2DYQA

Crystal structure of the c-terminal phophotyrosine interaction domain of human apbb3
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
130
structure length
124
Chain Sequence
AQKYEALYMGTLPVTKAMGMDVLNEAIGTLTARGDRNAWVPTMLSVSDSLMTAHPIQEEPLWQCPVRLVTFIGVGRDPHTFGLIADLGRQSFQCAAFWCQPHAGGLSEAVQAACMVQYQKCLVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Amyloid beta A4 precursor protein-binding family B member 3
publication title Crystal Structure of the C-terminal Phophotyrosine Interaction Domain of Human APBB3
rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 25
structure length 124
sequence length 130
ec nomenclature
pdb deposition date 2006-09-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2dyqA00
2UVMA 3LJUX 4TKNA 3FEHA 4Y94A 4HB3B 1BTKA 2UZSA 2EMSA 2CAYA 3ULBA 5FI1A 2R09A 3VOQA 5C5BA 1WGQA 2EJ8A 4KHAA 3PSCA 4IOYX 5DHAB 5JHHA 3FM8C 3F5RA 2AEHA 1GC7A 4YONA 2E2XA 2LKOA 1W1GA 4HB2B 1KI1B 2L2IA 2YT1A 3F0WA 2DYNA 3AU4A 2L1CA 1DROA 1OMWA 4KVGB 4HAYB 2FJLA 1M7RA 4HB4B 3UZTA 2KCJA 2RLOA 2RSGA 4B6HA 1I7AA 1W1DA 2Z0QA 3T06A 1WJMA 1EVHA 2PZ1A 1UPRA 1U27A 4A6FA 2CRFA 3CIKA 3RCPA 2VSZA 1WG7A 2DHJA 2DKQA 4WSFA 1XODA 5J3TA 4D0NB 2LOZA 2N0YA 2P0DA 1EF1A 1X11A 5D27A 2RGNB 3AJ4A 4TYZA 1NTVA 2H7DA 1IRSA 4KAXB 5KCVA 5EFXA 1KZGA 1V88A 4K2OA 3SV1A 2MKRA 2DX1A 2I5FA 3TFMA 3X23A 3D8EA 3SNHA 4HDOA 5L81A 2ELAA 3FSSA 2W2WA 1FHOA 2I5CA 2YS1A 1E5WA 3TW1A 4DXAB 1MK7B 4HAUB 4MT7A 4DX90 2ZPYA 1QC6A 3P6AA 1SGHA 5HE1A 2YVCA 4DBBA 4HAZB 2MFQA 2H7EA 1P3RA 1NTYA 1OQNA 5D3YA 3PEGA 3U7DA 2Y7BA 4A5KA 5KQ1A 1UNRA 3BINA 3WYFB 2W2XD 4C0AA 1KZ7A 2J59M 4XWXA 5HE0A 2VKIA 2QKLA 3TVVA 5LOPB 2YRYA 2CY4A 5D3VA 1GG3A 3O96A 3HQCA 1AWEA 2YS5A 2K2JA 3D8FA 1X05A 4GZUA 1TJ6A 1XR0B 2R0DA 5DIFB 1Z87A 1U5FA 1FOEA 2D10A 3GYPA 5HE2A 5CLLB 2AL6A 1U5EA 2YF0A 5D3WA 1PLSA 1DYNA 2DHKA 2P8VA 1B55A 4F7HA 3QBVB 1NU2A 3DXDA 1UNPA 4IFSA 2KGXB 1QQGA 1MIXA 4EJNA 4L6EA 2IYBA 1LW3A 5J3YA 4GMXB 1XX0A 1ZSQA 4HB0B 4YL8A 1AQCA 3KRWA 2J0KA 4MK0A 1TXDA 4CHJA 2X18A 4A6HA 3PP2A 5C6RA 2YSZA 4WJ7A 3ODXA 3VIAA 5JHGA 3KZ1A 2KUPA 1WVHA 2VRWB 4IAPA 4ZRIA 4GN1A 2XQNM 2Y8FA 2D9XA 1EAZA 2DA0A 5FI0A 4GMVA 1H4RA 5C5BB 4NSWA 4EMOA 2D11A 3A8QA 2OTXA 4F7GA 2QKMA 1XCGA 3TO1A 1BAKA 2Z0PA 4K81A 1FGYA 5LONB 1MAIA 2COFA 4F7UP 5HE3A 2I1KA 2LOXA 2DFKA 3U8ZA 4Z2NA 1PFJA 1V5MA 4HAWB 2YS3A 3M1IB 1XKEA 1MKEA 2LG1A 2Z0OA 4A6KA 2DX5A 2ADZA 2RNRB 5GOWB 2RUKB 2MWNB 1MIZB 2GCLA 4A6FB 3TCAA 5KQ4A 1V5UA 1Q67A 1NI2A 5D3XA 1V89A 3PVWA 3D8DA 2D9ZA 4EKUA 4HDQA 1V5PA 2D4QA 2ELBA 1U2BA 2V76A 2BCJA 4ZRJA 2NMBA 2J0JA 2COCA 4K2PA 2K00A 3HW2B 3GYOA 1MK9B 3BJIA 2HTHB 1GC6A 1FAOA 3SUZA 3DXCA 2D9YA 1EGXA 2NZ8B 1OY2A 3KY9A 1P5TA 1ZC3B 2K2UA 4K17A 2D2QA 1BWNA 1RJ2A 1MPHA 4KHBB 1K5DB 4GPTB 4DX8A 2UZRA 2DHIA 5J3QA 5JP4A 1ZM0A 3OANA 3ZVRA 2JP2A 1WI1A 3AU5A 3PG7A 3P7ZA 1U29A 4ZRKA 1Y19B 3PVLA 2ROVA 4PQ0A 3SYXA 1N3HA 1H10A 1W1HA 2GJYA 1K5GB 2G35A 3MPXA 1ZC4B 2CODA 3IVFA 