2DYQA

Crystal structure of the c-terminal phophotyrosine interaction domain of human apbb3
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
130
structure length
124
Chain Sequence
AQKYEALYMGTLPVTKAMGMDVLNEAIGTLTARGDRNAWVPTMLSVSDSLMTAHPIQEEPLWQCPVRLVTFIGVGRDPHTFGLIADLGRQSFQCAAFWCQPHAGGLSEAVQAACMVQYQKCLVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Protein binding
molecule keywords Amyloid beta A4 precursor protein-binding family B member 3
publication title Crystal Structure of the C-terminal Phophotyrosine Interaction Domain of Human APBB3
rcsb
source organism Homo sapiens
total genus 25
structure length 124
sequence length 130
ec nomenclature
pdb deposition date 2006-09-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2dyqA00
2LKOA 3ODOA 1QC6A 4K2PA 5L81A 4A6KA 1U5GA 2UZRA 4EMOA 1X1GA 1IRSA 2DKQA 1U29A 2YT1A 2YSZA 2MDXA 1TJ6A 4HB3B 1NTYA 2RNRB 3ODWA 4WSFA 3MDBC 1X1FA 3NSUA 2LOZA 4KAXB 3SV1A 2COAA 5HE0A 5EFXA 1W1DA 2YT0A 1KZ7A 1NU2A 4IAPA 1PFJA 1ZSQA 2OQBA 2DA0A 3ULCA 5J3QA 2AL6A 3QBVB 3A8QA 3QIJA 2G35A 1RRPB 2DHIA 3VOQA 1FHXA 2D9XA 3P7ZA 2GS0A 4KVGB 3G9WA 1WVHA 4K2OA 4DX8A 4D0NB 3PG7A 4BBKA 3KY9A 1J19A 1XCGA 2DX1A 1UNQA 2DLWA 5C5BA 1Y5OA 1V5PA 2I5CA 2LOXA 1OY2A 3X23A 2D2QA 5FI1A 1EAZA 5HE1A 4MK0A 4F7UP 2MWNB 1MPHA 1RJ2A 3HW2B 1X11A 2P0DA 4IOYX 3PZDA 3KRXA 1DBHA 2EMSA 3ODXA 3FM8C 5JLJB 4L6EA 1FHWA 3QWMA 2PZ1A 2H7EA 4PQ0A 3AJ4A 1SGHA 3PEGA 4HAWB 1MAIA 2EMTA 3TO1A 1UNRA 5C16A 1X86A 2KGXB 2L1CA 3U7DA 1LW3A 5CLQB 4HB0B 2CY5A 4HDQA 5KCVA 5D27A 1UPRA 3PVLA 5D3WA 2CRFA 2I1JA 1ZM0A 4NY0A 1GG3A 5D3VA 3A98B 1KI1B 2N0YA 2Z0OA 4KHOA 2K2JA 1I7AA 2CY4A 4HATB 2Y8GA 1V5UA 2I5FA 4MY6A 1V88A 2ELBA 2MFQA 5FI0A 4GN1A 1TXDA 1XX0A 5HE2A 2LYDA 1V5MA 1WJMA 1QQGA 2VSZA 1U27A 5JP4A 3DXEA 1V89A 4ZRJA 1OMWA 3IVFA 2LG1A 2Z0PA 4F7GA 2V76A 2GJYA 2FJLA 2VKIA 5GOWB 4PNKA 2P0HA 1DDWA 2ROZB 1WG7A 4KHBB 1GC6A 4A6FB 3PVUA 2AEHA 2J0JA 3WA0A 3AU4A 2J59M 2HE7A 3M1IB 2L2IA 2RSGA 2DTCA 2KUPA 4Y94A 5JHHA 3WYFB 4EJNA 2DHKA 1MKEA 1XODA 3BINA 3ULBA 4A6HA 2RVBB 2D9ZA 2IYBA 3LJUX 2N23A 3O96A 4XWXA 5DI9B 1BAKA 2J0MA 4HAUB 2H7DA 2COFA 1Q67A 1EVHA 3SYXA 4GXBA 5KQ1A 5C79A 1WGUA 1WGQA 3SNHA 1BTKA 4HAXB 4GZUA 3PVWA 1FHOA 1Y19B 3TVVA 1W1HA 2VRWB 2ZPYA 4ZRKA 4YONA 2QKMA 3UZTA 3BJIA 3KRWA 2RLOA 2P8VA 1PMSA 2EJ8A 4HB2B 4MT7A 1WI1A 3F5RA 4F7HA 3D8EA 1EF1A 1MK9B 2RUKB 4HB4B 1FOEA 4NSWA 3SO6A 3DXCA 3VIAA 2W2WA 2YRYA 2NMBA 1SHCA 2LULA 4HAVB 1P6SA 1H4RA 2P0FA 2XQNM 2IFSA 2ELAA 2YS1A 3DXDA 2Q13A 3HQCA 2COCA 4K81A 5KQ4A 2DFKA 2K00A 2KCJA 3OANA 5J3YA 1ZVRA 3RCPA 5C6RA 2DN6A 2ROVA 4KHAA 1DDVA 3MPXA 2I1KA 2BCJA 2CODA 1H10A 5CLLB 2JP2A 2R09A 2J0KA 2E2XA 1UEFA 2DX5A 4HAZB 1AWEA 2CAYA 1BTNA 1BWNA 3T06A 1P5TA 4DBBA 5LONB 4A5KA 1M7RA 1J0WA 1NTVA 1N3HA 1DROA 2YS3A 1P3RA 2UVMA 1UPQA 1MIZB 4WVFB 3HK0A 4H8SA 1E5WA 1AQCA 4ZRIA 1OQNA 3GYPA 2EC1A 5DIFB 1X05A 3F0WA 2RGNB 1PLSA 1U2BA 2YS5A 2W2XD 2Y8FA 4HDOA 2QKLA 3PSCA 1I2HA 