1W1DA

Crystal structure of the pdk1 pleckstrin homology (ph) domain bound to inositol (1,3,4,5)-tetrakisphosphate
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
143
structure length
143
Chain Sequence
b'PLGSNIEQYIHDLDSNSFELDLQFSEDEKRLLLEKQAGGNPWHQFVENNLILKMGPVDKRKGLFARRRQLLLTEGPHLYYVDPVNKVLKGEIPWSQELRPEAKNFKTFFVHTPNRTYYLMDPSGNAHKWCRKIQEVWRQRYQS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 3-PHOSPHOINOSITIDE DEPENDENT PROTEIN KINASE-1
publication title Structural Insights Into the Regulation of Pdk1 by Phosphoinositides and Inositol Phosphates
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 38
structure length 143
sequence length 143
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2004-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14593 PH_3 PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1w1dA00
4MY6A 4GXBA 3SV1A 2M38A 3D8FA 1M7RA 1P3RA 4HATB 4HDQA 1XCGA 5C5BA 1TQZA 2AL6A 2KUPA 3ODWA 1FOEA 4HAZB 3WYFB 3BINA 1WGQA 2L2IA 2FJLA 2OTXA 2MFQA 2RVBB 5D3YA 4GN1A 1SHCA 2GCJA 3TVVA 4Z2NA 2J0MA 2YRYA 1UEFA 3F0WA 3SUZA 1K5GB 4KHOA 2K2JA 3P7ZA 4Y94A 4NY0A 1UNQA 2Q13A 3CIKA 4TKNA 5GOWB 3SO6A 1BWNA 2CAYA 2EC1A 1UNRA 2N23A 1GG3A 4GZUA 1N3HA 4YONA 1H4RA 2D9YA 3KRXA 5D27A 5DHAB 4TYZA 3U7DA 3F5RA 1X11A 4HAUB 4IFSA 3TW1A 4DX8A 4DBBA 3A98B 5J3QA 4L6EA 5J3TA 1FGYA 4A6FA 4DX90 1DDMA 4PNKA 3KY9A 5EFXA 1WJMA 2VKIA 5HE3A 1FGZA 2ROVA 1X1FA 4IAPA 3CXBB 2GS0A 2D9XA 4BBKA 2MWNB 2ELAA 1KZGA 4KAXB 3PSCA 3V5WA 4ZRIA 3FSSA 3QIJA 5CLLB 1E5WA 2DFKA 4MK0A 1EF1A 4HAWB 2LOZA 2PZ1A 2LG1A 1GC6A 1ISNA 1NU2A 1FHWA 4KVGB 2R0DA 1DDWA 2OQBA 5DHFB 1EGXA 2H7DA 1MK7B 3O96A 2YVCA 4HAXB 2COAA 1RJ2A 2DX1A 1XODA 2VRWB 3PP2A 2CY5A 1NI2A 5KQ1A 3N7CA 3DXEA 3AU4A 3OANA 1V5UA 3FEHA 4ZRKA 1V5MA 2D9VA 1FAOA 2DKPA 1I7AA 2CODA 3DXCA 3ULCA 3FM8C 1DBHA 2DYQA 2D10A 5JHGA 5J3YA 5LOPB 1U5EA 4P7IA 1X86A 1X05A 1V89A 1X1GA 2YS5A 2Z0OA 3PZDA 5HE1A 2YT0A 3PVUA 5JP4A 1MIXA 2DTCA 3GYPA 1OY2A 3BJIA 1ZM0A 3QBVB 5D3XA 4EJNA 2P8VA 4CHMA 3VOQA 2W2WA 2RGNB 1RRPB 1FHXA 3D8EA 3P6AA 2ADZA 2X18A 1MPHA 2DLWA 4NSWA 1BAKA 1OQNA 2VSZA 3MPXA 4HAVB 3KRWA 2V76A 1TXDA 3A8QA 2R09A 2Z0QA 4HB3B 2XQNM 3ULBA 4H8SA 1U29A 1IRSA 2W2XC 5D3VA 2DA0A 3ZDTA 4ZRJA 2G35A 3HQCA 4GMVA 1ZVRA 4K2OA 4PQ0A 1WI1A 4A6KA 3ODOA 2CY4A 2K2UA 2J0KA 1QC6A 5DH9B 1U27A 2ZPYA 3HK0A 5C5BB 2P0HA 2I1KA 1BTKA 1V88A 2D4QA 4HDOA 3M1IB 3U8ZA 2IYBA 3D8DA 1XX0A 3KZ1A 3NSUA 1AWEA 3TCAA 3PVWA 5L81A 1DYNA 5KQ4A 2QKMA 2GJYA 4D0NB 1MAIA 1LB1A 4F7GA 2YSZA 4CHJA 1OMWA 2YT1A 4GPTB 4IOYX 2H7EA 4KHAA 4B6HA 3G9WA 1ZC4B 1EAZA 2I1JA 2Y8GA 2L1CA 1U5DA 1XD4A 2DHIA 2LKOA 4HB2B 5HE0A 2J59M 1FHOA 2M14A 3AJ4A 1UPRA 1KZ7A 2D11A 5DIFB 5CLQB 1WGUA 2I5FA 3VIAA 4K81A 4WVFB 2EJ8A 3AU5A 2NZ8B 2RSGA 3QWMA 2UVMA 2D9WA 4MT7A 2EMTA 1DROA 1I2HA 2YF0A 4HAYB 4F7UP 4A6FB 1MKEA 2RLOA 5KCVA 1U5GA 4KHBB 3IVFA 1Y19B 4HB4B 2W2XD 3A8PA 1XKEA 5JLJB 2HE7A 1PFJA 2JP2A 1M7EA 2MDXA 4K17A 1K5DB 1AQCA 4EKUA 