1FB8A 2D9WA 4HAXB 2W2XC 5DH9B 3ODOA 5DHFB 4HAVB 2M14A 1I2HA 2LULA 2Q13A 4KHOA 2I1JA 2EMTA 3G9WA 1SHCA 2DYQA 2COAA 1X86A 3DXEA 1UEFA 4HHVA 2DLWA 3SO6A 2LYDA 2GCJA 1UNQA 2DN6A 1RRPB 4P7IA 1DBHA 2J0MA 2ROZB 3CXBB 1P6SA 2MDXA 3ODWA 3ULCA 1X1GA 3HK0A 3MDBC 1BTNA 2D9VA 4CHMA 4Z2MB 3KRXA 1WGUA 4BBKA 1J19A 3QWMA 2M38A 4CYEA 2Y8GA 3A98B 3WA0A 3QIJA 1PMSA 3PVUA 4NY0A 3ML4A 4GXBA 4PNKA 2CY5A 1TQZA 1U5DA 2RVBB 3NSUA 1UPQA 1Y5OA 1FHWA 1U5GA 2YT0A 3PZDA 5CLQB 1XD4A 2HE7A 4MY6A 3ZDTA 1WJ1A 2DTCA 5C16A 2N23A 5C79A 1V61A 2DKPA 1ISNA 3N7CA 3V5WA 5JLJB 2OQBA 4H8SA 1FHXA 3KSYA 4WVFB 2GS0A 3A8PA 1J0WA 2EC1A 5DI9B 4HATB 1DDMA 2P0HA 2P0FA 1LB1A 1DDWA 2IFSA 1ZVRA 1FGZA 1M7EA 1X1FA 1DDVA
chains in the Genus database with same CATH superfamily
4HSIA 2UVMA 3LJUX 4TKNA 3FEHA 4Y94A 4HB3B 1BTKA 2UZSA 2EMSA 2CAYA 3ULBA 5FI1A 2R09A 4OT1A 3VOQA 5C5BA 1WGQA 2EJ8A 4KHAA 3PSCA 4IOYX 5DHAB 5JHHA 3FM8C 3F5RA 2AEHA 1GC7A 4YONA 2E2XA 2LKOA 4CSQA 2NBVA 1W1GA 4HB2B 1KI1B 2L2IA 2YT1A 3F0WA 2DYNA 3AU4A 2L1CA 1DROA 1OMWA 4KVGB 2K8EA 4HAYB 2FJLA 1M7RA 4HB4B 3UZTA 2KCJA 2RLOA 2RSGA 4B6HA 1I7AA 1W1DA 2Z0QA 3T06A 1WJMA 5I2SA 1EVHA 2PZ1A 3HSAA 1UPRA 1U27A 4A6FA 2CRFA 3CIKA 3RCPA 2VSZA 3HIEA 1WG7A 2DHJA 2DKQA 3B77A 4WSFA 1XODA 5J3TA 4D0NB 2LOZA 2N0YA 2P0DA 1EF1A 1X11A 5D27A 2RGNB 3AJ4A 4TYZA 1NTVA 2H7DA 1IRSA 4KAXB 2R2YA 5KCVA 5EFXA 2KIEA 1KZGA 1V88A 4K2OA 3SV1A 2MKRA 2DX1A 2I5FA 3TFMA 3X23A 3D8EA 3SNHA 4HDOA 5L81A 2ELAA 3FSSA 2W2WA 1FHOA 2I5CA 2YS1A 4D6WA 1E5WA 4QJ3B 1MI1A 3TW1A 1MK7B 4HAUB 4DXAB 4MT7A 4DX90 2ZPYA 1QC6A 3P6AA 1SGHA 5HE1A 2YVCA 4DBBA 4HAZB 2MFQA 2H7EA 1P3RA 1NTYA 1OQNA 5D3YA 2Z14A 3PEGA 3U7DA 2Y7BA 4A5KA 5KQ1A 1UNRA 3BINA 3WYFB 2W2XD 4QJ5B 4KHBA 4C0AA 1KZ7A 2J59M 4XWXA 5HE0A 2VKIA 2QKLA 3TVVA 5LOPB 2YRYA 4OSNA 2CY4A 4L1RA 5D3VA 1GG3A 3O96A 3HQCA 1AWEA 3NWFA 2YS5A 2K2JA 3D8FA 1X05A 4GZUA 1TJ6A 1XR0B 2R0DA 2YT2A 5DIFB 1Z87A 1U5FA 5LG4B 1FOEA 2D10A 3GYPA 5HE2A 2KUQA 5CLLB 2AL6A 1U5EA 2YF0A 5D3WA 1PLSA 1DYNA 2DHKA 2P8VA 1B55A 4F7HA 3QBVB 1NU2A 3DXDA 1UNPA 4IFSA 2KGXB 1QQGA 1MIXA 4EJNA 2RRFA 4L6EA 2IYBA 1LW3A 5J3YA 4GMXB 1XX0A 1ZSQA 2ZKMX 4HB0B 4YL8A 1AQCA 3KRWA 2J0KA 4MK0A 1TXDA 4CHJA 2X18A 4A6HA 3PP2A 5C6RA 2YSZA 4WJ7A 3ODXA 3VIAA 5JHGA 2KR0A 3KZ1A 2KUPA 1WVHA 3NW8A 2VRWB 4IAPA 4ZRIA 4GN1A 2XQNM 2Y8FA 2D9XA 1EAZA 2DA0A 5FI0A 4GMVA 1H4RA 5C5BB 4NSWA 4EMOA 2D11A 3A8QA 2OTXA 4F7GA 2QKMA 1XCGA 3TO1A 1BAKA 2Z0PA 4K81A 1FGYA 5LONB 1MAIA 2COFA 4F7UP 5HE3A 2I1KA 5IRSA 2LOXA 2DFKA 3U8ZA 5I2MA 4Z2NA 1PFJA 1V5MA 4DIXA 4HAWB 3OHMB 2YS3A 3M1IB 1XKEA 1MKEA 2LG1A 2Z0OA 4A6KA 2DX5A 2ADZA 2RNRB 5GOWB 2RUKB 4GNKB 2MWNB 1MIZB 2GCLA 4A6FB 1T77A 3TCAA 5KQ4A 1V5UA 1Q67A 1NI2A 5D3XA 1V89A 3PVWA 3D8DA 2D9ZA 3U12A 4EKUA 4HDQA 1V5PA 2D4QA 2ELBA 1U2BA 2V76A 2BCJA 4ZRJA 2NMBA 2J0JA 2COCA 4K2PA 2K00A 3HW2B 3GYOA 1MK9B 4QXAB 3BJIA 2HTHB 1GC6A 1FAOA 3SUZA 3DXCA 2D9YA 1EGXA 2NZ8B 1OY2A 3KY9A 1P5TA 1ZC3B 2K2UA 4K17A 2D2QA 