4CHJA 4TKNA 1LB1A 1TQZA 2ADZA 2MKRA 1MK7B 1B55A 1U5EA 2YVCA 4GMVA 5C5BB 1GC7A 3PP2A 1FAOA 3TW1A 4P7IA 5LOPB 4Z2NA 3TFMA 3U8ZA 2Y7BA 2UZSA 4GMXB 4A6FA 3N7CA 1Z87A 1FGZA 4IFSA 5JHGA 3FSSA 3A8PA 3D8FA 1K5GB 4DXAB 2HTHB 4EKUA 1V61A 2OTXA 1W1GA 2D10A 2D9YA 3FEHA 1XD4A 2Z0QA 4TYZA 2D4QA 2W2XC 1FB8A 4HAYB 4B6HA 2DHJA 4CHMA 1XKEA 2DYNA 1UNPA 5J3TA 4WJ7A 1DDMA 4HHVA 2M14A 1ZC4B 4DX90 3TCAA 4GPTB 2D9WA 1K5DB 2DKPA 2GCJA 1MIXA 5HE3A 2K2UA 2YF0A 4CYEA 4Z2MB 1DYNA 1WJ1A 1U5DA 3D8DA 5DH9B 3CIKA 1U5FA 2DYQA 5D3XA 3KZ1A 3ZDTA 4K17A 5DHAB 3SUZA 1NI2A 1EGXA 2R0DA 4YL8A 5DHFB 3AU5A 1M7EA 2GCLA 3ZVRA 3P6AA 3ML4A 3V5WA 1XR0B 1KZGA 3CXBB 3KSYA 5D3YA 2M38A 3GYOA 1FGYA 2D11A 2D9VA 4C0AA 2X18A 1ISNA 2NZ8B 1ZC3B
chains in the Genus database with same CATH superfamily
2LKOA 3ODOA 1QC6A 4K2PA 5L81A 4A6KA 1U5GA 2UZRA 5I2SA 4EMOA 1X1GA 1IRSA 2DKQA 1U29A 2YT1A 2YSZA 2MDXA 1TJ6A 4HB3B 2Z4DA 1NTYA 2RNRB 3ODWA 4WSFA 3MDBC 1X1FA 3NSUA 2LOZA 4KAXB 3SV1A 2COAA 5HE0A 5EFXA 1W1DA 2YT0A 4HSIA 1KZ7A 1NU2A 4IAPA 1PFJA 1ZSQA 2OQBA 2DA0A 3ULCA 5J3QA 2AL6A 3QBVB 3A8QA 3QIJA 2G35A 1RRPB 2DHIA 3VOQA 1FHXA 2D9XA 3P7ZA 4D6WA 2GS0A 4KVGB 3G9WA 1WVHA 4K2OA 4DX8A 2Z13A 4D0NB 3A58A 3PG7A 4BBKA 3KY9A 1J19A 1XCGA 5LG4B 2DX1A 1UNQA 2DLWA 4CSQA 5C5BA 1Y5OA 1V5PA 2I5CA 2LOXA 1OY2A 3X23A 4GNKB 5IRSA 2D2QA 5FI1A 1EAZA 5HE1A 4MK0A 4F7UP 2MWNB 1MPHA 1RJ2A 3HW2B 1X11A 2P0DA 4IOYX 3PZDA 3KRXA 1DBHA 2EMSA 3ODXA 3NW8A 3FM8C 5JLJB 4L6EA 1FHWA 3QWMA 2PZ1A 2H7EA 4PQ0A 3AJ4A 1SGHA 3PEGA 4HAWB 1MAIA 2EMTA 3TO1A 1UNRA 5C16A 1X86A 2KGXB 2L1CA 3U7DA 1LW3A 5CLQB 4HB0B 2CY5A 4HDQA 5KCVA 5D27A 1UPRA 3PVLA 5D3WA 1ZYIA 2CRFA 2I1JA 1ZM0A 4QJ4B 4NY0A 1GG3A 5D3VA 3A98B 1KI1B 4QJ3B 2N0YA 2Z0OA 4KHOA 2K2JA 1I7AA 2CY4A 4HATB 3B77A 2Y8GA 1V5UA 2I5FA 4MY6A 1V88A 2ELBA 2MFQA 5FI0A 4GN1A 1TXDA 1XX0A 5HE2A 2LYDA 1V5MA 1WJMA 1QQGA 2VSZA 1U27A 5JP4A 3DXEA 1V89A 4ZRJA 4DIXA 1OMWA 2LG1A 2Z0PA 3IVFA 4F7GA 2V76A 2GJYA 3NWAA 2FJLA 2VKIA 5GOWB 4PNKA 3NWDA 2P0HA 1DDWA 2ROZB 2KR0A 2Z59A 1WG7A 4KHBB 1GC6A 4QJ5B 4A6FB 3PVUA 2AEHA 2J0JA 5I2MA 3WA0A 3AU4A 2J59M 2HE7A 3M1IB 3NWFA 2L2IA 2RSGA 2DTCA 2KUPA 4Y94A 5JHHA 3WYFB 4EJNA 2DHKA 1MKEA 1XODA 3BINA 3ULBA 4A6HA 2RVBB 2D9ZA 2IYBA 3LJUX 2N23A 3O96A 4XWXA 5DI9B 1BAKA 2J0MA 4HAUB 2H7DA 2COFA 1Q67A 1EVHA 3SYXA 4GXBA 5M4YB 5KQ1A 5C79A 1WGUA 1WGQA 3SNHA 1BTKA 1MI1A 4HAXB 4GZUA 3PVWA 2K8EA 1FHOA 2KUQA 1Y19B 3TVVA 1W1HA 2VRWB 4OT1A 2ZPYA 4ZRKA 4YONA 2QKMA 3UZTA 3BJIA 3KRWA 4QXAB 2FJUB 2RLOA 2P8VA 1T77A 2R2YA 1PMSA 2EJ8A 4HB2B 4MT7A 1WI1A 3F5RA 4F7HA 3D8EA 1EF1A 3HSAA 1MK9B 2RUKB 4HB4B 1FOEA 4NSWA 3SO6A 3DXCA 3VIAA 2W2WA 2YRYA 2NMBA 1SHCA 2LULA 4HAVB 3U12A 1P6SA 1H4RA 2P0FA 2XQNM 2IFSA 2ELAA 2YS1A 3DXDA 2Q13A 3HQCA 2COCA 4GOUA 4K81A 3HIEA 5KQ4A 2DFKA 2K00A 2KCJA 3OANA 5J3YA 1ZVRA 3RCPA 5C6RA 2DN6A 2ROVA 4KHAA 1DDVA 2ZKMX 3MPXA 2I1KA 2BCJA 2CODA 1H10A 5CLLB 2JP2A 2R09A 2RRFA 2J0KA 2E2XA 1UEFA 2DX5A 4HAZB 1AWEA 2CAYA 1BTNA 