1W1DA

Crystal structure of the pdk1 pleckstrin homology (ph) domain bound to inositol (1,3,4,5)-tetrakisphosphate
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
143
structure length
143
Chain Sequence
PLGSNIEQYIHDLDSNSFELDLQFSEDEKRLLLEKQAGGNPWHQFVENNLILKMGPVDKRKGLFARRRQLLLTEGPHLYYVDPVNKVLKGEIPWSQELRPEAKNFKTFFVHTPNRTYYLMDPSGNAHKWCRKIQEVWRQRYQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Insights Into the Regulation of Pdk1 by Phosphoinositides and Inositol Phosphates
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords 3-PHOSPHOINOSITIDE DEPENDENT PROTEIN KINASE-1
total genus 38
structure length 143
sequence length 143
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2004-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14593 PH_3 PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1w1dA00
2DHKA 1UNRA 2FJLA 4DX8A 2AL6A 2XQNM 3AU4A 2V76A 1OQNA 1GC7A 4GXBA 2LKOA 1U29A 1WI1A 1GG3A 4HB0B 4C0AA 2D11A 3DXEA 4PQ0A 3PSCA 4HAYB 3GYPA 3DXDA 1N3HA 4MY6A 2ELBA 3BJIA 5L81A 4F7GA 1B55A 2X18A 1RRPB 3P6AA 4K2OA 4EKUA 2J59M 4Z2NA 3PVLA 1U2BA 3SNHA 1WG7A 4ZRIA 2RNRB 5D3XA 2YS3A 1H10A 3FM8C 2J0JA 2OQBA 1UPQA 4HAZB 2E2XA 5D27A 1W1DA 4GMXB 1AQCA 2YT0A 1UNPA 4IFSA 4EJNA 1BAKA 1P3RA 1Y5OA 2K2UA 4HB2B 3F0WA 1I7AA 4TKNA 4KVGB 5HE0A 2P0HA 1WGUA 5C5BA 5HE3A 1FOEA 5D3WA 1ZC3B 3PVUA 5KQ4A 1ZSQA 1J19A 3MPXA 3QIJA 4HB3B 4TYZA 1KZ7A 3MDBC 1SGHA 4K17A 2DKPA 3PP2A 4XWXA 2RVBB 2YT1A 2HTHB 4P7IA 4KAXB 3PG7A 1AWEA 1XKEA 3BINA 2NMBA 3D8EA 4K81A 4HAVB 2CODA 5HE2A 2M38A 3DXCA 1FHXA 3N7CA 1V5UA 1EVHA 2QKLA 2YF0A 3ODXA 4A6KA 2DLWA 5HE1A 1FHOA 2YSZA 4DXAB 1NTVA 1LB1A 2MKRA 3ULBA 2DHJA 5DIFB 2DYNA 4BBKA 2RSGA 2R0DA 4NSWA 2Z0OA 1W1HA 1V88A 1PLSA 2DX1A 1EF1A 3KSYA 1MPHA 4HDOA 5JP4A 3KRXA 5D3YA 2UZRA 5JLJB 