1WJ1A 3ODXA 1NTVA 1J0WA 4Z2MB 1P5TA 2DYNA 1MK9B 1B55A 3GYOA 1QQGA 1PLSA 4XWXA 3LJUX 3RCPA 3TFMA 4YL8A 3PEGA 2I5CA 2COFA 5FI1A 1UNPA 2IFSA 2K00A 5C79A 5D3WA 2YS3A 3UZTA 2ELBA 2LULA 2D9ZA 1MIZB 2KCJA 2QKLA 3HW2B 5DI9B 1V5PA 4K2PA 2D2QA 4A5KA 1GC7A 1ZC3B 3ZVRA 5HE2A 1ZSQA 4HB0B 1NTYA 1WVHA 2P0FA 3PG7A 4DXAB 2DHJA 4GMXB 1Z87A 3SNHA 2UZRA 4F7HA 4C0AA 4WSFA 2KGXB 5C6RA 4EMOA 3WA0A 1TJ6A 2DX5A 2HTHB 3T06A 1V61A 3ML4A 2ROZB 2UZSA 1SGHA 4A6HA 5C16A 2EMSA 2LOXA 4CYEA 2YS1A 2COCA 2RNRB 2GCLA 1FB8A 4WJ7A 2RUKB 1BTNA 2AEHA 3KSYA 1XR0B 1EVHA 2N0YA 1WG7A 1Y5OA 1U2BA 5JHHA 1H10A 2P0DA 1P6SA 1LW3A 2E2XA 2BCJA 3DXDA 1U5FA 2Y8FA 2CRFA 1DDVA 1PMSA 4HHVA 3MDBC 1Q67A 1UPQA 1W1HA 2DHKA 2Z0PA 2DKQA 1W1GA 2DN6A 2LYDA 3X23A 1J19A 5LONB 2J0JA 2Y7BA 2MKRA 3PVLA 1W1DA 3SYXA 5FI0A 3TO1A 2NMBA 1KI1B
chains in the Genus database with same CATH superfamily
2K8EA 4MY6A 4GXBA 3SV1A 2GUMA 2M38A 2Z59A 3D8FA 1M7RA 1P3RA 4HATB 4HDQA 1XCGA 5C5BA 1TQZA 2AL6A 2KUPA 3ODWA 1FOEA 4HAZB 3WYFB 3BINA 1WGQA 2L2IA 2FJLA 2OTXA 2MFQA 2RVBB 5D3YA 4GN1A 1SHCA 2GCJA 3TVVA 3B77A 4Z2NA 2J0MA 2YRYA 1UEFA 3F0WA 3SUZA 1K5GB 4KHOA 2K2JA 3P7ZA 4Y94A 4NY0A 1UNQA 2Q13A 3CIKA 4TKNA 5GOWB 3SO6A 1BWNA 2CAYA 2EC1A 1UNRA 2N23A 1GG3A 4GZUA 1N3HA 4YONA 1H4RA 2D9YA 3KRXA 5D27A 1ZYIA 3NW8A 4TYZA 5DHAB 3U7DA 2KR0A 3F5RA 1X11A 4HAUB 2RRFA 4IFSA 3TW1A 4DX8A 3NWAA 4DBBA 3A98B 5J3QA 4L6EA 5J3TA 1FGYA 2KIGA 4A6FA 1MI1A 4DX90 1DDMA 4PNKA 3OHMB 4KHBA 3KY9A 5EFXA 1WJMA 3DCXA 2VKIA 5HE3A 1FGZA 2ROVA 1X1FA 4IAPA 5I2MA 3CXBB 4GOUA 2GS0A 2D9XA 4BBKA 2MWNB 2ELAA 1KZGA 4KAXB 3PSCA 3V5WA 4ZRIA 2ZKMX 3FSSA 3QIJA 5CLLB 1E5WA 2DFKA 4MK0A 1EF1A 4HAWB 2LOZA 2PZ1A 2LG1A 1GC6A 1ISNA 1NU2A 1FHWA 4KVGB 2R0DA 1DDWA 2OQBA 5DHFB 1EGXA 2H7DA 2KIEA 1MK7B 3O96A 2YVCA 4HAXB 2COAA 1RJ2A 2DX1A 1XODA 3HSAA 2VRWB 5M4YB 3PP2A 2CY5A 1NI2A 5KQ1A 3N7CA 3DXEA 3AU4A 3OANA 1V5UA 3FEHA 4ZRKA 1V5MA 2D9VA 3A58A 1FAOA 2DKPA 1I7AA 4D6WA 2CODA 3DXCA 3ULCA 3FM8C 1DBHA 2DYQA 2D10A 5JHGA 5J3YA 5LOPB 1U5EA 4P7IA 1X86A 1X05A 1V89A 1X1GA 2YS5A 2Z0OA 3PZDA 5HE1A 2YT0A 3PVUA 5JP4A 1MIXA 2DTCA 3GYPA 1OY2A 3BJIA 1ZM0A 3QBVB 4QXAB 5D3XA 4EJNA 2P8VA 4CHMA 2Z14A 2W2WA 3VOQA 2RGNB 2NBVA 1RRPB 1FHXA 3D8EA 3P6AA 2ADZA 2X18A 1MPHA 2DLWA 4NSWA 1BAKA 1OQNA 2VSZA 3MPXA 4HAVB 3KRWA 2V76A 1TXDA 3A8QA 2R09A 2Z0QA 4HB3B 2XQNM 3ULBA 4H8SA 1U29A 4HSIA 1IRSA 2W2XC 5D3VA 2DA0A 3ZDTA 4ZRJA 2G35A 3HQCA 4GMVA 1ZVRA 4K2OA 4PQ0A 1WI1A 4A6KA 3ODOA 2CY4A 2K2UA 2J0KA 1QC6A 5DH9B 5I2SA 1U27A 2ZPYA 3HK0A 5C5BB 4OSNA 2P0HA 2I1KA 1BTKA 1V88A 2D4QA 4HDOA 3M1IB 3U8ZA 2IYBA 2K49A 3D8DA 1XX0A 3KZ1A 3NSUA 1AWEA 3TCAA 3PVWA 5L81A 1DYNA 5KQ4A 2QKMA 2GJYA 4D0NB 1MAIA 1LB1A 4F7GA 3U12A 2YSZA 3FVCA 4CHJA 4OT1A 1OMWA 2YT1A 4GPTB 4IOYX 2H7EA 4KHAA 4B6HA 3G9WA 1ZC4B 1EAZA 2I1JA 2Y8GA 2L1CA 1U5DA 1XD4A 5IRSA 2DHIA 2LKOA 4HB2B 5HE0A 2J59M 1FHOA 2M14A 3AJ4A 1UPRA 4QJ5B 1KZ7A 2D11A 5LG4B 5DIFB 5CLQB 1WGUA 2I5FA 3VIAA 4K81A 4WVFB 2EJ8A 3AU5A 2NZ8B 2RSGA 