1BWNA 1RJ2A 1MPHA 4KHBB 1K5DB 4GPTB 2Z59A 4DX8A 3FVCA 2UZRA 2DHIA 5J3QA 5JP4A 1ZM0A 3OANA 3ZVRA 2JP2A 1WI1A 3AU5A 3PG7A 3P7ZA 1U29A 4ZRKA 1Y19B 3PVLA 2ROVA 4PQ0A 3SYXA 1N3HA 1H10A 1W1HA 2GJYA 1K5GB 2G35A 3MPXA 1ZC4B 2CODA 3IVFA 1FB8A 2D9WA 4HAXB 2W2XC 5DH9B 3ODOA 5DHFB 4HAVB 2M14A 1I2HA 2LULA 2Q13A 4KHOA 2I1JA 2EMTA 2Z4DA 3G9WA 1SHCA 2DYQA 2COAA 1X86A 3DXEA 1UEFA 4HHVA 2DLWA 3SO6A 2GUMA 2LYDA 4QJ4B 2GCJA 1UNQA 2DN6A 1RRPB 4P7IA 1DBHA 2J0MA 3CXBB 2ROZB 1P6SA 2MDXA 3ODWA 3ULCA 1X1GA 3HK0A 3MDBC 1BTNA 2D9VA 4CHMA 4Z2MB 3KRXA 1WGUA 4BBKA 1J19A 3QWMA 2M38A 4CYEA 2Y8GA 3A98B 3WA0A 3QIJA 1PMSA 3PVUA 2Z13A 4NY0A 3ML4A 4GXBA 4PNKA 2CY5A 1TQZA 1U5DA 2RVBB 1Y5OA 1UPQA 3NSUA 1FHWA 1U5GA 2YT0A 3PZDA 5CLQB 1XD4A 2HE7A 1ZYIA 4MY6A 3ZDTA 2K49A 3DCXA 3NWAA 1WJ1A 2DTCA 5C16A 2KIGA 2N23A 5C79A 5M4YB 1V61A 2DKPA 1ISNA 3N7CA 3V5WA 5JLJB 2FJUB 2OQBA 4H8SA 1FHXA 3KSYA 4WVFB 2GS0A 3A8PA 1J0WA 2EC1A 5DI9B 4HATB 1DDMA 2P0HA 2P0FA 3A58A 1LB1A 4GOUA 1DDWA 2IFSA 3NWDA 1ZVRA 1FGZA 1M7EA 1X1FA 1DDVA
chains in the Genus database with same CATH topology
2UVMA 3LJUX 4TKNA 3FEHA 4Y94A 4HB3B 1BTKA 2UZSA 2EMSA 2CAYA 3ULBA 5FI1A 2R09A 3VOQA 5C5BA 1WGQA 2EJ8A 4KHAA 3PSCA 4IOYX 5DHAB 5JHHA 3FM8C 3F5RA 2AEHA 1GC7A 4YONA 2E2XA 2LKOA 1W1GA 4HB2B 1KI1B 2L2IA 2YT1A 3F0WA 2DYNA 3AU4A 2L1CA 1DROA 1OMWA 4KVGB 4HAYB 2FJLA 1M7RA 4HB4B 3UZTA 2KCJA 2RLOA 2RSGA 4B6HA 1I7AA 1W1DA 2Z0QA 3T06A 1WJMA 1EVHA 2PZ1A 1UPRA 1U27A 4A6FA 2CRFA 3CIKA 3RCPA 2VSZA 1WG7A 2DHJA 2DKQA 4WSFA 1XODA 5J3TA 4D0NB 2LOZA 2N0YA 2P0DA 1EF1A 1X11A 5D27A 2RGNB 3AJ4A 4TYZA 1NTVA 2H7DA 1IRSA 4KAXB 5KCVA 5EFXA 1KZGA 1V88A 4K2OA 3SV1A 2MKRA 2DX1A 2I5FA 3TFMA 3X23A 3D8EA 3SNHA 4HDOA 5L81A 2ELAA 3FSSA 2W2WA 1FHOA 2I5CA 2YS1A 1E5WA 3TW1A 4DXAB 1MK7B 4HAUB 4MT7A 4DX90 2ZPYA 1QC6A 3P6AA 1SGHA 5HE1A 2YVCA 4DBBA 4HAZB 2MFQA 2H7EA 1P3RA 1NTYA 1OQNA 5D3YA 3PEGA 3U7DA 2Y7BA 4A5KA 5KQ1A 1UNRA 3BINA 3WYFB 2W2XD 4C0AA 1KZ7A 2J59M 4XWXA 5HE0A 2VKIA 2QKLA 3TVVA 5LOPB 2YRYA 2CY4A 5D3VA 1GG3A 3O96A 3HQCA 1AWEA 2YS5A 2K2JA 3D8FA 1X05A 4GZUA 1TJ6A 1XR0B 2R0DA 5DIFB 1Z87A 1U5FA 1FOEA 2D10A 3GYPA 5HE2A 5CLLB 2AL6A 1U5EA 2YF0A 5D3WA 1PLSA 1DYNA 2DHKA 2P8VA 1B55A 4F7HA 3QBVB 1NU2A 3DXDA 1UNPA 4IFSA 2KGXB 1QQGA 1MIXA 4EJNA 4L6EA 2IYBA 1LW3A 5J3YA 4GMXB 1XX0A 1ZSQA 4HB0B 4YL8A 1AQCA 3KRWA 2J0KA 4MK0A 1TXDA 4CHJA 2X18A 4A6HA 3PP2A 5C6RA 2YSZA 4WJ7A 3ODXA 3VIAA 5JHGA 3KZ1A 2KUPA 1WVHA 2VRWB 4IAPA 4ZRIA 4GN1A 2XQNM 2Y8FA 2D9XA 1EAZA 2DA0A 5FI0A 4GMVA 1H4RA 5C5BB 4NSWA 4EMOA 2D11A 3A8QA 2OTXA 4F7GA 2QKMA 1XCGA 3TO1A 1BAKA 2Z0PA 4K81A 1FGYA 5LONB 1MAIA 2COFA 4F7UP 5HE3A 2I1KA 2LOXA 2DFKA 3U8ZA 4Z2NA 1PFJA 1V5MA 4HAWB 2YS3A 3M1IB 1XKEA 1MKEA 2LG1A 2Z0OA 4A6KA 2DX5A 2ADZA 2RNRB 5GOWB 2RUKB 2MWNB 1MIZB 2GCLA 4A6FB 3TCAA 5KQ4A 1V5UA 1Q67A 1NI2A 5D3XA 1V89A 3PVWA 3D8DA 2D9ZA 4EKUA 4HDQA 1V5PA 2D4QA 2ELBA 1U2BA 2V76A 2BCJA 4ZRJA 2NMBA 2J0JA 2COCA 4K2PA 2K00A 3HW2B 3GYOA 1MK9B 3BJIA 