1BWNA 3T06A 1P5TA 4DBBA 5LONB 4A5KA 1M7RA 1J0WA 1NTVA 1N3HA 2YT2A 1DROA 2YS3A 1P3RA 2UVMA 1UPQA 1MIZB 4WVFB 3HK0A 4H8SA 1E5WA 1AQCA 4ZRIA 1OQNA 2KIEA 3GYPA 2EC1A 5DIFB 1X05A 3F0WA 2RGNB 3OHMB 1PLSA 4OSNA 1U2BA 2YS5A 2W2XD 3DCXA 2Y8FA 4HDOA 2QKLA 4L1RA 3PSCA 1I2HA 4CHJA 4TKNA 1LB1A 1TQZA 2ADZA 2MKRA 1MK7B 1B55A 1U5EA 2YVCA 4GMVA 5C5BB 1GC7A 3PP2A 1FAOA 3TW1A 4P7IA 5LOPB 4Z2NA 3TFMA 2K49A 3U8ZA 2Y7BA 2UZSA 2GUMA 4GMXB 4KHBA 4A6FA 3N7CA 1Z87A 1FGZA 4IFSA 5JHGA 3FSSA 3A8PA 3D8FA 1K5GB 2NBVA 4DXAB 2HTHB 4EKUA 1V61A 2OTXA 1W1GA 2D10A 2D9YA 3FEHA 1XD4A 2Z0QA 4TYZA 2D4QA 2W2XC 1FB8A 4HAYB 4B6HA 2DHJA 4CHMA 1XKEA 2DYNA 3FVCA 1UNPA 5J3TA 4WJ7A 1DDMA 4HHVA 2M14A 1ZC4B 4DX90 3TCAA 4GPTB 2D9WA 1K5DB 2DKPA 2GCJA 1MIXA 5HE3A 2K2UA 2YF0A 4CYEA 4Z2MB 1DYNA 2KIGA 1WJ1A 1U5DA 3D8DA 5DH9B 3CIKA 1U5FA 2DYQA 5D3XA 3KZ1A 3ZDTA 4K17A 5DHAB 3SUZA 1NI2A 1EGXA 2R0DA 4YL8A 5DHFB 3AU5A 1M7EA 2GCLA 3ZVRA 3P6AA 3ML4A 3V5WA 2Z14A 1XR0B 1KZGA 3CXBB 3KSYA 5D3YA 2M38A 3GYOA 1FGYA 2D11A 2D9VA 4C0AA 2X18A 1ISNA 2NZ8B 1ZC3B
chains in the Genus database with same CATH topology
2LKOA 3ODOA 1QC6A 4K2PA 5L81A 4A6KA 1U5GA 2UZRA 4EMOA 1X1GA 1IRSA 2DKQA 1U29A 2YT1A 2YSZA 2MDXA 1TJ6A 4HB3B 1NTYA 2RNRB 3ODWA 4WSFA 3MDBC 1X1FA 3NSUA 2LOZA 4KAXB 3SV1A 2COAA 5HE0A 5EFXA 1W1DA 2YT0A 1KZ7A 1NU2A 4IAPA 1PFJA 1ZSQA 2OQBA 2DA0A 3ULCA 5J3QA 2AL6A 3QBVB 3A8QA 3QIJA 2G35A 1RRPB 2DHIA 3VOQA 1FHXA 2D9XA 3P7ZA 2GS0A 4KVGB 3G9WA 1WVHA 4K2OA 4DX8A 4D0NB 3PG7A 4BBKA 3KY9A 1J19A 1XCGA 2DX1A 1UNQA 2DLWA 5C5BA 1Y5OA 1V5PA 2I5CA 2LOXA 1OY2A 3X23A 2D2QA 5FI1A 1EAZA 5HE1A 4MK0A 4F7UP 2MWNB 1MPHA 1RJ2A 3HW2B 1X11A 2P0DA 4IOYX 3PZDA 3KRXA 1DBHA 2EMSA 3ODXA 3FM8C 5JLJB 4L6EA 1FHWA 3QWMA 2PZ1A 2H7EA 4PQ0A 3AJ4A 1SGHA 3PEGA 4HAWB 1MAIA 2EMTA 3TO1A 1UNRA 5C16A 1X86A 2KGXB 2L1CA 3U7DA 1LW3A 5CLQB 4HB0B 2CY5A 4HDQA 5KCVA 5D27A 1UPRA 3PVLA 5D3WA 2CRFA 2I1JA 1ZM0A 4NY0A 1GG3A 5D3VA 3A98B 1KI1B 2N0YA 2Z0OA 4KHOA 2K2JA 1I7AA 2CY4A 4HATB 2Y8GA 1V5UA 2I5FA 4MY6A 1V88A 2ELBA 2MFQA 5FI0A 4GN1A 1TXDA 1XX0A 5HE2A 2LYDA 1V5MA 1WJMA 1QQGA 2VSZA 1U27A 5JP4A 3DXEA 1V89A 4ZRJA 1OMWA 3IVFA 2LG1A 2Z0PA 4F7GA 2V76A 2GJYA 2FJLA 2VKIA 5GOWB 4PNKA 2P0HA 1DDWA 2ROZB 1WG7A 4KHBB 1GC6A 4A6FB 3PVUA 2AEHA 2J0JA 3WA0A 3AU4A 2J59M 2HE7A 3M1IB 2L2IA 2RSGA 2DTCA 2KUPA 4Y94A 5JHHA 3WYFB 4EJNA 2DHKA 1MKEA 1XODA 3BINA 3ULBA 4A6HA 2RVBB 2D9ZA 2IYBA 3LJUX 2N23A 3O96A 4XWXA 5DI9B 1BAKA 2J0MA 4HAUB 2H7DA 2COFA 1Q67A 1EVHA 3SYXA 4GXBA 5KQ1A 5C79A 1WGUA 1WGQA 3SNHA 1BTKA 4HAXB 4GZUA 3PVWA 1FHOA 1Y19B 3TVVA 1W1HA 2VRWB 2ZPYA 4ZRKA 4YONA 2QKMA 3UZTA 3BJIA 3KRWA 2RLOA 2P8VA 1PMSA 2EJ8A 4HB2B 4MT7A 1WI1A 3F5RA 4F7HA 3D8EA 1EF1A 1MK9B 2RUKB 4HB4B 1FOEA 4NSWA 3SO6A 3DXCA 3VIAA 2W2WA 2YRYA 2NMBA 1SHCA 2LULA 4HAVB 1P6SA 1H4RA 2P0FA 2XQNM 2IFSA 2ELAA 2YS1A 3DXDA 2Q13A 3HQCA 2COCA 4K81A 5KQ4A 2DFKA 2K00A 2KCJA 3OANA 5J3YA 1ZVRA 3RCPA 5C6RA 2DN6A 2ROVA 4KHAA 1DDVA 3MPXA 2I1KA 2BCJA 2CODA 