A;  3FSS A;  2Z13 A;  1ZSQ A;  2NZ8 B;  1KI1 B;  4EKU A;  2P0F A;  4DXA B;  1Q67 A;  3CIK A;  4HHV A;  2NMB A;  2UZS A;  1FGY A;  3NWF A;  5KQ1 A;  5HE3 A;  4GXB A;  3AU4 A;  4EMO A;  2ROZ B;  2I5C A;  4QJ3 B;  1H10 A;  1NU2 A;  5C6R A;  4A6F B;  1WI1 A;  2D9Y A;  4KHO A;  2DX5 A;  1MIX A;  1U5E A;  2DFK A;  4CYE A;  5FI1 A;  2COA A;  2KUP A;  5D27 A;  2YS5 A;  5LG4 B;  2ELB A;  1DDM A;  5GOW B;  2L2I A;  3X23 A;  2J59 M;  2D11 A;  3U7D A;  4B6H A;  4L1R A;  4F7U P;  2CY4 A;  3SV1 A;  2V76 A;  5KCV A;  1MK9 B;  1WGU A;  1B55 A;  1X11 A;  2CY5 A;  5CLQ B;  2KIG A;  3F5R A;  4PNK A;  4HAV B;  2OQB A;  1NTY A;  2BCJ A;  1QQG A;  2R0D A;  1XX0 A;  1U29 A;  3TFM A;  1XD4 A;  2I5F A;  1OY2 A;  2KGX B;  5IRS A;  4K2P A;  2J0K A;  4HDQ A;  4DIX A;  5D3V A;  3TO1 A;  1J0W A;  5LOP B;  2LOZ A;  3SYX A;  2P0H A;  1XKE A;  5I2M A;  1W1H A;  5C16 A;  3TCA A;  4BBK A;  2LG1 A;  3D8E A;  2OTX A;  3A58 A;  4YL8 A;  4GZU A;  1I2H A;  2CAY A;  4ZRI A;  4CSQ A;  3KY9 A;  2YT1 A;  4A6F A;  4QJ5 B;  1EGX A;  3PVU A;  1U2B A;  2Y8G A;  1EVH A;  1WGQ A;  3QIJ A;  3PVL A;  2COC A;  2LOX A;  2EMS A;  2W2X C;  4HAW B;  5HE0 A;  1UNQ A;  1DYN A;  4L6E A;  2HE7 A;  1V61 A;  3AJ4 A;  4HAU B;  4KAX B;  2R2Y A;  3G9W A;  1MI1 A;  3PG7 A;  3IVF A; 
#chains in the Genus database with same CATH homology
 1PLS A;  5CLL B;  1V89 A;  1BAK A;  1P3R A;  4A6H A;  2DN6 A;  3O96 A;  4KHB B;  4DX9 0;  2N0Y A;  2DKQ A;  3DXD A;  1UEF A;  4HAT B;  4MK0 A;  1ZC4 B;  2AEH A;  2DYQ A;  1OQN A;  1X1G A;  2JP2 A;  2MFQ A;  1V88 A;  2YS1 A;  2G35 A;  1BTN A;  1XCG A;  4HAY B;  1RJ2 A;  2QKM A;  2GCJ A;  3PVW A;  2E2X A;  1SGH A;  1BTK A;  3ML4 A;  2N23 A;  5HE1 A;  2FJL A;  4MY6 A;  1U5F A;  3D8D A;  1X1F A;  4MT7 A;  3ODX A;  3VOQ A;  2LYD A;  2YS3 A;  5JHG A;  1NI2 A;  4K17 A;  4HDO A;  4PQ0 A;  1ISN A;  5DHF B;  3QBV B;  1H4R A;  1GG3 A;  2LKO A;  5L81 A;  1TJ6 A;  3N7C A;  2Y8F A;  2ZPY A;  3DXE A;  2UVM A;  3HK0 A;  4ZRK A;  1V5U A;  3MPX A;  2KCJ A;  2PZ1 A;  2UZR A;  1K5G B;  1AWE A;  1EF1 A;  2H7E A;  2RGN B;  2J0M A;  2X18 A;  1W1D A;  1ZM0 A;  1FB8 A;  3D8F A;  2D4Q A;  1DDV A;  1ZVR A;  1DBH A;  2YT0 A;  1WJ1 A;  1V5P A;  2DHI A;  1BWN A;  3PZD A;  4HB3 B;  2EJ8 A;  4IOY X;  3LJU X;  1LB1 A;  2ELA A;  4WJ7 A;  3HW2 B;  4HB2 B;  1XOD A;  3WA0 A;  4K2O A;  1NTV A;  5C5B B;  1M7R A;  3BIN A;  3A98 B;  4D0N B;  1TXD A;  3GYO A;  1DRO A;  2DHJ A;  1UNR A;  2CRF A;  1GC6 A;  3AU5 A;  2D9X A;  3V5W A;  4CHM A;  2DKP A;  5DIF B;  4GPT B;  2ADZ A;  2ROV A;  1U5D A;  3SO6 A;  4NY0 A;  2YSZ A;  2Z0Q A;  2RUK B;  1WG7 A;  4ZRJ A;  2K2J A;  1FHX A;  1Y19 B;  4WSF A;  1TQZ A;  2Y7B A;  2M38 A;  4HB4 B;  1ZC3 B;  3FEH A;  5JP4 A;  5FI0 A;  3ULB A;  2VRW B;  1KZ7 A;  4HAX B;  4H8S A;  5DH9 B;  3RCP A;  2K2U A;  4YON A;  1PFJ A;  4IAP A;  1K5D