1P6SA 3X23A 3PEGA 3A98B 4K2PA 1MKEA 3O96A 3SO6A 3PZDA 3HW2B 2D4QA 1MIXA 2GS0A 1M7EA 2N23A 1V61A 2P0FA 4YONA 1H4RA 2I1KA 2D10A 2W2WA 1IRSA 2LULA 4GZUA 3ULCA 2KUPA 1GC6A 1XR0B 5CLLB 1X1GA 1WVHA 2K2JA 3AU5A 3ODWA 1DDWA 5J3YA 3M1IB 2I1JA 2I5FA 2KGXB 3F5RA 3PVWA 3T06A 4DX90 2LYDA 3CXBB 4ZRKA 1V89A 2R09A 2NZ8B 3HK0A 2IFSA 5C79A 3U8ZA 2ZPYA 1RJ2A 4GPTB 2GJYA 2CY4A 4HAUB 5C6RA 2CY5A 1XX0A 1DROA 2DX5A 4IAPA 3HQCA 3ODOA 2ADZA 1PMSA 1WJ1A 3OANA 1DDVA 2G35A 1ZVRA 2CRFA 1X11A 5J3TA 2J0KA 1FHWA 1ZC4B 1PFJA 3IVFA 2COFA 2MWNB 4HDQA 2Z0QA 4A6FB 2LG1A 2EMSA 5C5BB 5LONB 5DHFB 1Y19B 4A6FA 5LOPB 2H7EA 1DDMA 5FI0A 1X86A 4DBBA 5KQ1A 4KHAA 1MK7B 4NY0A 2ELAA 4H8SA 2H7DA 4Y94A 5JHGA 2Z0PA 2MDXA 4A6HA 2N0YA 3ZVRA 3GYOA 5KCVA 2Y8GA 2RGNB 1J0WA 3VOQA 3TW1A 2Y7BA 4KHOA 1EGXA 4YL8A 1MIZB 1W1GA 3RCPA 1E5WA 2MFQA 1FGZA 2AEHA 3U7DA 2KCJA 1TXDA 2P8VA 1Z87A 1U5FA 2CAYA 2RUKB 3QBVB 1XCGA 1U5GA 2W2XC 4HB4B 2EJ8A 1XODA 1K5DB 1OY2A 1P5TA 1NU2A 3FSSA 2D9WA 5DI9B 1X1FA 3A8QA 2LOZA 2D2QA 4MK0A 3TVVA 2D9XA 4WSFA 4HHVA 1U27A 2DKQA 2L2IA 3LJUX 1DBHA 5GOWB 1BTKA 1QC6A 2BCJA 2M14A 2UVMA 2GCJA 5FI1A 1BWNA 2VRWB 1TQZA 3D8FA 3WA0A 2Q13A 3SV1A 4HAXB 2EC1A 2VKIA 3V5WA 3G9WA 3VIAA 3KZ1A 1XD4A 2YRYA 3UZTA 5EFXA 2ROVA 3QWMA 4CHMA 1EAZA 4HAWB 3D8DA 1NI2A 2VSZA 4D0NB 1UEFA 1WGQA 3TO1A 1BTNA 1OMWA 2IYBA 3TCAA 2DTCA 4GMVA 4KHBB 1FB8A 4CHJA 2UZSA 2QKMA 2DFKA 5CLQB 2YS1A 3ZDTA 4EMOA 2HE7A 3A8PA 1MAIA 2RLOA 2PZ1A 1KZGA 1DYNA 1WJMA 1MK9B 2EMTA 2D9ZA 1TJ6A 2D9YA 2DN6A 1M7RA 1FAOA 2DYQA 2YS5A 1NTYA 5C16A 4PNKA 2P0DA 1FGYA 2OTXA 1KI1B 3FEHA 5D3VA 2GCLA 3ML4A 4MT7A 5DH9B 4ZRJA 2LOXA 2Y8FA 1UPRA 4A5KA 2ROZB 4CYEA 1QQGA 2K00A 1Q67A 2COCA 1LW3A 4HATB 2I5CA 2DHIA 1U5EA 2DA0A 3P7ZA 1V5PA 2COAA 5J3QA 2D9VA 1I2HA 3AJ4A 1SHCA 4WVFB 3SYXA 4B6HA 2J0MA 1V5MA 1K5GB 1ZM0A 4IOYX 4L6EA 3KY9A 2L1CA 3NSUA 1UNQA 2YVCA 3KRWA 3SUZA 5JHHA 1X05A 2JP2A 1ISNA 3CIKA 4GN1A 3WYFB 4F7HA 3TFMA 2W2XD 5DHAB 4F7UP 4Z2MB 4WJ7A 1U5DA