1H10A 5CLLB 2JP2A 2R09A 2J0KA 2E2XA 1UEFA 2DX5A 4HAZB 1AWEA 2CAYA 1BTNA 1BWNA 3T06A 1P5TA 4DBBA 5LONB 4A5KA 1M7RA 1J0WA 1NTVA 1N3HA 1DROA 2YS3A 1P3RA 2UVMA 1UPQA 1MIZB 4WVFB 3HK0A 4H8SA 1E5WA 1AQCA 4ZRIA 1OQNA 3GYPA 2EC1A 5DIFB 1X05A 3F0WA 2RGNB 1PLSA 1U2BA 2YS5A 2W2XD 2Y8FA 4HDOA 2QKLA 3PSCA 1I2HA 4CHJA 4TKNA 1LB1A 1TQZA 2ADZA 2MKRA 1MK7B 1B55A 1U5EA 2YVCA 4GMVA 5C5BB 1GC7A 3PP2A 1FAOA 3TW1A 4P7IA 5LOPB 4Z2NA 3TFMA 3U8ZA 2Y7BA 2UZSA 4GMXB 4A6FA 3N7CA 1Z87A 1FGZA 4IFSA 5JHGA 3FSSA 3A8PA 3D8FA 1K5GB 4DXAB 2HTHB 4EKUA 1V61A 2OTXA 1W1GA 2D10A 2D9YA 3FEHA 1XD4A 2Z0QA 4TYZA 2D4QA 2W2XC 1FB8A 4HAYB 4B6HA 2DHJA 4CHMA 1XKEA 2DYNA 1UNPA 5J3TA 4WJ7A 1DDMA 4HHVA 2M14A 1ZC4B 4DX90 3TCAA 4GPTB 2D9WA 1K5DB 2DKPA 2GCJA 1MIXA 5HE3A 2K2UA 2YF0A 4CYEA 4Z2MB 1DYNA 1WJ1A 1U5DA 3D8DA 5DH9B 3CIKA 1U5FA 2DYQA 5D3XA 3KZ1A 3ZDTA 4K17A 5DHAB 3SUZA 1NI2A 1EGXA 2R0DA 4YL8A 5DHFB 3AU5A 1M7EA 2GCLA 3ZVRA 3P6AA 3ML4A 3V5WA 1XR0B 1KZGA 3CXBB 3KSYA 5D3YA 2M38A 3GYOA 1FGYA 2D11A 2D9VA 4C0AA 2X18A 1ISNA 2NZ8B 1ZC3B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LKO A;  3ODO A;  1QC6 A;  4K2P A;  5L81 A;  4A6K A;  1U5G A;  2UZR A;  4EMO A;  1X1G A;  1IRS A;  2DKQ A;  1U29 A;  2YT1 A;  2YSZ A;  2MDX A;  1TJ6 A;  4HB3 B;  1NTY A;  2RNR B;  3ODW A;  4WSF A;  3MDB C;  1X1F A;  3NSU A;  2LOZ A;  4KAX B;  3SV1 A;  2COA A;  5HE0 A;  5EFX A;  1W1D A;  2YT0 A;  1KZ7 A;  1NU2 A;  4IAP A;  1PFJ A;  1ZSQ A;  2OQB A;  2DA0 A;  3ULC A;  5J3Q A;  2AL6 A;  3QBV B;  3A8Q A;  3QIJ A;  2G35 A;  1RRP B;  2DHI A;  3VOQ A;  1FHX A;  2D9X A;  3P7Z A;  2GS0 A;  4KVG B;  3G9W A;  1WVH A;  4K2O A;  4DX8 A;  4D0N B;  3PG7 A;  4BBK A;  3KY9 A;  1J19 A;  1XCG A;  2DX1 A;  1UNQ A;  2DLW A;  5C5B A;  1Y5O A;  1V5P A;  2I5C A;  2LOX A;  1OY2 A;  3X23 A;  2D2Q A;  5FI1 A;  1EAZ A;  5HE1 A;  4MK0 A;  4F7U P;  2MWN B;  1MPH A;  1RJ2 A;  3HW2 B;  1X11 A;  2P0D A;  4IOY X;  3PZD A;  3KRX A;  1DBH A;  2EMS A;  3ODX A;  3FM8 C;  5JLJ B;  4L6E A;  1FHW A;  3QWM A;  2PZ1 A;  2H7E A;  4PQ0 A;  3AJ4 A;  1SGH A;  3PEG A;  4HAW B;  1MAI A;  2EMT A;  3TO1 A;  1UNR A;  5C16 A;  1X86 A;  2KGX B;  2L1C A;  3U7D A;  1LW3 A;  5CLQ B;  4HB0 B;  2CY5 A;  4HDQ A;  5KCV A;  5D27 A;  1UPR A;  3PVL A;  5D3W A;  2CRF A;  2I1J A;  1ZM0 A;  4NY0 A;  1GG3 A;  5D3V A;  3A98 B;  1KI1 B;  2N0Y A;  2Z0O A;  4KHO A;  2K2J A;  1I7A A;  2CY4 A;  4HAT B;  2Y8G A;  1V5U A;  2I5F A;  4MY6 A;  1V88 A;  2ELB A;  2MFQ A;  5FI0 A;  4GN1 A;  1TXD A;  1XX0 A;  5HE2 A;  2LYD A;  1V5M A;  1WJM A;  1QQG A;  2VSZ A;  1U27 A;  5JP4 A;  3DXE A;  1V89 A;  4ZRJ A;  1OMW A;  3IVF A;  2LG1 A;  2Z0P A;  4F7G A;  2V76 A;  2GJY A;  2FJL A;  2VKI A;  5GOW B;  4PNK A;  2P0H A;  1DDW A;  2ROZ B;  1WG7 A;  4KHB B;  1GC6 A;  4A6F B;  3PVU A;  2AEH A;  2J0J A;  3WA0 A;  3AU4 A;  2J59 M;  2HE7 A;  3M1I B;  2L2I A;  2RSG A;  2DTC A;  2KUP A;  4Y94 A;  5JHH A;  3WYF B;  4EJN A;  2DHK A;  