3QWMA 2UVMA 2D9WA 4MT7A 2EMTA 1DROA 1I2HA 2YF0A 4HAYB 4F7UP 4A6FB 1MKEA 2RLOA 2Z13A 4CSQA 5KCVA 1U5GA 4KHBB 2KUQA 3IVFA 1Y19B 4HB4B 2W2XD 3A8PA 1XKEA 5JLJB 2HE7A 1PFJA 2JP2A 1M7EA 2MDXA 4K17A 1K5DB 1AQCA 4EKUA 1WJ1A 3ODXA 1NTVA 1J0WA 4Z2MB 1P5TA 2DYNA 1MK9B 1B55A 3GYOA 1QQGA 3HIEA 1PLSA 4XWXA 3LJUX 3RCPA 3TFMA 1T77A 4YL8A 4DIXA 3PEGA 2I5CA 2COFA 5FI1A 2Z4DA 1UNPA 2IFSA 2K00A 5C79A 5D3WA 2YT2A 2YS3A 3UZTA 2ELBA 2LULA 2D9ZA 1MIZB 2KCJA 2QKLA 3HW2B 5DI9B 1V5PA 4K2PA 2R2YA 2D2QA 4A5KA 1GC7A 1ZC3B 3ZVRA 5HE2A 4QJ4B 1ZSQA 4HB0B 1NTYA 1WVHA 2P0FA 3PG7A 4DXAB 2DHJA 4GMXB 1Z87A 3SNHA 2UZRA 3NWDA 4F7HA 4C0AA 4WSFA 2KGXB 5C6RA 4EMOA 3WA0A 1TJ6A 2DX5A 2HTHB 3T06A 1V61A 3ML4A 2ROZB 2UZSA 1SGHA 4A6HA 5C16A 2EMSA 2LOXA 4CYEA 2YS1A 4GNKB 2COCA 2RNRB 2GCLA 1FB8A 4WJ7A 2RUKB 1BTNA 2AEHA 3KSYA 3NWFA 1XR0B 1EVHA 2N0YA 1WG7A 1Y5OA 1U2BA 2FJUB 5JHHA 1H10A 2P0DA 1P6SA 1LW3A 2E2XA 2BCJA 3DXDA 1U5FA 2Y8FA 2CRFA 1DDVA 1PMSA 4HHVA 1Q67A 1UPQA 1W1HA 3MDBC 2DHKA 4L1RA 2Z0PA 2DKQA 1W1GA 2DN6A 2LYDA 3X23A 1J19A 5LONB 2J0JA 2Y7BA 2MKRA 3PVLA 1W1DA 3SYXA 5FI0A 3TO1A 2NMBA 4QJ3B 1KI1B
chains in the Genus database with same CATH topology
4MY6A 4GXBA 3SV1A 2M38A 3D8FA 1M7RA 1P3RA 4HATB 4HDQA 1XCGA 5C5BA 1TQZA 2AL6A 2KUPA 3ODWA 1FOEA 4HAZB 3WYFB 3BINA 1WGQA 2L2IA 2FJLA 2OTXA 2MFQA 2RVBB 5D3YA 4GN1A 1SHCA 2GCJA 3TVVA 4Z2NA 2J0MA 2YRYA 1UEFA 3F0WA 3SUZA 1K5GB 4KHOA 2K2JA 3P7ZA 4Y94A 4NY0A 1UNQA 2Q13A 3CIKA 4TKNA 5GOWB 3SO6A 1BWNA 2CAYA 2EC1A 1UNRA 2N23A 1GG3A 4GZUA 1N3HA 4YONA 1H4RA 2D9YA 3KRXA 5D27A 5DHAB 4TYZA 3U7DA 3F5RA 1X11A 4HAUB 4IFSA 3TW1A 4DX8A 4DBBA 3A98B 5J3QA 4L6EA 5J3TA 1FGYA 4A6FA 4DX90 1DDMA 4PNKA 3KY9A 5EFXA 1WJMA 2VKIA 5HE3A 1FGZA 2ROVA 1X1FA 4IAPA 3CXBB 2GS0A 2D9XA 4BBKA 2MWNB 2ELAA 1KZGA 4KAXB 3PSCA 3V5WA 4ZRIA 3FSSA 3QIJA 5CLLB 1E5WA 2DFKA 4MK0A 1EF1A 4HAWB 2LOZA 2PZ1A 2LG1A 1GC6A 1ISNA 1NU2A 1FHWA 4KVGB 2R0DA 1DDWA 2OQBA 5DHFB 1EGXA 2H7DA 1MK7B 3O96A 2YVCA 4HAXB 2COAA 1RJ2A 2DX1A 1XODA 2VRWB 3PP2A 2CY5A 1NI2A 5KQ1A 3N7CA 3DXEA 3AU4A 3OANA 1V5UA 3FEHA 4ZRKA 1V5MA 2D9VA 1FAOA 2DKPA 1I7AA 2CODA 3DXCA 3ULCA 3FM8C 1DBHA 2DYQA 2D10A 5JHGA 5J3YA 5LOPB 1U5EA 4P7IA 1X86A 1X05A 1V89A 1X1GA 2YS5A 2Z0OA 3PZDA 5HE1A 2YT0A 3PVUA 5JP4A 1MIXA 2DTCA 3GYPA 1OY2A 3BJIA 1ZM0A 3QBVB 5D3XA 4EJNA 2P8VA 4CHMA 3VOQA 2W2WA 2RGNB 1RRPB 1FHXA 3D8EA 3P6AA 2ADZA 2X18A 1MPHA 2DLWA 4NSWA 1BAKA 1OQNA 2VSZA 3MPXA 4HAVB 3KRWA 2V76A 1TXDA 3A8QA 2R09A 2Z0QA 4HB3B 2XQNM 3ULBA 4H8SA 1U29A 1IRSA 2W2XC 5D3VA 2DA0A 3ZDTA 4ZRJA 2G35A 3HQCA 4GMVA 1ZVRA 4K2OA 4PQ0A 1WI1A 4A6KA 3ODOA 2CY4A 2K2UA 2J0KA 1QC6A 5DH9B 1U27A 2ZPYA 3HK0A 5C5BB 2P0HA 2I1KA 1BTKA 1V88A 2D4QA 4HDOA 3M1IB 3U8ZA 2IYBA 3D8DA 1XX0A 3KZ1A 3NSUA 1AWEA 3TCAA 3PVWA 5L81A 1DYNA 5KQ4A 2QKMA 2GJYA 4D0NB 1MAIA 1LB1A 4F7GA 2YSZA 4CHJA 1OMWA 2YT1A 4GPTB 4IOYX 2H7EA 4KHAA 4B6HA 3G9WA 1ZC4B 1EAZA 2I1JA 2Y8GA 2L1CA 1U5DA 1XD4A 2DHIA 2LKOA 4HB2B 5HE0A 2J59M 1FHOA 2M14A 3AJ4A 