chains in the Genus database with same CATH superfamily
2DHKA 1UNRA 2FJLA 4DX8A 2AL6A 2XQNM 3AU4A 2V76A 1OQNA 1GC7A 4GXBA 2LKOA 1U29A 1WI1A 1GG3A 4HB0B 4C0AA 2D11A 3DXEA 4PQ0A 3PSCA 4HAYB 3GYPA 3DXDA 1N3HA 4MY6A 2R2YA 4HSIA 2ELBA 3BJIA 5L81A 4F7GA 1B55A 2X18A 1RRPB 3P6AA 4K2OA 4EKUA 2J59M 4Z2NA 3PVLA 1U2BA 3SNHA 1WG7A 4ZRIA 2RNRB 5D3XA 2YS3A 1H10A 3FM8C 2J0JA 2OQBA 1UPQA 2KIEA 4HAZB 2E2XA 5D27A 1W1DA 4GMXB 1AQCA 2YT0A 1UNPA 4IFSA 4EJNA 3DCXA 2FJUB 1BAKA 1P3RA 1Y5OA 2K2UA 4HB2B 3F0WA 1I7AA 4TKNA 4KVGB 5HE0A 2P0HA 1WGUA 5C5BA 5HE3A 1FOEA 5D3WA 1ZC3B 3PVUA 5KQ4A 1ZSQA 2RRFA 1J19A 3MPXA 3QIJA 4HB3B 4TYZA 1KZ7A 3MDBC 3NW8A 1SGHA 3NWFA 4K17A 2DKPA 3PP2A 4XWXA 2RVBB 2YT1A 2HTHB 4P7IA 4KAXB 3PG7A 1AWEA 1XKEA 3BINA 2NMBA 3D8EA 4KHBA 4K81A 4HAVB 2CODA 5HE2A 2M38A 3DXCA 1FHXA 3N7CA 1V5UA 1EVHA 2QKLA 2YF0A 3ODXA 4A6KA 2DLWA 5HE1A 1FHOA 2YSZA 4DXAB 1NTVA 1LB1A 2MKRA 3ULBA 2DHJA 5DIFB 2DYNA 4BBKA 2RSGA 2R0DA 4NSWA 2Z0OA 1W1HA 1V88A 1PLSA 2YT2A 2DX1A 1EF1A 3KSYA 5IRSA 1MPHA 4HDOA 5JP4A 3KRXA 5D3YA 2UZRA 5JLJB 1P6SA 4QJ3B 3X23A 3PEGA 3A98B 4K2PA 1MKEA 3O96A 3SO6A 3PZDA 3HW2B 2D4QA 1MIXA 2GS0A 1M7EA 2N23A 1V61A 2P0FA 2K49A 4F7UP 4YONA 1H4RA 2I1KA 4QXAB 2D10A 2W2WA 1IRSA 2LULA 4GZUA 3FVCA 3ULCA 2KUPA 1GC6A 1XR0B 5CLLB 1X1GA 1WVHA 2K2JA 3AU5A 3ODWA 1DDWA 5J3YA 3M1IB 2I1JA 2I5FA 2KGXB 3F5RA 3PVWA 3T06A 4DX90 2LYDA 3CXBB 4ZRKA 1V89A 2R09A 5I2SA 2NZ8B 3HK0A 2IFSA 5C79A 3U8ZA 2ZPYA 1RJ2A 4GPTB 2GJYA 4CSQA 2CY4A 4HAUB 5C6RA 2CY5A 1XX0A 1DROA 2DX5A 4IAPA 2NBVA 3HQCA 3ODOA 2ADZA 1PMSA 1WJ1A 3OANA 1DDVA 2G35A 1ZVRA 2CRFA 1X11A 5J3TA 2J0KA 1FHWA 1ZC4B 1PFJA 3IVFA 4QJ4B 2COFA 