1MKE A;  1XOD A;  3BIN A;  3ULB A;  4A6H A;  2RVB B;  2D9Z A;  2IYB A;  3LJU X;  2N23 A;  3O96 A;  4XWX A;  5DI9 B;  1BAK A;  2J0M A;  4HAU B;  2H7D A;  2COF A;  1Q67 A;  1EVH A;  3SYX A;  4GXB A;  5KQ1 A;  5C79 A;  1WGU A;  1WGQ A;  3SNH A;  1BTK A;  4HAX B;  4GZU A;  3PVW A;  1FHO A;  1Y19 B;  3TVV A;  1W1H A;  2VRW B;  2ZPY A;  4ZRK A;  4YON A;  2QKM A;  3UZT A;  3BJI A;  3KRW A;  2RLO A;  2P8V A;  1PMS A;  2EJ8 A;  4HB2 B;  4MT7 A;  1WI1 A;  3F5R A;  4F7H A;  3D8E A;  1EF1 A;  1MK9 B;  2RUK B;  4HB4 B;  1FOE A;  4NSW A;  3SO6 A;  3DXC A;  3VIA A;  2W2W A;  2YRY A;  2NMB A;  1SHC A;  2LUL A;  4HAV B;  1P6S A;  1H4R A;  2P0F A;  2XQN M;  2IFS A;  2ELA A;  2YS1 A;  3DXD A;  2Q13 A;  3HQC A;  2COC A;  4K81 A;  5KQ4 A;  2DFK A;  2K00 A;  2KCJ A;  3OAN A;  5J3Y A;  1ZVR A;  3RCP A;  5C6R A;  2DN6 A;  2ROV A;  4KHA A;  1DDV A;  3MPX A;  2I1K A;  2BCJ A;  2COD A;  1H10 A;  5CLL B;  2JP2 A;  2R09 A;  2J0K A;  2E2X A;  1UEF A;  2DX5 A;  4HAZ B;  1AWE A;  2CAY A;  1BTN A;  1BWN A;  3T06 A;  1P5T A;  4DBB A;  5LON B;  4A5K A;  1M7R A;  1J0W A;  1NTV A;  1N3H A;  1DRO A;  2YS3 A;  1P3R A;  2UVM A;  1UPQ A;  1MIZ B;  4WVF B;  3HK0 A;  4H8S A;  1E5W A;  1AQC A;  4ZRI A;  1OQN A;  3GYP A;  2EC1 A;  5DIF B;  1X05 A;  3F0W A;  2RGN B;  1PLS A;  1U2B A;  2YS5 A;  2W2X D;  2Y8F A;  4HDO A;  2QKL A;  3PSC A;  1I2H A;  4CHJ A;  4TKN A;  1LB1 A;  1TQZ A;  2ADZ A;  2MKR A;  1MK7 B;  1B55 A;  1U5E A;  2YVC A;  4GMV A;  5C5B B;  1GC7 A;  3PP2 A;  1FAO A;  3TW1 A;  4P7I A;  5LOP B;  4Z2N A;  3TFM A;  3U8Z A;  2Y7B A;  2UZS A;  4GMX B;  4A6F A;  3N7C A;  1Z87 A;  1FGZ A;  4IFS A;  5JHG A;  3FSS A;  3A8P A;  3D8F A;  1K5G B;  4DXA B;  2HTH B;  4EKU A;  1V61 A;  2OTX A;  1W1G A;  2D10 A;  2D9Y A;  3FEH A;  1XD4 A;  2Z0Q A;  4TYZ A;  2D4Q A;  2W2X C;  1FB8 A;  4HAY B;  4B6H A;  2DHJ A;  4CHM A;  1XKE A;  2DYN A;  1UNP A;  5J3T A;  4WJ7 A;  1DDM A;  4HHV A;  2M14 A;  1ZC4 B;  4DX9 0;  3TCA A;  4GPT B;  2D9W A;  1K5D B;  2DKP A;  2GCJ A;  1MIX A;  5HE3 A;  2K2U A;  2YF0 A;  4CYE A;  4Z2M B;  1DYN A;  1WJ1 A;  1U5D A;  3D8D A;  5DH9 B;  3CIK A;  1U5F A;  2DYQ A;  5D3X A;  3KZ1 A;  3ZDT A;  4K17 A;  5DHA B;  3SUZ A;  1NI2 A;  1EGX A;  2R0D A;  4YL8 A;  5DHF B;  3AU5 A;  1M7E A;  2GCL A;  3ZVR A;  3P6A A;  3ML4 A;  3V5W A;  1XR0 B;  1KZG A;  3CXB B;  3KSY A;  5D3Y A;  2M38 A;  3GYO A;  1FGY A;  2D11 A;  2D9V A;  4C0A A;  2X18 A;  1ISN A;  2NZ8 B;  1ZC3 B; 
#chains in the Genus database with same CATH topology