2HTHB 1GC6A 1FAOA 3SUZA 3DXCA 2D9YA 1EGXA 2NZ8B 1OY2A 3KY9A 1P5TA 1ZC3B 2K2UA 4K17A 2D2QA 1BWNA 1RJ2A 1MPHA 4KHBB 1K5DB 4GPTB 4DX8A 2UZRA 2DHIA 5J3QA 5JP4A 1ZM0A 3OANA 3ZVRA 2JP2A 1WI1A 3AU5A 3PG7A 3P7ZA 1U29A 4ZRKA 1Y19B 3PVLA 2ROVA 4PQ0A 3SYXA 1N3HA 1H10A 1W1HA 2GJYA 1K5GB 2G35A 3MPXA 1ZC4B 2CODA 3IVFA 1FB8A 2D9WA 4HAXB 2W2XC 5DH9B 3ODOA 5DHFB 4HAVB 2M14A 1I2HA 2LULA 2Q13A 4KHOA 2I1JA 2EMTA 3G9WA 1SHCA 2DYQA 2COAA 1X86A 3DXEA 1UEFA 4HHVA 2DLWA 3SO6A 2LYDA 2GCJA 1UNQA 2DN6A 1RRPB 4P7IA 1DBHA 2J0MA 2ROZB 3CXBB 1P6SA 2MDXA 3ODWA 3ULCA 1X1GA 3HK0A 3MDBC 1BTNA 2D9VA 4CHMA 4Z2MB 3KRXA 1WGUA 4BBKA 1J19A 3QWMA 2M38A 4CYEA 2Y8GA 3A98B 3WA0A 3QIJA 1PMSA 3PVUA 4NY0A 3ML4A 4GXBA 4PNKA 2CY5A 1TQZA 1U5DA 2RVBB 3NSUA 1UPQA 1Y5OA 1FHWA 1U5GA 2YT0A 3PZDA 5CLQB 1XD4A 2HE7A 4MY6A 3ZDTA 1WJ1A 2DTCA 5C16A 2N23A 5C79A 1V61A 2DKPA 1ISNA 3N7CA 3V5WA 5JLJB 2OQBA 4H8SA 1FHXA 3KSYA 4WVFB 2GS0A 3A8PA 1J0WA 2EC1A 5DI9B 4HATB 1DDMA 2P0HA 2P0FA 1LB1A 1DDWA 2IFSA 1ZVRA 1FGZA 1M7EA 1X1FA 1DDVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UVM A;  3LJU X;  4TKN A;  3FEH A;  4Y94 A;  4HB3 B;  1BTK A;  2UZS A;  2EMS A;  2CAY A;  3ULB A;  5FI1 A;  2R09 A;  3VOQ A;  5C5B A;  1WGQ A;  2EJ8 A;  4KHA A;  3PSC A;  4IOY X;  5DHA B;  5JHH A;  3FM8 C;  3F5R A;  2AEH A;  1GC7 A;  4YON A;  2E2X A;  2LKO A;  1W1G A;  4HB2 B;  1KI1 B;  2L2I A;  2YT1 A;  3F0W A;  2DYN A;  3AU4 A;  2L1C A;  1DRO A;  1OMW A;  4KVG B;  4HAY B;  2FJL A;  1M7R A;  4HB4 B;  3UZT A;  2KCJ A;  2RLO A;  2RSG A;  4B6H A;  1I7A A;  1W1D A;  2Z0Q A;  3T06 A;  1WJM A;  1EVH A;  2PZ1 A;  1UPR A;  1U27 A;  4A6F A;  2CRF A;  3CIK A;  3RCP A;  2VSZ A;  1WG7 A;  2DHJ A;  2DKQ A;  4WSF A;  1XOD A;  5J3T A;  4D0N B;  2LOZ A;  2N0Y A;  2P0D A;  1EF1 A;  1X11 A;  5D27 A;  2RGN B;  3AJ4 A;  4TYZ A;  1NTV A;  2H7D A;  1IRS A;  4KAX B;  5KCV A;  5EFX A;  1KZG A;  1V88 A;  4K2O A;  3SV1 A;  2MKR A;  2DX1 A;  2I5F A;  3TFM A;  3X23 A;  3D8E A;  3SNH A;  4HDO A;  5L81 A;  2ELA A;  3FSS A;  2W2W A;  1FHO A;  2I5C A;  2YS1 A;  1E5W A;  3TW1 A;  4DXA B;  1MK7 B;  4HAU B;  4MT7 A;  4DX9 0;  2ZPY A;  1QC6 A;  3P6A A;  1SGH A;  5HE1 A;  2YVC A;  4DBB A;  4HAZ B;  2MFQ A;  2H7E A;  1P3R A;  1NTY A;  1OQN A;  5D3Y A;  3PEG A;  3U7D A;  2Y7B A;  4A5K A;  5KQ1 A;  1UNR A;  3BIN A;  3WYF B;  2W2X D;  4C0A A;  1KZ7 A;  2J59 M;  4XWX A;  5HE0 A;  2VKI A;  2QKL A;  3TVV A;  5LOP B;  2YRY A;  2CY4 A;  5D3V A;  1GG3 A;  3O96 A;  3HQC A;  1AWE A;  2YS5 A;  2K2J A;  3D8F A;  1X05 A;  4GZU A;  1TJ6 A;  1XR0 B;  2R0D A;  5DIF B;  1Z87 A;  1U5F A;  1FOE A;  2D10 A;  3GYP A;  5HE2 A;  5CLL B;  2AL6 A;  1U5E A;  2YF0 A;  5D3W A;  1PLS A;  1DYN A;  2DHK A;  2P8V A;  1B55 A;  4F7H A;  3QBV B;  1NU2 A;  3DXD A;  1UNP A;  4IFS A;  2KGX B;  1QQG A;  1MIX A;  4EJN A;  4L6E A;  2IYB A;  1LW3 A;  5J3Y A;  4GMX B;  1XX0 A;  1ZSQ A;  4HB0 B;  4YL8 A;  1AQC A;  3KRW A;  2J0K