2MWNB 4HDQA 2Z0QA 4A6FB 2LG1A 2EMSA 5C5BB 5LONB 5DHFB 1Y19B 2GUMA 4A6FA 5LOPB 2H7EA 1DDMA 5FI0A 1X86A 4DBBA 1ZYIA 5KQ1A 4KHAA 3OHMB 1MK7B 4NY0A 2ELAA 4H8SA 2H7DA 2K8EA 4Y94A 5JHGA 2Z0PA 2MDXA 4A6HA 2N0YA 3ZVRA 3GYOA 4OT1A 5KCVA 2Y8GA 2RGNB 1J0WA 3VOQA 3TW1A 2Y7BA 4KHOA 1EGXA 4YL8A 1MIZB 1W1GA 3RCPA 1E5WA 4D6WA 2MFQA 3NWDA 1FGZA 2AEHA 3HSAA 3U7DA 2KCJA 1TXDA 2P8VA 1Z87A 3NWAA 4DIXA 1U5FA 2CAYA 2RUKB 3QBVB 1XCGA 1U5GA 2W2XC 4HB4B 2EJ8A 1XODA 1K5DB 4OSNA 1OY2A 1P5TA 1NU2A 3FSSA 2D9WA 5DI9B 1X1FA 3A8QA 2LOZA 2D2QA 5M4YB 4MK0A 3TVVA 2D9XA 4GOUA 4WSFA 4HHVA 1U27A 2DKQA 2L2IA 3LJUX 1DBHA 5GOWB 1BTKA 1QC6A 2BCJA 2M14A 2UVMA 2GCJA 5FI1A 1BWNA 2VRWB 1TQZA 3D8FA 3WA0A 3U12A 2Q13A 3SV1A 4HAXB 2EC1A 2VKIA 3V5WA 3G9WA 3VIAA 3KZ1A 1XD4A 2YRYA 3UZTA 5EFXA 2ROVA 3QWMA 2Z4DA 4CHMA 2KIGA 1EAZA 3HIEA 4HAWB 4L1RA 3D8DA 1NI2A 2VSZA 4D0NB 3B77A 1UEFA 1WGQA 3TO1A 4QJ5B 1BTNA 2Z59A 1OMWA 2IYBA 3TCAA 2DTCA 4GMVA 4KHBB 1FB8A 1T77A 4CHJA 2UZSA 2QKMA 2DFKA 5CLQB 2YS1A 3ZDTA 4EMOA 2HE7A 3A58A 3A8PA 1MAIA 2RLOA 2PZ1A 5LG4B 1KZGA 1DYNA 1WJMA 1MK9B 2EMTA 2D9ZA 1TJ6A 2D9YA 2DN6A 1M7RA 1FAOA 2DYQA 2YS5A 1NTYA 5C16A 4PNKA 2P0DA 1FGYA 2OTXA 1KI1B 3FEHA 5D3VA 2GCLA 3ML4A 2KR0A 4MT7A 5DH9B 2KUQA 4ZRJA 2LOXA 2Y8FA 1UPRA 4A5KA 2ROZB 4CYEA 5I2MA 1QQGA 2K00A 1Q67A 2COCA 2Z14A 1LW3A 4HATB 2I5CA 2DHIA 4GNKB 1U5EA 2DA0A 3P7ZA 1V5PA 2COAA 5J3QA 2D9VA 1MI1A 1I2HA 3AJ4A 1SHCA 4WVFB 3SYXA 4B6HA 2J0MA 1V5MA 2Z13A 1K5GB 1ZM0A 4IOYX 4L6EA 3KY9A 2L1CA 3NSUA 1UNQA 2YVCA 3KRWA 3SUZA 5JHHA 1X05A 2JP2A 1ISNA 3CIKA 4GN1A 3WYFB 4F7HA 3TFMA 2W2XD 5DHAB 2ZKMX 4Z2MB 4WJ7A 1U5DA
chains in the Genus database with same CATH topology