 2LKO A;  3ODO A;  1QC6 A;  4K2P A;  5L81 A;  4A6K A;  1U5G A;  2UZR A;  5I2S A;  4EMO A;  1X1G A;  1IRS A;  2DKQ A;  1U29 A;  2YT1 A;  2YSZ A;  2MDX A;  1TJ6 A;  4HB3 B;  2Z4D A;  1NTY A;  2RNR B;  3ODW A;  4WSF A;  3MDB C;  1X1F A;  3NSU A;  2LOZ A;  4KAX B;  3SV1 A;  2COA A;  5HE0 A;  5EFX A;  1W1D A;  2YT0 A;  4HSI A;  1KZ7 A;  1NU2 A;  4IAP A;  1PFJ A;  1ZSQ A;  2OQB A;  2DA0 A;  3ULC A;  5J3Q A;  2AL6 A;  3QBV B;  3A8Q A;  3QIJ A;  2G35 A;  1RRP B;  2DHI A;  3VOQ A;  1FHX A;  2D9X A;  3P7Z A;  4D6W A;  2GS0 A;  4KVG B;  3G9W A;  1WVH A;  4K2O A;  4DX8 A;  2Z13 A;  4D0N B;  3A58 A;  3PG7 A;  4BBK A;  3KY9 A;  1J19 A;  1XCG A;  5LG4 B;  2DX1 A;  1UNQ A;  2DLW A;  4CSQ A;  5C5B A;  1Y5O A;  1V5P A;  2I5C A;  2LOX A;  1OY2 A;  3X23 A;  4GNK B;  5IRS A;  2D2Q A;  5FI1 A;  1EAZ A;  5HE1 A;  4MK0 A;  4F7U P;  2MWN B;  1MPH A;  1RJ2 A;  3HW2 B;  1X11 A;  2P0D A;  4IOY X;  3PZD A;  3KRX A;  1DBH A;  2EMS A;  3ODX A;  3NW8 A;  3FM8 C;  5JLJ B;  4L6E A;  1FHW A;  3QWM A;  2PZ1 A;  2H7E A;  4PQ0 A;  3AJ4 A;  1SGH A;  3PEG A;  4HAW B;  1MAI A;  2EMT A;  3TO1 A;  1UNR A;  5C16 A;  1X86 A;  2KGX B;  2L1C A;  3U7D A;  1LW3 A;  5CLQ B;  4HB0 B;  2CY5 A;  4HDQ A;  5KCV A;  5D27 A;  1UPR A;  3PVL A;  5D3W A;  1ZYI A;  2CRF A;  2I1J A;  1ZM0 A;  4QJ4 B;  4NY0 A;  1GG3 A;  5D3V A;  3A98 B;  1KI1 B;  4QJ3 B;  2N0Y A;  2Z0O A;  4KHO A;  2K2J A;  1I7A A;  2CY4 A;  4HAT B;  3B77 A;  2Y8G A;  1V5U A;  2I5F A;  4MY6 A;  1V88 A;  2ELB A;  2MFQ A;  5FI0 A;  4GN1 A;  1TXD A;  1XX0 A;  5HE2 A;  2LYD A;  1V5M A;  1WJM A;  1QQG A;  2VSZ A;  1U27 A;  5JP4 A;  3DXE A;  1V89 A;  4ZRJ A;  4DIX A;  1OMW A;  2LG1 A;  2Z0P A;  3IVF A;  4F7G A;  2V76 A;  2GJY A;  3NWA A;  2FJL A;  2VKI A;  5GOW B;  4PNK A;  3NWD A;  2P0H A;  1DDW A;  2ROZ B;  2KR0 A;  2Z59 A;  1WG7 A;  4KHB B;  1GC6 A;  4QJ5 B;  4A6F B;  3PVU A;  2AEH A;  2J0J A;  5I2M A;  3WA0 A;  3AU4 A;  2J59 M;  2HE7 A;  3M1I B;  3NWF A;  2L2I A;  2RSG A;  2DTC A;  2KUP A;  4Y94 A;  5JHH A;  3WYF B;  4EJN A;  2DHK A;  1MKE A;  1XOD A;  3BIN A;  3ULB A;  4A6H A;  2RVB B;  2D9Z A;  2IYB A;  3LJU X;  2N23 A;  3O96 A;  4XWX A;  5DI9 B;  1BAK A;  2J0M A;  4HAU B;  2H7D A;  2COF A;  1Q67 A;  1EVH A;  3SYX A;  4GXB A;  5M4Y B;  5KQ1 A;  5C79 A;  1WGU A;  1WGQ A;  3SNH A;  1BTK A;  1MI1 A;  4HAX B;  4GZU A;  3PVW A;  2K8E A;  1FHO A;  2KUQ A;  1Y19 B;  3TVV A;  1W1H A;  2VRW B;  4OT1 A;  2ZPY A;  4ZRK A;  4YON A;  2QKM A;  3UZT A;  3BJI A;  3KRW A;  4QXA B;  2FJU B;  2RLO A;  2P8V A;  1T77 A;  2R2Y A;  1PMS A;  2EJ8 A;  4HB2 B;  4MT7 A;  1WI1 A;  3F5R A;  4F7H A;  3D8E A;  1EF1 A;  3HSA A;  1MK9 B;  2RUK B;  4HB4 B;  1FOE A;  4NSW A;  3SO6 A;  3DXC A;  3VIA A;  2W2W A;  2YRY A;  2NMB A;  1SHC A;  2LUL A;  4HAV B;  3U12 A;  1P6S A;  1H4R A;  2P0F A;  2XQN M;  2IFS A;  2ELA A;  2YS1 A;  3DXD A;  2Q13 A;  3HQC A;  2COC A;  4GOU A;  4K81 A;  3HIE A;  5KQ4 A;  2DFK A;  2K00 A;  2KCJ A;  3OAN A;  5J3Y A;  1ZVR A;  3RCP A;  5C6R A;  2DN6 A;  2ROV A;  4KHA A;  1DDV A;  2ZKM X;  3MPX A;  2I1K A;  2BCJ A;  2COD A;  1H10 A;  5CLL B;  2JP2 A;  2R09 A;  2RRF A;  2J0K A;  2E2X A;  1UEF A;  2DX5 A;  4HAZ B;  1AWE A;  2CAY A;  1BTN A;  1BWN A;  3T06 A;  1P5T A;  4DBB A;  5LON B;  4A5K A;  1M7R A;  1J0W A;  1NTV A;  1N3H A;  2YT2 A;  1DRO A;  2YS3 A;  