A;  4MK0 A;  1TXD A;  4CHJ A;  2X18 A;  4A6H A;  3PP2 A;  5C6R A;  2YSZ A;  4WJ7 A;  3ODX A;  3VIA A;  5JHG A;  3KZ1 A;  2KUP A;  1WVH A;  2VRW B;  4IAP A;  4ZRI A;  4GN1 A;  2XQN M;  2Y8F A;  2D9X A;  1EAZ A;  2DA0 A;  5FI0 A;  4GMV A;  1H4R A;  5C5B B;  4NSW A;  4EMO A;  2D11 A;  3A8Q A;  2OTX A;  4F7G A;  2QKM A;  1XCG A;  3TO1 A;  1BAK A;  2Z0P A;  4K81 A;  1FGY A;  5LON B;  1MAI A;  2COF A;  4F7U P;  5HE3 A;  2I1K A;  2LOX A;  2DFK A;  3U8Z A;  4Z2N A;  1PFJ A;  1V5M A;  4HAW B;  2YS3 A;  3M1I B;  1XKE A;  1MKE A;  2LG1 A;  2Z0O A;  4A6K A;  2DX5 A;  2ADZ A;  2RNR B;  5GOW B;  2RUK B;  2MWN B;  1MIZ B;  2GCL A;  4A6F B;  3TCA A;  5KQ4 A;  1V5U A;  1Q67 A;  1NI2 A;  5D3X A;  1V89 A;  3PVW A;  3D8D A;  2D9Z A;  4EKU A;  4HDQ A;  1V5P A;  2D4Q A;  2ELB A;  1U2B A;  2V76 A;  2BCJ A;  4ZRJ A;  2NMB A;  2J0J A;  2COC A;  4K2P A;  2K00 A;  3HW2 B;  3GYO A;  1MK9 B;  3BJI A;  2HTH B;  1GC6 A;  1FAO A;  3SUZ A;  3DXC A;  2D9Y A;  1EGX A;  2NZ8 B;  1OY2 A;  3KY9 A;  1P5T A;  1ZC3 B;  2K2U A;  4K17 A;  2D2Q A;  1BWN A;  1RJ2 A;  1MPH A;  4KHB B;  1K5D B;  4GPT B;  4DX8 A;  2UZR A;  2DHI A;  5J3Q A;  5JP4 A;  1ZM0 A;  3OAN A;  3ZVR A;  2JP2 A;  1WI1 A;  3AU5 A;  3PG7 A;  3P7Z A;  1U29 A;  4ZRK A;  1Y19 B;  3PVL A;  2ROV A;  4PQ0 A;  3SYX A;  1N3H A;  1H10 A;  1W1H A;  2GJY A;  1K5G B;  2G35 A;  3MPX A;  1ZC4 B;  2COD A;  3IVF A;  1FB8 A;  2D9W A;  4HAX B;  2W2X C;  5DH9 B;  3ODO A;  5DHF B;  4HAV B;  2M14 A;  1I2H A;  2LUL A;  2Q13 A;  4KHO A;  2I1J A;  2EMT A;  3G9W A;  1SHC A;  2DYQ A;  2COA A;  1X86 A;  3DXE A;  1UEF A;  4HHV A;  2DLW A;  3SO6 A;  2LYD A;  2GCJ A;  1UNQ A;  2DN6 A;  1RRP B;  4P7I A;  1DBH A;  2J0M A;  2ROZ B;  3CXB B;  1P6S A;  2MDX A;  3ODW A;  3ULC A;  1X1G A;  3HK0 A;  3MDB C;  1BTN A;  2D9V A;  4CHM A;  4Z2M B;  3KRX A;  1WGU A;  4BBK A;  1J19 A;  3QWM A;  2M38 A;  4CYE A;  2Y8G A;  3A98 B;  3WA0 A;  3QIJ A;  1PMS A;  3PVU A;  4NY0 A;  3ML4 A;  4GXB A;  4PNK A;  2CY5 A;  1TQZ A;  1U5D A;  2RVB B;  3NSU A;  1UPQ A;  1Y5O A;  1FHW A;  1U5G A;  2YT0 A;  3PZD A;  5CLQ B;  1XD4 A;  2HE7 A;  4MY6 A;  3ZDT A;  1WJ1 A;  2DTC A;  5C16 A;  2N23 A;  5C79 A;  1V61 A;  2DKP A;  1ISN A;  3N7C A;  3V5W A;  5JLJ B;  2OQB A;  4H8S A;  1FHX A;  3KSY A;  4WVF B;  2GS0 A;  3A8P A;  1J0W A;  2EC1 A;  5DI9 B;  4HAT B;  1DDM A;  2P0H A;  2P0F A;  1LB1 A;  1DDW A;  2IFS A;  1ZVR A;  1FGZ A;  1M7E A;  1X1F A;  1DDV A; 
#chains in the Genus database with same CATH topology