2DHKA 1UNRA 2FJLA 4DX8A 2AL6A 2XQNM 3AU4A 2V76A 1OQNA 1GC7A 4GXBA 2LKOA 1U29A 1WI1A 1GG3A 4HB0B 4C0AA 2D11A 3DXEA 4PQ0A 3PSCA 4HAYB 3GYPA 3DXDA 1N3HA 4MY6A 2ELBA 3BJIA 5L81A 4F7GA 1B55A 2X18A 1RRPB 3P6AA 4K2OA 4EKUA 2J59M 4Z2NA 3PVLA 1U2BA 3SNHA 1WG7A 4ZRIA 2RNRB 5D3XA 2YS3A 1H10A 3FM8C 2J0JA 2OQBA 1UPQA 4HAZB 2E2XA 5D27A 1W1DA 4GMXB 1AQCA 2YT0A 1UNPA 4IFSA 4EJNA 1BAKA 1P3RA 1Y5OA 2K2UA 4HB2B 3F0WA 1I7AA 4TKNA 4KVGB 5HE0A 2P0HA 1WGUA 5C5BA 5HE3A 1FOEA 5D3WA 1ZC3B 3PVUA 5KQ4A 1ZSQA 1J19A 3MPXA 3QIJA 4HB3B 4TYZA 1KZ7A 3MDBC 1SGHA 4K17A 2DKPA 3PP2A 4XWXA 2RVBB 2YT1A 2HTHB 4P7IA 4KAXB 3PG7A 1AWEA 1XKEA 3BINA 2NMBA 3D8EA 4K81A 4HAVB 2CODA 5HE2A 2M38A 3DXCA 1FHXA 3N7CA 1V5UA 1EVHA 2QKLA 2YF0A 3ODXA 4A6KA 2DLWA 5HE1A 1FHOA 2YSZA 4DXAB 1NTVA 1LB1A 2MKRA 3ULBA 2DHJA 5DIFB 2DYNA 4BBKA 2RSGA 2R0DA 4NSWA 2Z0OA 1W1HA 1V88A 1PLSA 2DX1A 1EF1A 3KSYA 1MPHA 4HDOA 5JP4A 3KRXA 5D3YA 2UZRA 5JLJB 1P6SA 3X23A 3PEGA 3A98B 4K2PA 1MKEA 3O96A 3SO6A 3PZDA 3HW2B 2D4QA 1MIXA 2GS0A 1M7EA 2N23A 1V61A 2P0FA 4YONA 1H4RA 2I1KA 2D10A 2W2WA 1IRSA 2LULA 4GZUA 3ULCA 2KUPA 1GC6A 1XR0B 5CLLB 1X1GA 1WVHA 2K2JA 3AU5A 3ODWA 1DDWA 5J3YA 3M1IB 2I1JA 2I5FA 2KGXB 3F5RA 3PVWA 3T06A 4DX90 2LYDA 3CXBB 4ZRKA 1V89A 2R09A 2NZ8B 3HK0A 2IFSA 5C79A 3U8ZA 2ZPYA 1RJ2A 4GPTB 2GJYA 2CY4A 4HAUB 5C6RA 2CY5A 1XX0A 1DROA 2DX5A 4IAPA 3HQCA 3ODOA 2ADZA 1PMSA 1WJ1A 3OANA 1DDVA 2G35A 1ZVRA 2CRFA 1X11A 5J3TA 2J0KA 1FHWA 1ZC4B 1PFJA 3IVFA 2COFA 2MWNB 4HDQA 2Z0QA 4A6FB 2LG1A 2EMSA 5C5BB 5LONB 5DHFB 1Y19B 4A6FA 5LOPB 2H7EA 1DDMA 5FI0A 1X86A 4DBBA 5KQ1A 4KHAA 1MK7B 4NY0A 2ELAA 4H8SA 2H7DA 4Y94A 5JHGA 2Z0PA 2MDXA 4A6HA 2N0YA 3ZVRA 3GYOA 5KCVA 2Y8GA 2RGNB 1J0WA 3VOQA 3TW1A 2Y7BA 4KHOA 1EGXA 4YL8A 1MIZB 1W1GA 3RCPA 1E5WA 2MFQA 1FGZA 2AEHA 3U7DA 2KCJA 1TXDA 2P8VA 1Z87A 1U5FA 2CAYA 2RUKB 3QBVB 1XCGA 1U5GA 2W2XC 4HB4B 2EJ8A 1XODA 1K5DB 1OY2A 1P5TA 1NU2A 3FSSA 2D9WA 5DI9B 1X1FA 3A8QA 2LOZA 