1UPRA 1KZ7A 2D11A 5DIFB 5CLQB 1WGUA 2I5FA 3VIAA 4K81A 4WVFB 2EJ8A 3AU5A 2NZ8B 2RSGA 3QWMA 2UVMA 2D9WA 4MT7A 2EMTA 1DROA 1I2HA 2YF0A 4HAYB 4F7UP 4A6FB 1MKEA 2RLOA 5KCVA 1U5GA 4KHBB 3IVFA 1Y19B 4HB4B 2W2XD 3A8PA 1XKEA 5JLJB 2HE7A 1PFJA 2JP2A 1M7EA 2MDXA 4K17A 1K5DB 1AQCA 4EKUA 1WJ1A 3ODXA 1NTVA 1J0WA 4Z2MB 1P5TA 2DYNA 1MK9B 1B55A 3GYOA 1QQGA 1PLSA 4XWXA 3LJUX 3RCPA 3TFMA 4YL8A 3PEGA 2I5CA 2COFA 5FI1A 1UNPA 2IFSA 2K00A 5C79A 5D3WA 2YS3A 3UZTA 2ELBA 2LULA 2D9ZA 1MIZB 2KCJA 2QKLA 3HW2B 5DI9B 1V5PA 4K2PA 2D2QA 4A5KA 1GC7A 1ZC3B 3ZVRA 5HE2A 1ZSQA 4HB0B 1NTYA 1WVHA 2P0FA 3PG7A 4DXAB 2DHJA 4GMXB 1Z87A 3SNHA 2UZRA 4F7HA 4C0AA 4WSFA 2KGXB 5C6RA 4EMOA 3WA0A 1TJ6A 2DX5A 2HTHB 3T06A 1V61A 3ML4A 2ROZB 2UZSA 1SGHA 4A6HA 5C16A 2EMSA 2LOXA 4CYEA 2YS1A 2COCA 2RNRB 2GCLA 1FB8A 4WJ7A 2RUKB 1BTNA 2AEHA 3KSYA 1XR0B 1EVHA 2N0YA 1WG7A 1Y5OA 1U2BA 5JHHA 1H10A 2P0DA 1P6SA 1LW3A 2E2XA 2BCJA 3DXDA 1U5FA 2Y8FA 2CRFA 1DDVA 1PMSA 4HHVA 3MDBC 1Q67A 1UPQA 1W1HA 2DHKA 2Z0PA 2DKQA 1W1GA 2DN6A 2LYDA 3X23A 1J19A 5LONB 2J0JA 2Y7BA 2MKRA 3PVLA 1W1DA 3SYXA 5FI0A 3TO1A 2NMBA 1KI1B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MY6 A;  4GXB A;  3SV1 A;  2M38 A;  3D8F A;  1M7R A;  1P3R A;  4HAT B;  4HDQ A;  1XCG A;  5C5B A;  1TQZ A;  2AL6 A;  2KUP A;  3ODW A;  1FOE A;  4HAZ B;  3WYF B;  3BIN A;  1WGQ A;  2L2I A;  2FJL A;  2OTX A;  2MFQ A;  2RVB B;  5D3Y A;  4GN1 A;  1SHC A;  2GCJ A;  3TVV A;  4Z2N A;  2J0M A;  2YRY A;  1UEF A;  3F0W A;  3SUZ A;  1K5G B;  4KHO A;  2K2J A;  3P7Z A;  4Y94 A;  4NY0 A;  1UNQ A;  2Q13 A;  3CIK A;  4TKN A;  5GOW B;  3SO6 A;  1BWN A;  2CAY A;  2EC1 A;  1UNR A;  2N23 A;  1GG3 A;  4GZU A;  1N3H A;  4YON A;  1H4R A;  2D9Y A;  3KRX A;  5D27 A;  5DHA B;  4TYZ A;  3U7D A;  3F5R A;  1X11 A;  4HAU B;  4IFS A;  3TW1 A;  4DX8 A;  4DBB A;  3A98 B;  5J3Q A;  4L6E A;  5J3T A;  1FGY A;  4A6F A;  4DX9 0;  1DDM A;  4PNK A;  3KY9 A;  5EFX A;  1WJM A;  2VKI A;  5HE3 A;  1FGZ A;  2ROV A;  1X1F A;  4IAP A;  3CXB B;  2GS0 A;  2D9X A;  4BBK A;  2MWN B;  2ELA A;  1KZG A;  4KAX B;  3PSC A;  3V5W A;  4ZRI A;  3FSS A;  3QIJ A;  5CLL B;  1E5W A;  2DFK A;  4MK0 A;  1EF1 A;  4HAW B;  2LOZ A;  2PZ1 A;  2LG1 A;  1GC6 A;  1ISN A;  1NU2 A;  1FHW A;  4KVG B;  2R0D A;  1DDW A;  2OQB A;  5DHF B;  1EGX A;  2H7D A;  1MK7 B;  3O96 A;  2YVC A;  4HAX B;  2COA A;  1RJ2 A;  2DX1 A;  1XOD A;  2VRW B;  3PP2 A;  2CY5 A;  1NI2 A;  5KQ1 A;  3N7C A;  3DXE A;  3AU4 A;  3OAN A;  1V5U A;  3FEH A;  4ZRK A;  1V5M A;  2D9V A;  1FAO A;  2DKP A;  1I7A A;  2COD A;  3DXC A;  3ULC A;  3FM8 C;  1DBH A;  2DYQ A;  2D10 A;  5JHG A;  5J3Y A;  5LOP B;  1U5E A;  4P7I A;  1X86 A;  1X05 A;  1V89 A;  1X1G A;  2YS5 A;  2Z0O A;  3PZD A;  5HE1 A;  2YT0 A;  3PVU A;  5JP4 A;  1MIX A;  2DTC A;  3GYP A;  1OY2 A;  3BJI A;  1ZM0 A;  3QBV B;  5D3X A;  4EJN A;  2P8V A;  4CHM A;  3VOQ A;  2W2W A;  2RGN B;  1RRP B;  1FHX A;  3D8E A;  3P6A A;  2ADZ A;  2X18 A;  1MPH A;  