 4HSI A;  2UVM A;  3LJU X;  4TKN A;  3FEH A;  4Y94 A;  4HB3 B;  1BTK A;  2UZS A;  2EMS A;  2CAY A;  3ULB A;  5FI1 A;  2R09 A;  4OT1 A;  3VOQ A;  5C5B A;  1WGQ A;  2EJ8 A;  4KHA A;  3PSC A;  4IOY X;  5DHA B;  5JHH A;  3FM8 C;  3F5R A;  2AEH A;  1GC7 A;  4YON A;  2E2X A;  2LKO A;  4CSQ A;  2NBV A;  1W1G A;  4HB2 B;  1KI1 B;  2L2I A;  2YT1 A;  3F0W A;  2DYN A;  3AU4 A;  2L1C A;  1DRO A;  1OMW A;  4KVG B;  2K8E A;  4HAY B;  2FJL A;  1M7R A;  4HB4 B;  3UZT A;  2KCJ A;  2RLO A;  2RSG A;  4B6H A;  1I7A A;  1W1D A;  2Z0Q A;  3T06 A;  1WJM A;  5I2S A;  1EVH A;  2PZ1 A;  3HSA A;  1UPR A;  1U27 A;  4A6F A;  2CRF A;  3CIK A;  3RCP A;  2VSZ A;  3HIE A;  1WG7 A;  2DHJ A;  2DKQ A;  3B77 A;  4WSF A;  1XOD A;  5J3T A;  4D0N B;  2LOZ A;  2N0Y A;  2P0D A;  1EF1 A;  1X11 A;  5D27 A;  2RGN B;  3AJ4 A;  4TYZ A;  1NTV A;  2H7D A;  1IRS A;  4KAX B;  2R2Y A;  5KCV A;  5EFX A;  2KIE A;  1KZG A;  1V88 A;  4K2O A;  3SV1 A;  2MKR A;  2DX1 A;  2I5F A;  3TFM A;  3X23 A;  3D8E A;  3SNH A;  4HDO A;  5L81 A;  2ELA A;  3FSS A;  2W2W A;  1FHO A;  2I5C A;  2YS1 A;  4D6W A;  1E5W A;  4QJ3 B;  1MI1 A;  3TW1 A;  1MK7 B;  4HAU B;  4DXA B;  4MT7 A;  4DX9 0;  2ZPY A;  1QC6 A;  3P6A A;  1SGH A;  5HE1 A;  2YVC A;  4DBB A;  4HAZ B;  2MFQ A;  2H7E A;  1P3R A;  1NTY A;  1OQN A;  5D3Y A;  2Z14 A;  3PEG A;  3U7D A;  2Y7B A;  4A5K A;  5KQ1 A;  1UNR A;  3BIN A;  3WYF B;  2W2X D;  4QJ5 B;  4KHB A;  4C0A A;  1KZ7 A;  2J59 M;  4XWX A;  5HE0 A;  2VKI A;  2QKL A;  3TVV A;  5LOP B;  2YRY A;  4OSN A;  2CY4 A;  4L1R A;  5D3V A;  1GG3 A;  3O96 A;  3HQC A;  1AWE A;  3NWF A;  2YS5 A;  2K2J A;  3D8F A;  1X05 A;  4GZU A;  1TJ6 A;  1XR0 B;  2R0D A;  2YT2 A;  5DIF B;  1Z87 A;  1U5F A;  5LG4 B;  1FOE A;  2D10 A;  3GYP A;  5HE2 A;  2KUQ A;  5CLL B;  2AL6 A;  1U5E A;  2YF0 A;  5D3W A;  1PLS A;  1DYN A;  2DHK A;  2P8V A;  1B55 A;  4F7H A;  3QBV B;  1NU2 A;  3DXD A;  1UNP A;  4IFS A;  2KGX B;  1QQG A;  1MIX A;  4EJN A;  2RRF A;  4L6E A;  2IYB A;  1LW3 A;  5J3Y A;  4GMX B;  1XX0 A;  1ZSQ A;  2ZKM X;  4HB0 B;  4YL8 A;  1AQC A;  3KRW A;  2J0K A;  4MK0 A;  1TXD A;  4CHJ A;  2X18 A;  4A6H A;  3PP2 A;  5C6R A;  2YSZ A;  4WJ7 A;  3ODX A;  3VIA A;  5JHG A;  2KR0 A;  3KZ1 A;  2KUP A;  1WVH A;  3NW8 A;  2VRW B;  4IAP A;  4ZRI A;  4GN1 A;  2XQN M;  2Y8F A;  2D9X A;  1EAZ A;  2DA0 A;  5FI0 A;  4GMV A;  1H4R A;  5C5B B;  4NSW A;  4EMO A;  2D11 A;  3A8Q A;  2OTX A;  4F7G A;  2QKM A;  1XCG A;  3TO1 A;  1BAK A;  2Z0P A;  4K81 A;  1FGY A;  5LON B;  1MAI A;  2COF A;  4F7U P;  5HE3 A;  2I1K A;  5IRS A;  2LOX A;  2DFK A;  3U8Z A;  5I2M A;  4Z2N A;  1PFJ A;  1V5M A;  4DIX A;  4HAW B;  3OHM B;  2YS3 A;  3M1I B;  1XKE A;  1MKE A;  2LG1 A;  2Z0O A;  4A6K A;  2DX5 A;  2ADZ A;  2RNR B;  5GOW B;  2RUK B;  4GNK B;  2MWN B;  1MIZ B;  2GCL A;  4A6F B;  1T77 A;  3TCA A;  5KQ4 A;  1V5U A;  1Q67 A;  1NI2 A;  5D3X A;  1V89 A;  3PVW A;  3D8D A;  2D9Z A;  3U12 A;  4EKU A;  4HDQ A;  1V5P A;  2D4Q A;  2ELB A;  1U2B A;  2V76 A;  2BCJ A;  4ZRJ A;  2NMB A;  2J0J A;  2COC A;  4K2P A;  2K00 A;  3HW2 B;  3GYO A;  1MK9 B;  4QXA B;  3BJI A;  2HTH B;  1GC6 A;  1FAO A;  3SUZ A;  3DXC A;  2D9Y A;  1EGX A;  2NZ8 B;  1OY2 A;  3KY9 A;  1P5T A;  1ZC3 B;  2K2U A;  4K17 A;  2D2Q A;  1BWN A;  1RJ2 A;  1MPH A;  4KHB B;  1K5D B;  4GPT B;  2Z59 A;  4DX8 A;  3FVC A;  2UZR A;  2DHI