2D2QA 4MK0A 3TVVA 2D9XA 4WSFA 4HHVA 1U27A 2DKQA 2L2IA 3LJUX 1DBHA 5GOWB 1BTKA 1QC6A 2BCJA 2M14A 2UVMA 2GCJA 5FI1A 1BWNA 2VRWB 1TQZA 3D8FA 3WA0A 2Q13A 3SV1A 4HAXB 2EC1A 2VKIA 3V5WA 3G9WA 3VIAA 3KZ1A 1XD4A 2YRYA 3UZTA 5EFXA 2ROVA 3QWMA 4CHMA 1EAZA 4HAWB 3D8DA 1NI2A 2VSZA 4D0NB 1UEFA 1WGQA 3TO1A 1BTNA 1OMWA 2IYBA 3TCAA 2DTCA 4GMVA 4KHBB 1FB8A 4CHJA 2UZSA 2QKMA 2DFKA 5CLQB 2YS1A 3ZDTA 4EMOA 2HE7A 3A8PA 1MAIA 2RLOA 2PZ1A 1KZGA 1DYNA 1WJMA 1MK9B 2EMTA 2D9ZA 1TJ6A 2D9YA 2DN6A 1M7RA 1FAOA 2DYQA 2YS5A 1NTYA 5C16A 4PNKA 2P0DA 1FGYA 2OTXA 1KI1B 3FEHA 5D3VA 2GCLA 3ML4A 4MT7A 5DH9B 4ZRJA 2LOXA 2Y8FA 1UPRA 4A5KA 2ROZB 4CYEA 1QQGA 2K00A 1Q67A 2COCA 1LW3A 4HATB 2I5CA 2DHIA 1U5EA 2DA0A 3P7ZA 1V5PA 2COAA 5J3QA 2D9VA 1I2HA 3AJ4A 1SHCA 4WVFB 3SYXA 4B6HA 2J0MA 1V5MA 1K5GB 1ZM0A 4IOYX 4L6EA 3KY9A 2L1CA 3NSUA 1UNQA 2YVCA 3KRWA 3SUZA 5JHHA 1X05A 2JP2A 1ISNA 3CIKA 4GN1A 3WYFB 4F7HA 3TFMA 2W2XD 5DHAB 4F7UP 4Z2MB 4WJ7A 1U5DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DHK A;  1UNR A;  2FJL A;  4DX8 A;  2AL6 A;  2XQN M;  3AU4 A;  2V76 A;  1OQN A;  1GC7 A;  4GXB A;  2LKO A;  1U29 A;  1WI1 A;  1GG3 A;  4HB0 B;  4C0A A;  2D11 A;  3DXE A;  4PQ0 A;  3PSC A;  4HAY B;  3GYP A;  3DXD A;  1N3H A;  4MY6 A;  2ELB A;  3BJI A;  5L81 A;  4F7G A;  1B55 A;  2X18 A;  1RRP B;  3P6A A;  4K2O A;  4EKU A;  2J59 M;  4Z2N A;  3PVL A;  1U2B A;  3SNH A;  1WG7 A;  4ZRI A;  2RNR B;  5D3X A;  2YS3 A;  1H10 A;  3FM8 C;  2J0J A;  2OQB A;  1UPQ A;  4HAZ B;  2E2X A;  5D27 A;  1W1D A;  4GMX B;  1AQC A;  2YT0 A;  1UNP A;  4IFS A;  4EJN A;  1BAK A;  1P3R A;  1Y5O A;  2K2U A;  4HB2 B;  3F0W A;  1I7A A;  4TKN A;  4KVG B;  5HE0 A;  2P0H A;  1WGU A;  5C5B A;  5HE3 A;  1FOE A;  5D3W A;  1ZC3 B;  3PVU A;  5KQ4 A;  1ZSQ A;  1J19 A;  3MPX A;  3QIJ A;  4HB3 