2DLW A;  4NSW A;  1BAK A;  1OQN A;  2VSZ A;  3MPX A;  4HAV B;  3KRW A;  2V76 A;  1TXD A;  3A8Q A;  2R09 A;  2Z0Q A;  4HB3 B;  2XQN M;  3ULB A;  4H8S A;  1U29 A;  1IRS A;  2W2X C;  5D3V A;  2DA0 A;  3ZDT A;  4ZRJ A;  2G35 A;  3HQC A;  4GMV A;  1ZVR A;  4K2O A;  4PQ0 A;  1WI1 A;  4A6K A;  3ODO A;  2CY4 A;  2K2U A;  2J0K A;  1QC6 A;  5DH9 B;  1U27 A;  2ZPY A;  3HK0 A;  5C5B B;  2P0H A;  2I1K A;  1BTK A;  1V88 A;  2D4Q A;  4HDO A;  3M1I B;  3U8Z A;  2IYB A;  3D8D A;  1XX0 A;  3KZ1 A;  3NSU A;  1AWE A;  3TCA A;  3PVW A;  5L81 A;  1DYN A;  5KQ4 A;  2QKM A;  2GJY A;  4D0N B;  1MAI A;  1LB1 A;  4F7G A;  2YSZ A;  4CHJ A;  1OMW A;  2YT1 A;  4GPT B;  4IOY X;  2H7E A;  4KHA A;  4B6H A;  3G9W A;  1ZC4 B;  1EAZ A;  2I1J A;  2Y8G A;  2L1C A;  1U5D A;  1XD4 A;  2DHI A;  2LKO A;  4HB2 B;  5HE0 A;  2J59 M;  1FHO A;  2M14 A;  3AJ4 A;  1UPR A;  1KZ7 A;  2D11 A;  5DIF B;  5CLQ B;  1WGU A;  2I5F A;  3VIA A;  4K81 A;  4WVF B;  2EJ8 A;  3AU5 A;  2NZ8 B;  2RSG A;  3QWM A;  2UVM A;  2D9W A;  4MT7 A;  2EMT A;  1DRO A;  1I2H A;  2YF0 A;  4HAY B;  4F7U P;  4A6F B;  1MKE A;  2RLO A;  5KCV A;  1U5G A;  4KHB B;  3IVF A;  1Y19 B;  4HB4 B;  2W2X D;  3A8P A;  1XKE A;  5JLJ B;  2HE7 A;  1PFJ A;  2JP2 A;  1M7E A;  2MDX A;  4K17 A;  1K5D B;  1AQC A;  4EKU A;  1WJ1 A;  3ODX A;  1NTV A;  1J0W A;  4Z2M B;  1P5T A;  2DYN A;  1MK9 B;  1B55 A;  3GYO A;  1QQG A;  1PLS A;  4XWX A;  3LJU X;  3RCP A;  3TFM A;  4YL8 A;  3PEG A;  2I5C A;  2COF A;  5FI1 A;  1UNP A;  2IFS A;  2K00 A;  5C79 A;  5D3W A;  2YS3 A;  3UZT A;  2ELB A;  2LUL A;  2D9Z A;  1MIZ B;  2KCJ A;  2QKL A;  3HW2 B;  5DI9 B;  1V5P A;  4K2P A;  2D2Q A;  4A5K A;  1GC7 A;  1ZC3 B;  3ZVR A;  5HE2 A;  1ZSQ A;  4HB0 B;  1NTY A;  1WVH A;  2P0F A;  3PG7 A;  4DXA B;  2DHJ A;  4GMX B;  1Z87 A;  3SNH A;  2UZR A;  4F7H A;  4C0A A;  4WSF A;  2KGX B;  5C6R A;  4EMO A;  3WA0 A;  1TJ6 A;  2DX5 A;  2HTH B;  3T06 A;  1V61 A;  3ML4 A;  2ROZ B;  2UZS A;  1SGH A;  4A6H A;  5C16 A;  2EMS A;  2LOX A;  4CYE A;  2YS1 A;  2COC A;  2RNR B;  2GCL A;  1FB8 A;  4WJ7 A;  2RUK B;  1BTN A;  2AEH A;  3KSY A;  1XR0 B;  1EVH A;  2N0Y A;  1WG7 A;  1Y5O A;  1U2B A;  5JHH A;  1H10 A;  2P0D A;  1P6S A;  1LW3 A;  2E2X A;  2BCJ A;  3DXD A;  1U5F A;  2Y8F A;  2CRF A;  1DDV A;  1PMS A;  4HHV A;  3MDB C;  1Q67 A;  1UPQ A;  1W1H A;  2DHK A;  2Z0P A;  2DKQ A;  1W1G A;  2DN6 A;  2LYD A;  3X23 A;  1J19 A;  5LON B;  2J0J A;  2Y7B A;  2MKR A;  3PVL A;  1W1D A;  3SYX A;  5FI0 A;  3TO1 A;  2NMB A;  1KI1 B; 
#chains in the Genus database with same CATH topology