A;  5J3Q A;  5JP4 A;  1ZM0 A;  3OAN A;  3ZVR A;  2JP2 A;  1WI1 A;  3AU5 A;  3PG7 A;  3P7Z A;  1U29 A;  4ZRK A;  1Y19 B;  3PVL A;  2ROV A;  4PQ0 A;  3SYX A;  1N3H A;  1H10 A;  1W1H A;  2GJY A;  1K5G B;  2G35 A;  3MPX A;  1ZC4 B;  2COD A;  3IVF A;  1FB8 A;  2D9W A;  4HAX B;  2W2X C;  5DH9 B;  3ODO A;  5DHF B;  4HAV B;  2M14 A;  1I2H A;  2LUL A;  2Q13 A;  4KHO A;  2I1J A;  2EMT A;  2Z4D A;  3G9W A;  1SHC A;  2DYQ A;  2COA A;  1X86 A;  3DXE A;  1UEF A;  4HHV A;  2DLW A;  3SO6 A;  2GUM A;  2LYD A;  4QJ4 B;  2GCJ A;  1UNQ A;  2DN6 A;  1RRP B;  4P7I A;  1DBH A;  2J0M A;  3CXB B;  2ROZ B;  1P6S A;  2MDX A;  3ODW A;  3ULC A;  1X1G A;  3HK0 A;  3MDB C;  1BTN A;  2D9V A;  4CHM A;  4Z2M B;  3KRX A;  1WGU A;  4BBK A;  1J19 A;  3QWM A;  2M38 A;  4CYE A;  2Y8G A;  3A98 B;  3WA0 A;  3QIJ A;  1PMS A;  3PVU A;  2Z13 A;  4NY0 A;  3ML4 A;  4GXB A;  4PNK A;  2CY5 A;  1TQZ A;  1U5D A;  2RVB B;  1Y5O A;  1UPQ A;  3NSU A;  1FHW A;  1U5G A;  2YT0 A;  3PZD A;  5CLQ B;  1XD4 A;  2HE7 A;  1ZYI A;  4MY6 A;  3ZDT A;  2K49 A;  3DCX A;  3NWA A;  1WJ1 A;  2DTC A;  5C16 A;  2KIG A;  2N23 A;  5C79 A;  5M4Y B;  1V61 A;  2DKP A;  1ISN A;  3N7C A;  3V5W A;  5JLJ B;  2FJU B;  2OQB A;  4H8S A;  1FHX A;  3KSY A;  4WVF B;  2GS0 A;  3A8P A;  1J0W A;  2EC1 A;  5DI9 B;  4HAT B;  1DDM A;  2P0H A;  2P0F A;  3A58 A;  1LB1 A;  4GOU A;  1DDW A;  2IFS A;  3NWD A;  1ZVR A;  1FGZ A;  1M7E A;  1X1F A;  1DDV A; 
#chains in the Genus database with same CATH homology
 2UVM A;  3LJU X;  4TKN A;  3FEH A;  4Y94 A;  4HB3 B;  1BTK A;  2UZS A;  2EMS A;  2CAY A;  3ULB A;  5FI1 A;  2R09 A;  3VOQ A;  5C5B A;  1WGQ A;  2EJ8 A;  4KHA A;  3PSC A;  4IOY X;  5DHA B;  5JHH A;  3FM8 C;  3F5R A;  2AEH A;  1GC7 A;  4YON A;  2E2X A;  2LKO A;  1W1G A;  4HB2 B;  1KI1 B;  2L2I A;  2YT1 A;  3F0W A;  2DYN A;  3AU4 A;  2L1C A;  1DRO A;  1OMW A;  4KVG B;  4HAY B;  2FJL A;  1M7R A;  4HB4 B;  3UZT A;  2KCJ A;  2RLO A;  2RSG A;  4B6H A;  1I7A A;  1W1D A;  2Z0Q A;  3T06 A;  1WJM A;  1EVH A;  2PZ1 A;  1UPR A;  1U27 A;  4A6F A;  2CRF A;  3CIK A;  3RCP A;  2VSZ A;  1WG7 A;  2DHJ A;  2DKQ A;  4WSF A;  1XOD A;  5J3T A;  4D0N B;  2LOZ A;  2N0Y A;  2P0D A;  1EF1 A;  1X11 A;  5D27 A;  2RGN B;  3AJ4 A;  4TYZ A;  1NTV A;  2H7D A;  1IRS A;  4KAX B;  5KCV A;  5EFX A;  1KZG A;  1V88 A;  4K2O A;  3SV1 A;  2MKR A;  2DX1 A;  2I5F A;  3TFM A;  3X23 A;  3D8E A;  3SNH A;  4HDO A;  5L81 A;  2ELA A;  3FSS A;  2W2W A;  1FHO A;  2I5C A;  2YS1 A;  1E5W A;  3TW1 A;  4DXA B;  1MK7 B;  4HAU B;  4MT7 A;  4DX9 0;  2ZPY A;  1QC6 A;  3P6A A;  1SGH A;  5HE1 A;  2YVC A;  4DBB A;  4HAZ B;  2MFQ A;  2H7E A;  1P3R A;  1NTY A;  1OQN A;  5D3Y A;  3PEG A;  3U7D A;  2Y7B A;  4A5K A;  5KQ1 A;  1UNR A;  3BIN A;  3WYF B;  2W2X D;  4C0A A;  1KZ7 A;  2J59 M;  4XWX A;  5HE0 A;  2VKI A;  2QKL A;  3TVV A;  5LOP B;  2YRY A;  2CY4 A;  5D3V A;  1GG3 A;  3O96 A;  3HQC A;  1AWE A;  2YS5 A;  2K2J