1P3R A;  2UVM A;  1UPQ A;  1MIZ B;  4WVF B;  3HK0 A;  4H8S A;  1E5W A;  1AQC A;  4ZRI A;  1OQN A;  2KIE A;  3GYP A;  2EC1 A;  5DIF B;  1X05 A;  3F0W A;  2RGN B;  3OHM B;  1PLS A;  4OSN A;  1U2B A;  2YS5 A;  2W2X D;  3DCX A;  2Y8F A;  4HDO A;  2QKL A;  4L1R A;  3PSC A;  1I2H A;  4CHJ A;  4TKN A;  1LB1 A;  1TQZ A;  2ADZ A;  2MKR A;  1MK7 B;  1B55 A;  1U5E A;  2YVC A;  4GMV A;  5C5B B;  1GC7 A;  3PP2 A;  1FAO A;  3TW1 A;  4P7I A;  5LOP B;  4Z2N A;  3TFM A;  2K49 A;  3U8Z A;  2Y7B A;  2UZS A;  2GUM A;  4GMX B;  4KHB A;  4A6F A;  3N7C A;  1Z87 A;  1FGZ A;  4IFS A;  5JHG A;  3FSS A;  3A8P A;  3D8F A;  1K5G B;  2NBV A;  4DXA B;  2HTH B;  4EKU A;  1V61 A;  2OTX A;  1W1G A;  2D10 A;  2D9Y A;  3FEH A;  1XD4 A;  2Z0Q A;  4TYZ A;  2D4Q A;  2W2X C;  1FB8 A;  4HAY B;  4B6H A;  2DHJ A;  4CHM A;  1XKE A;  2DYN A;  3FVC A;  1UNP A;  5J3T A;  4WJ7 A;  1DDM A;  4HHV A;  2M14 A;  1ZC4 B;  4DX9 0;  3TCA A;  4GPT B;  2D9W A;  1K5D B;  2DKP A;  2GCJ A;  1MIX A;  5HE3 A;  2K2U A;  2YF0 A;  4CYE A;  4Z2M B;  1DYN A;  2KIG A;  1WJ1 A;  1U5D A;  3D8D A;  5DH9 B;  3CIK A;  1U5F A;  2DYQ A;  5D3X A;  3KZ1 A;  3ZDT A;  4K17 A;  5DHA B;  3SUZ A;  1NI2 A;  1EGX A;  2R0D A;  4YL8 A;  5DHF B;  3AU5 A;  1M7E A;  2GCL A;  3ZVR A;  3P6A A;  3ML4 A;  3V5W A;  2Z14 A;  1XR0 B;  1KZG A;  3CXB B;  3KSY A;  5D3Y A;  2M38 A;  3GYO A;  1FGY A;  2D11 A;  2D9V A;  4C0A A;  2X18 A;  1ISN A;  2NZ8 B;  1ZC3 B; 
#chains in the Genus database with same CATH homology
 2LKO A;  3ODO A;  1QC6 A;  4K2P A;  5L81 A;  4A6K A;  1U5G A;  2UZR A;  4EMO A;  1X1G A;  1IRS A;  2DKQ A;  1U29 A;  2YT1 A;  2YSZ A;  2MDX A;  1TJ6 A;  4HB3 B;  1NTY A;  2RNR B;  3ODW A;  4WSF A;  3MDB C;  1X1F A;  3NSU A;  2LOZ A;  4KAX B;  3SV1 A;  2COA A;  5HE0 A;  5EFX A;  1W1D A;  2YT0 A;  1KZ7 A;  1NU2 A;  4IAP A;  1PFJ A;  1ZSQ A;  2OQB A;  2DA0 A;  3ULC A;  5J3Q A;  2AL6 A;  3QBV B;  3A8Q A;  3QIJ A;  2G35 A;  1RRP B;  2DHI A;  3VOQ A;  1FHX A;  2D9X A;  3P7Z A;  2GS0 A;  4KVG B;  3G9W A;  1WVH A;  4K2O A;  4DX8 A;  4D0N B;  3PG7 A;  4BBK A;  3KY9 A;  1J19 A;  1XCG A;  2DX1 A;  1UNQ A;  2DLW A;  5C5B A;  1Y5O A;  1V5P A;  2I5C A;  2LOX A;  1OY2 A;  3X23 A;  2D2Q A;  5FI1 A;  1EAZ A;  5HE1 A;  4MK0 A;  4F7U P;  2MWN B;  1MPH A;  1RJ2 A;  3HW2 B;  1X11 A;  2P0D A;  4IOY X;  3PZD A;  3KRX A;  1DBH A;  2EMS A;  3ODX A;  3FM8 C;  5JLJ B;  4L6E A;  1FHW A;  3QWM A;  2PZ1 A;  2H7E A;  4PQ0 A;  3AJ4 A;  1SGH A;  3PEG A;  4HAW B;  1MAI A;  2EMT A;  3TO1 A;  1UNR A;  5C16 A;  1X86 A;  2KGX B;  2L1C A;  3U7D A;  1LW3 A;  5CLQ B;  4HB0 B;  2CY5 A;  4HDQ A;  5KCV A;  5D27 A;  1UPR A;  3PVL A;  5D3W A;  2CRF A;  2I1J A;  1ZM0 A;  4NY0 A;  1GG3 A;  5D3V A;  3A98 B;  1KI1 B;  2N0Y A;  2Z0O A;  4KHO A;  2K2J A;  1I7A A;  2CY4 A;  4HAT B;  2Y8G A;  1V5U A;  2I5F A;  4MY6 A;  1V88 A;  2ELB A;  2MFQ A;  5FI0 A;  4GN1 A;  1TXD A;  1XX0 A;  5HE2 A;  2LYD A;  1V5M