 2K8E A;  4MY6 A;  4GXB A;  3SV1 A;  2GUM A;  2M38 A;  2Z59 A;  3D8F A;  1M7R A;  1P3R A;  4HAT B;  4HDQ A;  1XCG A;  5C5B A;  1TQZ A;  2AL6 A;  2KUP A;  3ODW A;  1FOE A;  4HAZ B;  3WYF B;  3BIN A;  1WGQ A;  2L2I A;  2FJL A;  2OTX A;  2MFQ A;  2RVB B;  5D3Y A;  4GN1 A;  1SHC A;  2GCJ A;  3TVV A;  3B77 A;  4Z2N A;  2J0M A;  2YRY A;  1UEF A;  3F0W A;  3SUZ A;  1K5G B;  4KHO A;  2K2J A;  3P7Z A;  4Y94 A;  4NY0 A;  1UNQ A;  2Q13 A;  3CIK A;  4TKN A;  5GOW B;  3SO6 A;  1BWN A;  2CAY A;  2EC1 A;  1UNR A;  2N23 A;  1GG3 A;  4GZU A;  1N3H A;  4YON A;  1H4R A;  2D9Y A;  3KRX A;  5D27 A;  1ZYI A;  3NW8 A;  4TYZ A;  5DHA B;  3U7D A;  2KR0 A;  3F5R A;  1X11 A;  4HAU B;  2RRF A;  4IFS A;  3TW1 A;  4DX8 A;  3NWA A;  4DBB A;  3A98 B;  5J3Q A;  4L6E A;  5J3T A;  1FGY A;  2KIG A;  4A6F A;  1MI1 A;  4DX9 0;  1DDM A;  4PNK A;  3OHM B;  4KHB A;  3KY9 A;  5EFX A;  1WJM A;  3DCX A;  2VKI A;  5HE3 A;  1FGZ A;  2ROV A;  1X1F A;  4IAP A;  5I2M A;  3CXB B;  4GOU A;  2GS0 A;  2D9X A;  4BBK A;  2MWN B;  2ELA A;  1KZG A;  4KAX B;  3PSC A;  3V5W A;  4ZRI A;  2ZKM X;  3FSS A;  3QIJ A;  5CLL B;  1E5W A;  2DFK A;  4MK0 A;  1EF1 A;  4HAW B;  2LOZ A;  2PZ1 A;  2LG1 A;  1GC6 A;  1ISN A;  1NU2 A;  1FHW A;  4KVG B;  2R0D A;  1DDW A;  2OQB A;  5DHF B;  1EGX A;  2H7D A;  2KIE A;  1MK7 B;  3O96 A;  2YVC A;  4HAX B;  2COA A;  1RJ2 A;  2DX1 A;  1XOD A;  3HSA A;  2VRW B;  5M4Y B;  3PP2 A;  2CY5 A;  1NI2 A;  5KQ1 A;  3N7C A;  3DXE A;  3AU4 A;  3OAN A;  1V5U A;  3FEH A;  4ZRK A;  1V5M A;  2D9V A;  3A58 A;  1FAO A;  2DKP A;  1I7A A;  4D6W A;  2COD A;  3DXC A;  3ULC A;  3FM8 C;  1DBH A;  2DYQ A;  2D10 A;  5JHG A;  5J3Y A;  5LOP B;  1U5E A;  4P7I A;  1X86 A;  1X05 A;  1V89 A;  1X1G A;  2YS5 A;  2Z0O A;  3PZD A;  5HE1 A;  2YT0 A;  3PVU A;  5JP4 A;  1MIX A;  2DTC A;  3GYP A;  1OY2 A;  3BJI A;  1ZM0 A;  3QBV B;  4QXA B;  5D3X A;  4EJN A;  2P8V A;  4CHM A;  2Z14 A;  2W2W A;  3VOQ A;  2RGN B;  2NBV A;  1RRP B;  1FHX A;  3D8E A;  3P6A A;  2ADZ A;  2X18 A;  1MPH A;  2DLW A;  4NSW A;  1BAK A;  1OQN A;  2VSZ A;  3MPX A;  4HAV B;  3KRW A;  2V76 A;  1TXD A;  3A8Q A;  2R09 A;  2Z0Q A;  4HB3 B;  2XQN M;  3ULB A;  4H8S A;  1U29 A;  4HSI A;  1IRS A;  2W2X C;  5D3V A;  2DA0 A;  3ZDT A;  4ZRJ A;  2G35 A;  3HQC A;  4GMV A;  1ZVR A;  4K2O A;  4PQ0 A;  1WI1 A;  4A6K A;  3ODO A;  2CY4 A;  2K2U A;  2J0K A;  1QC6 A;  5DH9 B;  5I2S A;  1U27 A;  2ZPY A;  3HK0 A;  5C5B B;  4OSN A;  2P0H A;  2I1K A;  1BTK A;  1V88 A;  2D4Q A;  4HDO A;  3M1I B;  3U8Z A;  2IYB A;  2K49 A;  3D8D A;  1XX0 A;  3KZ1 A;  3NSU A;  1AWE A;  3TCA A;  3PVW A;  5L81 A;  1DYN A;  5KQ4 A;  2QKM A;  2GJY A;  4D0N B;  1MAI A;  1LB1 A;  4F7G A;  3U12 A;  2YSZ A;  3FVC A;  4CHJ A;  4OT1 A;  1OMW A;  2YT1 A;  4GPT B;  4IOY X;  2H7E A;  4KHA A;  4B6H A;  3G9W A;  1ZC4 B;  1EAZ A;  2I1J A;  2Y8G A;  2L1C A;  1U5D A;  1XD4 A;  5IRS A;  2DHI A;  2LKO A;  4HB2 B;  5HE0 A;  2J59 M;  1FHO A;  2M14 A;  3AJ4 A;  1UPR A;  4QJ5 B;  1KZ7 A;  2D11 A;  5LG4 B;  5DIF B;  5CLQ B;  1WGU A;  2I5F A;  3VIA A;  4K81 A;  4WVF B;  2EJ8 A;  3AU5 A;  2NZ8 B;  2RSG A;  3QWM A;  2UVM A;  2D9W A;  4MT7 A;  2EMT A;  1DRO A;  1I2H A;  2YF0 A;  4HAY B;  4F7U P;  4A6F B;  1MKE A;  2RLO A;  2Z13 A;  4CSQ A;  5KCV A;  1U5G A;  4KHB B;  2KUQ A;  3IVF A;  1Y19 B;  4HB4 