A;  3D8F A;  1X05 A;  4GZU A;  1TJ6 A;  1XR0 B;  2R0D A;  5DIF B;  1Z87 A;  1U5F A;  1FOE A;  2D10 A;  3GYP A;  5HE2 A;  5CLL B;  2AL6 A;  1U5E A;  2YF0 A;  5D3W A;  1PLS A;  1DYN A;  2DHK A;  2P8V A;  1B55 A;  4F7H A;  3QBV B;  1NU2 A;  3DXD A;  1UNP A;  4IFS A;  2KGX B;  1QQG A;  1MIX A;  4EJN A;  4L6E A;  2IYB A;  1LW3 A;  5J3Y A;  4GMX B;  1XX0 A;  1ZSQ A;  4HB0 B;  4YL8 A;  1AQC A;  3KRW A;  2J0K A;  4MK0 A;  1TXD A;  4CHJ A;  2X18 A;  4A6H A;  3PP2 A;  5C6R A;  2YSZ A;  4WJ7 A;  3ODX A;  3VIA A;  5JHG A;  3KZ1 A;  2KUP A;  1WVH A;  2VRW B;  4IAP A;  4ZRI A;  4GN1 A;  2XQN M;  2Y8F A;  2D9X A;  1EAZ A;  2DA0 A;  5FI0 A;  4GMV A;  1H4R A;  5C5B B;  4NSW A;  4EMO A;  2D11 A;  3A8Q A;  2OTX A;  4F7G A;  2QKM A;  1XCG A;  3TO1 A;  1BAK A;  2Z0P A;  4K81 A;  1FGY A;  5LON B;  1MAI A;  2COF A;  4F7U P;  5HE3 A;  2I1K A;  2LOX A;  2DFK A;  3U8Z A;  4Z2N A;  1PFJ A;  1V5M A;  4HAW B;  2YS3 A;  3M1I B;  1XKE A;  1MKE A;  2LG1 A;  2Z0O A;  4A6K A;  2DX5 A;  2ADZ A;  2RNR B;  5GOW B;  2RUK B;  2MWN B;  1MIZ B;  2GCL A;  4A6F B;  3TCA A;  5KQ4 A;  1V5U A;  1Q67 A;  1NI2 A;  5D3X A;  1V89 A;  3PVW A;  3D8D A;  2D9Z A;  4EKU A;  4HDQ A;  1V5P A;  2D4Q A;  2ELB A;  1U2B A;  2V76 A;  2BCJ A;  4ZRJ A;  2NMB A;  2J0J A;  2COC A;  4K2P A;  2K00 A;  3HW2 B;  3GYO A;  1MK9 B;  3BJI A;  2HTH B;  1GC6 A;  1FAO A;  3SUZ A;  3DXC A;  2D9Y A;  1EGX A;  2NZ8 B;  1OY2 A;  3KY9 A;  1P5T A;  1ZC3 B;  2K2U A;  4K17 A;  2D2Q A;  1BWN A;  1RJ2 A;  1MPH A;  4KHB B;  1K5D B;  4GPT B;  4DX8 A;  2UZR A;  2DHI A;  5J3Q A;  5JP4 A;  1ZM0 A;  3OAN A;  3ZVR A;  2JP2 A;  1WI1 A;  3AU5 A;  3PG7 A;  3P7Z A;  1U29 A;  4ZRK A;  1Y19 B;  3PVL A;  2ROV A;  4PQ0 A;  3SYX A;  1N3H A;  1H10 A;  1W1H A;  2GJY A;  1K5G B;  2G35 A;  3MPX A;  1ZC4 B;  2COD A;  3IVF A;  1FB8 A;  2D9W A;  4HAX B;  2W2X C;  5DH9 B;  3ODO A;  5DHF B;  4HAV B;  2M14 A;  1I2H A;  2LUL A;  2Q13 A;  4KHO A;  2I1J A;  2EMT A;  3G9W A;  1SHC A;  2DYQ A;  2COA A;  1X86 A;  3DXE A;  1UEF A;  4HHV A;  2DLW A;  3SO6 A;  2LYD A;  2GCJ A;  1UNQ A;  2DN6 A;  1RRP B;  4P7I A;  1DBH A;  2J0M A;  2ROZ B;  3CXB B;  1P6S A;  2MDX A;  3ODW A;  3ULC A;  1X1G A;  3HK0 A;  3MDB C;  1BTN A;  2D9V A;  4CHM A;  4Z2M B;  3KRX A;  1WGU A;  4BBK A;  1J19 A;  3QWM A;  2M38 A;  4CYE A;  2Y8G A;  3A98 B;  3WA0 A;  3QIJ A;  1PMS A;  3PVU A;  4NY0 A;  3ML4 A;  4GXB A;  4PNK A;  2CY5 A;  1TQZ A;  1U5D A;  2RVB B;  3NSU A;  1UPQ A;  1Y5O A;  1FHW A;  1U5G A;  2YT0 A;  3PZD A;  5CLQ B;  1XD4 A;  2HE7 A;  4MY6 A;  3ZDT A;  1WJ1 A;  2DTC A;  5C16 A;  2N23 A;  5C79 A;  1V61 A;  2DKP A;  1ISN A;  3N7C A;  3V5W A;  5JLJ B;  2OQB A;  4H8S A;  1FHX A;  3KSY A;  4WVF B;  2GS0 A;  3A8P A;  1J0W A;  2EC1 A;  5DI9 B;  4HAT B;  1DDM A;  2P0H A;  2P0F A;  1LB1 A;  1DDW A;  2IFS A;  1ZVR A;  1FGZ A;  1M7E A;  1X1F A;  1DDV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...