B;  2W2X D;  4KHA A;  2MWN B;  2COF A;  2RNR B;  1Y5O A;  1P6S A;  1AQC A;  2P0D A;  3QWM A;  1U5G A;  4XWX A;  2COD A;  3F0W A;  3T06 A;  3FM8 C;  3ZDT A;  2I1K A;  1WJM A;  1RRP B;  1IRS A;  2DA0 A;  4HAZ B;  4Z2N A;  2GS0 A;  1M7E A;  4GN1 A;  1FHW A;  4DX8 A;  2IFS A;  2GJY A;  5J3T A;  2QKL A;  1OMW A;  2R09 A;  5C5B A;  2RLO A;  1DDW A;  1MK7 B;  2H7D A;  4DBB A;  3ULC A;  1P5T A;  1UPQ A;  4HB0 B;  4CHJ A;  2YVC A;  3A8Q A;  2MDX A;  2DX1 A;  3P7Z A;  2GCL A;  3ODO A;  2Q13 A;  4IFS A;  5J3Q A;  1FAO A;  4A6K A;  2D10 A;  3GYP A;  1E5W A;  1KZG A;  1XR0 B;  4GMV A;  2MKR A;  4F7G A;  2VSZ A;  1MIZ B;  3HQC A;  4P7I A;  4F7H A;  1MKE A;  2P8V A;  4WVF B;  5D3W A;  2W2W A;  3WYF B;  5D3Y A;  3MDB C;  3KRX A;  5EFX A;  1QC6 A;  4EJN A;  3DXC A;  2DLW A;  1U27 A;  5DI9 B;  2YF0 A;  2HTH B;  3U8Z A;  1MPH A;  1EAZ A;  4A5K A;  2EC1 A;  3NSU A;  3BJI A;  3OAN A;  3SNH A;  1I7A A;  4Z2M B;  1X86 A;  1FOE A;  2XQN M;  3M1I B;  1X05 A;  2D9W A;  2Z0O A;  2RSG A;  2EMT A;  3P6A A;  1V5M A;  5KQ4 A;  2L1C A;  1FHO A;  1UPR A;  5J3Y A;  2J0J A;  4NSW A;  3PP2 A;  5JLJ B;  2I1J A;  1UNP A;  3TW1 A;  1MAI A;  3KSY A;  4TKN A;  1GC7 A;  2LUL A;  3PEG A;  4C0A A;  4K81 A;  4KVG B;  5D3X A;  5LON B;  1N3H A;  1PMS A;  2DHK A;  2D9V A;  5C79 A;  2K00 A;  3A8P A;  5HE2 A;  1W1G A;  2DYN A;  5DHA B;  2RVB B;  2YRY A;  3KRW A;  5JHH A;  3CXB B;  2D9Z A;  1J19 A;  2DTC A;  1WVH A;  4GMX B;  3KZ1 A;  2AL6 A;  4TYZ A;  3UZT A;  2M14 A;  3VIA A;  3PSC A;  2D2Q A;  2VKI A;  3ZVR A;  4Y94 A;  1SHC A;  2Z0P A;  3ODW A;  3SUZ A;  1FGZ A;  1LW3 A;  1Z87 A;  2IYB A;  3TVV A;  3FSS A;  1ZSQ A;  2NZ8 B;  1KI1 B;  4EKU A;  2P0F A;  4DXA B;  1Q67 A;  3CIK A;  4HHV A;  2NMB A;  2UZS A;  1FGY A;  5KQ1 A;  5HE3 A;  4GXB A;  3AU4 A;  4EMO A;  2ROZ B;  2I5C A;  1H10 A;  1NU2 A;  5C6R A;  4A6F B;  1WI1 A;  2D9Y A;  4KHO A;  2DX5 A;  1MIX A;  1U5E A;  2DFK A;  4CYE A;  5FI1 A;  2COA A;  2KUP A;  5D27 A;  2YS5 A;  2ELB A;  1DDM A;  5GOW B;  2L2I A;  3X23 A;  2J59 M;  2D11 A;  3U7D A;  4B6H A;  4F7U P;  2CY4 A;  3SV1 A;  2V76 A;  5KCV A;  1MK9 B;  1WGU A;  1B55 A;  1X11 A;  2CY5 A;  5CLQ B;  3F5R A;  4PNK A;  4HAV B;  2OQB A;  1NTY A;  2BCJ A;  1QQG A;  2R0D A;  1XX0 A;  1U29 A;  3TFM A;  1XD4 A;  2I5F A;  1OY2 A;  2KGX B;  4K2P A;  2J0K A;  4HDQ A;  5D3V A;  3TO1 A;  1J0W A;  5LOP B;  2LOZ A;  3SYX A;  2P0H A;  1XKE A;  1W1H A;  5C16 A;  3TCA A;  4BBK A;  2LG1 A;  3D8E A;  2OTX A;  4YL8 A;  4GZU A;  1I2H A;  2CAY A;  4ZRI A;  3KY9 A;  2YT1 A;  4A6F A;  1EGX A;  3PVU A;  1U2B A;  2Y8G A;  1EVH A;  1WGQ A;  3QIJ A;  3PVL A;  2COC A;  2LOX A;  2EMS A;  2W2X C;  4HAW B;  5HE0 A;  1UNQ A;  1DYN A;  4L6E A;  2HE7 A;  1V61 A;  3AJ4 A;  4HAU B;  4KAX B;  3G9W A;  3PG7 A;  3IVF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...