B;  2W2X D;  3A8P A;  1XKE A;  5JLJ B;  2HE7 A;  1PFJ A;  2JP2 A;  1M7E A;  2MDX A;  4K17 A;  1K5D B;  1AQC A;  4EKU A;  1WJ1 A;  3ODX A;  1NTV A;  1J0W A;  4Z2M B;  1P5T A;  2DYN A;  1MK9 B;  1B55 A;  3GYO A;  1QQG A;  3HIE A;  1PLS A;  4XWX A;  3LJU X;  3RCP A;  3TFM A;  1T77 A;  4YL8 A;  4DIX A;  3PEG A;  2I5C A;  2COF A;  5FI1 A;  2Z4D A;  1UNP A;  2IFS A;  2K00 A;  5C79 A;  5D3W A;  2YT2 A;  2YS3 A;  3UZT A;  2ELB A;  2LUL A;  2D9Z A;  1MIZ B;  2KCJ A;  2QKL A;  3HW2 B;  5DI9 B;  1V5P A;  4K2P A;  2R2Y A;  2D2Q A;  4A5K A;  1GC7 A;  1ZC3 B;  3ZVR A;  5HE2 A;  4QJ4 B;  1ZSQ A;  4HB0 B;  1NTY A;  1WVH A;  2P0F A;  3PG7 A;  4DXA B;  2DHJ A;  4GMX B;  1Z87 A;  3SNH A;  2UZR A;  3NWD A;  4F7H A;  4C0A A;  4WSF A;  2KGX B;  5C6R A;  4EMO A;  3WA0 A;  1TJ6 A;  2DX5 A;  2HTH B;  3T06 A;  1V61 A;  3ML4 A;  2ROZ B;  2UZS A;  1SGH A;  4A6H A;  5C16 A;  2EMS A;  2LOX A;  4CYE A;  2YS1 A;  4GNK B;  2COC A;  2RNR B;  2GCL A;  1FB8 A;  4WJ7 A;  2RUK B;  1BTN A;  2AEH A;  3KSY A;  3NWF A;  1XR0 B;  1EVH A;  2N0Y A;  1WG7 A;  1Y5O A;  1U2B A;  2FJU B;  5JHH A;  1H10 A;  2P0D A;  1P6S A;  1LW3 A;  2E2X A;  2BCJ A;  3DXD A;  1U5F A;  2Y8F A;  2CRF A;  1DDV A;  1PMS A;  4HHV A;  1Q67 A;  1UPQ A;  1W1H A;  3MDB C;  2DHK A;  4L1R A;  2Z0P A;  2DKQ A;  1W1G A;  2DN6 A;  2LYD A;  3X23 A;  1J19 A;  5LON B;  2J0J A;  2Y7B A;  2MKR A;  3PVL A;  1W1D A;  3SYX A;  5FI0 A;  3TO1 A;  2NMB A;  4QJ3 B;  1KI1 B; 
#chains in the Genus database with same CATH homology
 4MY6 A;  4GXB A;  3SV1 A;  2M38 A;  3D8F A;  1M7R A;  1P3R A;  4HAT B;  4HDQ A;  1XCG A;  5C5B A;  1TQZ A;  2AL6 A;  2KUP A;  3ODW A;  1FOE A;  4HAZ B;  3WYF B;  3BIN A;  1WGQ A;  2L2I A;  2FJL A;  2OTX A;  2MFQ A;  2RVB B;  5D3Y A;  4GN1 A;  1SHC A;  2GCJ A;  3TVV A;  4Z2N A;  2J0M A;  2YRY A;  1UEF A;  3F0W A;  3SUZ A;  1K5G B;  4KHO A;  2K2J A;  3P7Z A;  4Y94 A;  4NY0 A;  1UNQ A;  2Q13 A;  3CIK A;  4TKN A;  5GOW B;  3SO6 A;  1BWN A;  2CAY A;  2EC1 A;  1UNR A;  2N23 A;  1GG3 A;  4GZU A;  1N3H A;  4YON A;  1H4R A;  2D9Y A;  3KRX A;  5D27 A;  5DHA B;  4TYZ A;  3U7D A;  3F5R A;  1X11 A;  4HAU B;  4IFS A;  3TW1 A;  4DX8 A;  4DBB A;  3A98 B;  5J3Q A;  4L6E A;  5J3T A;  1FGY A;  4A6F A;  4DX9 0;  1DDM A;  4PNK A;  3KY9 A;  5EFX A;  1WJM A;  2VKI A;  5HE3 A;  1FGZ A;  2ROV A;  1X1F A;  4IAP A;  3CXB B;  2GS0 A;  2D9X A;  4BBK A;  2MWN B;  2ELA A;  1KZG A;  4KAX B;  3PSC A;  3V5W A;  4ZRI A;  3FSS A;  3QIJ A;  5CLL B;  1E5W A;  2DFK A;  4MK0 A;  1EF1 A;  4HAW B;  2LOZ A;  2PZ1 A;  2LG1 A;  1GC6 A;  1ISN A;  1NU2 A;  1FHW A;  4KVG B;  2R0D A;  1DDW A;  2OQB A;  5DHF B;  1EGX A;  2H7D A;  1MK7 B;  3O96 A;  2YVC A;  4HAX B;  2COA A;  1RJ2 A;  2DX1 A;  1XOD A;  2VRW B;  3PP2 A;  2CY5 A;  1NI2 A;  5KQ1 A;  3N7C A;  3DXE A;  3AU4 A;  3OAN A;  1V5U A;  3FEH A;  4ZRK A;  1V5M A;  2D9V A;  1FAO A;  2DKP A;  1I7A A;  2COD A;  3DXC A;  3ULC A;  3FM8 C;  