A;  1WJM A;  1QQG A;  2VSZ A;  1U27 A;  5JP4 A;  3DXE A;  1V89 A;  4ZRJ A;  1OMW A;  3IVF A;  2LG1 A;  2Z0P A;  4F7G A;  2V76 A;  2GJY A;  2FJL A;  2VKI A;  5GOW B;  4PNK A;  2P0H A;  1DDW A;  2ROZ B;  1WG7 A;  4KHB B;  1GC6 A;  4A6F B;  3PVU A;  2AEH A;  2J0J A;  3WA0 A;  3AU4 A;  2J59 M;  2HE7 A;  3M1I B;  2L2I A;  2RSG A;  2DTC A;  2KUP A;  4Y94 A;  5JHH A;  3WYF B;  4EJN A;  2DHK A;  1MKE A;  1XOD A;  3BIN A;  3ULB A;  4A6H A;  2RVB B;  2D9Z A;  2IYB A;  3LJU X;  2N23 A;  3O96 A;  4XWX A;  5DI9 B;  1BAK A;  2J0M A;  4HAU B;  2H7D A;  2COF A;  1Q67 A;  1EVH A;  3SYX A;  4GXB A;  5KQ1 A;  5C79 A;  1WGU A;  1WGQ A;  3SNH A;  1BTK A;  4HAX B;  4GZU A;  3PVW A;  1FHO A;  1Y19 B;  3TVV A;  1W1H A;  2VRW B;  2ZPY A;  4ZRK A;  4YON A;  2QKM A;  3UZT A;  3BJI A;  3KRW A;  2RLO A;  2P8V A;  1PMS A;  2EJ8 A;  4HB2 B;  4MT7 A;  1WI1 A;  3F5R A;  4F7H A;  3D8E A;  1EF1 A;  1MK9 B;  2RUK B;  4HB4 B;  1FOE A;  4NSW A;  3SO6 A;  3DXC A;  3VIA A;  2W2W A;  2YRY A;  2NMB A;  1SHC A;  2LUL A;  4HAV B;  1P6S A;  1H4R A;  2P0F A;  2XQN M;  2IFS A;  2ELA A;  2YS1 A;  3DXD A;  2Q13 A;  3HQC A;  2COC A;  4K81 A;  5KQ4 A;  2DFK A;  2K00 A;  2KCJ A;  3OAN A;  5J3Y A;  1ZVR A;  3RCP A;  5C6R A;  2DN6 A;  2ROV A;  4KHA A;  1DDV A;  3MPX A;  2I1K A;  2BCJ A;  2COD A;  1H10 A;  5CLL B;  2JP2 A;  2R09 A;  2J0K A;  2E2X A;  1UEF A;  2DX5 A;  4HAZ B;  1AWE A;  2CAY A;  1BTN A;  1BWN A;  3T06 A;  1P5T A;  4DBB A;  5LON B;  4A5K A;  1M7R A;  1J0W A;  1NTV A;  1N3H A;  1DRO A;  2YS3 A;  1P3R A;  2UVM A;  1UPQ A;  1MIZ B;  4WVF B;  3HK0 A;  4H8S A;  1E5W A;  1AQC A;  4ZRI A;  1OQN A;  3GYP A;  2EC1 A;  5DIF B;  1X05 A;  3F0W A;  2RGN B;  1PLS A;  1U2B A;  2YS5 A;  2W2X D;  2Y8F A;  4HDO A;  2QKL A;  3PSC A;  1I2H A;  4CHJ A;  4TKN A;  1LB1 A;  1TQZ A;  2ADZ A;  2MKR A;  1MK7 B;  1B55 A;  1U5E A;  2YVC A;  4GMV A;  5C5B B;  1GC7 A;  3PP2 A;  1FAO A;  3TW1 A;  4P7I A;  5LOP B;  4Z2N A;  3TFM A;  3U8Z A;  2Y7B A;  2UZS A;  4GMX B;  4A6F A;  3N7C A;  1Z87 A;  1FGZ A;  4IFS A;  5JHG A;  3FSS A;  3A8P A;  3D8F A;  1K5G B;  4DXA B;  2HTH B;  4EKU A;  1V61 A;  2OTX A;  1W1G A;  2D10 A;  2D9Y A;  3FEH A;  1XD4 A;  2Z0Q A;  4TYZ A;  2D4Q A;  2W2X C;  1FB8 A;  4HAY B;  4B6H A;  2DHJ A;  4CHM A;  1XKE A;  2DYN A;  1UNP A;  5J3T A;  4WJ7 A;  1DDM A;  4HHV A;  2M14 A;  1ZC4 B;  4DX9 0;  3TCA A;  4GPT B;  2D9W A;  1K5D B;  2DKP A;  2GCJ A;  1MIX A;  5HE3 A;  2K2U A;  2YF0 A;  4CYE A;  4Z2M B;  1DYN A;  1WJ1 A;  1U5D A;  3D8D A;  5DH9 B;  3CIK A;  1U5F A;  2DYQ A;  5D3X A;  3KZ1 A;  3ZDT A;  4K17 A;  5DHA B;  3SUZ A;  1NI2 A;  1EGX A;  2R0D A;  4YL8 A;  5DHF B;  3AU5 A;  1M7E A;  2GCL A;  3ZVR A;  3P6A A;  3ML4 A;  3V5W A;  1XR0 B;  1KZG A;  3CXB B;  3KSY A;  5D3Y A;  2M38 A;  3GYO A;  1FGY A;  2D11 A;  2D9V A;  4C0A A;  2X18 A;  1ISN A;  2NZ8 B;  1ZC3 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...