1DBH A;  2DYQ A;  2D10 A;  5JHG A;  5J3Y A;  5LOP B;  1U5E A;  4P7I A;  1X86 A;  1X05 A;  1V89 A;  1X1G A;  2YS5 A;  2Z0O A;  3PZD A;  5HE1 A;  2YT0 A;  3PVU A;  5JP4 A;  1MIX A;  2DTC A;  3GYP A;  1OY2 A;  3BJI A;  1ZM0 A;  3QBV B;  5D3X A;  4EJN A;  2P8V A;  4CHM A;  3VOQ A;  2W2W A;  2RGN B;  1RRP B;  1FHX A;  3D8E A;  3P6A A;  2ADZ A;  2X18 A;  1MPH A;  2DLW A;  4NSW A;  1BAK A;  1OQN A;  2VSZ A;  3MPX A;  4HAV B;  3KRW A;  2V76 A;  1TXD A;  3A8Q A;  2R09 A;  2Z0Q A;  4HB3 B;  2XQN M;  3ULB A;  4H8S A;  1U29 A;  1IRS A;  2W2X C;  5D3V A;  2DA0 A;  3ZDT A;  4ZRJ A;  2G35 A;  3HQC A;  4GMV A;  1ZVR A;  4K2O A;  4PQ0 A;  1WI1 A;  4A6K A;  3ODO A;  2CY4 A;  2K2U A;  2J0K A;  1QC6 A;  5DH9 B;  1U27 A;  2ZPY A;  3HK0 A;  5C5B B;  2P0H A;  2I1K A;  1BTK A;  1V88 A;  2D4Q A;  4HDO A;  3M1I B;  3U8Z A;  2IYB A;  3D8D A;  1XX0 A;  3KZ1 A;  3NSU A;  1AWE A;  3TCA A;  3PVW A;  5L81 A;  1DYN A;  5KQ4 A;  2QKM A;  2GJY A;  4D0N B;  1MAI A;  1LB1 A;  4F7G A;  2YSZ A;  4CHJ A;  1OMW A;  2YT1 A;  4GPT B;  4IOY X;  2H7E A;  4KHA A;  4B6H A;  3G9W A;  1ZC4 B;  1EAZ A;  2I1J A;  2Y8G A;  2L1C A;  1U5D A;  1XD4 A;  2DHI A;  2LKO A;  4HB2 B;  5HE0 A;  2J59 M;  1FHO A;  2M14 A;  3AJ4 A;  1UPR A;  1KZ7 A;  2D11 A;  5DIF B;  5CLQ B;  1WGU A;  2I5F A;  3VIA A;  4K81 A;  4WVF B;  2EJ8 A;  3AU5 A;  2NZ8 B;  2RSG A;  3QWM A;  2UVM A;  2D9W A;  4MT7 A;  2EMT A;  1DRO A;  1I2H A;  2YF0 A;  4HAY B;  4F7U P;  4A6F B;  1MKE A;  2RLO A;  5KCV A;  1U5G A;  4KHB B;  3IVF A;  1Y19 B;  4HB4 B;  2W2X D;  3A8P A;  1XKE A;  5JLJ B;  2HE7 A;  1PFJ A;  2JP2 A;  1M7E A;  2MDX A;  4K17 A;  1K5D B;  1AQC A;  4EKU A;  1WJ1 A;  3ODX A;  1NTV A;  1J0W A;  4Z2M B;  1P5T A;  2DYN A;  1MK9 B;  1B55 A;  3GYO A;  1QQG A;  1PLS A;  4XWX A;  3LJU X;  3RCP A;  3TFM A;  4YL8 A;  3PEG A;  2I5C A;  2COF A;  5FI1 A;  1UNP A;  2IFS A;  2K00 A;  5C79 A;  5D3W A;  2YS3 A;  3UZT A;  2ELB A;  2LUL A;  2D9Z A;  1MIZ B;  2KCJ A;  2QKL A;  3HW2 B;  5DI9 B;  1V5P A;  4K2P A;  2D2Q A;  4A5K A;  1GC7 A;  1ZC3 B;  3ZVR A;  5HE2 A;  1ZSQ A;  4HB0 B;  1NTY A;  1WVH A;  2P0F A;  3PG7 A;  4DXA B;  2DHJ A;  4GMX B;  1Z87 A;  3SNH A;  2UZR A;  4F7H A;  4C0A A;  4WSF A;  2KGX B;  5C6R A;  4EMO A;  3WA0 A;  1TJ6 A;  2DX5 A;  2HTH B;  3T06 A;  1V61 A;  3ML4 A;  2ROZ B;  2UZS A;  1SGH A;  4A6H A;  5C16 A;  2EMS A;  2LOX A;  4CYE A;  2YS1 A;  2COC A;  2RNR B;  2GCL A;  1FB8 A;  4WJ7 A;  2RUK B;  1BTN A;  2AEH A;  3KSY A;  1XR0 B;  1EVH A;  2N0Y A;  1WG7 A;  1Y5O A;  1U2B A;  5JHH A;  1H10 A;  2P0D A;  1P6S A;  1LW3 A;  2E2X A;  2BCJ A;  3DXD A;  1U5F A;  2Y8F A;  2CRF A;  1DDV A;  1PMS A;  4HHV A;  3MDB C;  1Q67 A;  1UPQ A;  1W1H A;  2DHK A;  2Z0P A;  2DKQ A;  1W1G A;  2DN6 A;  2LYD A;  3X23 A;  1J19 A;  5LON B;  2J0J A;  2Y7B A;  2MKR A;  3PVL A;  1W1D A;  3SYX A;  5FI0 A;  3TO1 A;  2NMB A;  1KI1 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...