B;  4TYZ A;  1KZ7 A;  3MDB C;  1SGH A;  4K17 A;  2DKP A;  3PP2 A;  4XWX A;  2RVB B;  2YT1 A;  2HTH B;  4P7I A;  4KAX B;  3PG7 A;  1AWE A;  1XKE A;  3BIN A;  2NMB A;  3D8E A;  4K81 A;  4HAV B;  2COD A;  5HE2 A;  2M38 A;  3DXC A;  1FHX A;  3N7C A;  1V5U A;  1EVH A;  2QKL A;  2YF0 A;  3ODX A;  4A6K A;  2DLW A;  5HE1 A;  1FHO A;  2YSZ A;  4DXA B;  1NTV A;  1LB1 A;  2MKR A;  3ULB A;  2DHJ A;  5DIF B;  2DYN A;  4BBK A;  2RSG A;  2R0D A;  4NSW A;  2Z0O A;  1W1H A;  1V88 A;  1PLS A;  2DX1 A;  1EF1 A;  3KSY A;  1MPH A;  4HDO A;  5JP4 A;  3KRX A;  5D3Y A;  2UZR A;  5JLJ B;  1P6S A;  3X23 A;  3PEG A;  3A98 B;  4K2P A;  1MKE A;  3O96 A;  3SO6 A;  3PZD A;  3HW2 B;  2D4Q A;  1MIX A;  2GS0 A;  1M7E A;  2N23 A;  1V61 A;  2P0F A;  4YON A;  1H4R A;  2I1K A;  2D10 A;  2W2W A;  1IRS A;  2LUL A;  4GZU A;  3ULC A;  2KUP A;  1GC6 A;  1XR0 B;  5CLL B;  1X1G A;  1WVH A;  2K2J A;  3AU5 A;  3ODW A;  1DDW A;  5J3Y A;  3M1I B;  2I1J A;  2I5F A;  2KGX B;  3F5R A;  3PVW A;  3T06 A;  4DX9 0;  2LYD A;  3CXB B;  4ZRK A;  1V89 A;  2R09 A;  2NZ8 B;  3HK0 A;  2IFS A;  5C79 A;  3U8Z A;  2ZPY A;  1RJ2 A;  4GPT B;  2GJY A;  2CY4 A;  4HAU B;  5C6R A;  2CY5 A;  1XX0 A;  1DRO A;  2DX5 A;  4IAP A;  3HQC A;  3ODO A;  2ADZ A;  1PMS A;  1WJ1 A;  3OAN A;  1DDV A;  2G35 A;  1ZVR A;  2CRF A;  1X11 A;  5J3T A;  2J0K A;  1FHW A;  1ZC4 B;  1PFJ A;  3IVF A;  2COF A;  2MWN B;  4HDQ A;  2Z0Q A;  4A6F B;  2LG1 A;  2EMS A;  5C5B B;  5LON B;  5DHF B;  1Y19 B;  4A6F A;  5LOP B;  2H7E A;  1DDM A;  5FI0 A;  1X86 A;  4DBB A;  5KQ1 A;  4KHA A;  1MK7 B;  4NY0 A;  2ELA A;  4H8S A;  2H7D A;  4Y94 A;  5JHG A;  2Z0P A;  2MDX A;  4A6H A;  2N0Y A;  3ZVR A;  3GYO A;  5KCV A;  2Y8G A;  2RGN B;  1J0W A;  3VOQ A;  3TW1 A;  2Y7B A;  4KHO A;  1EGX A;  4YL8 A;  1MIZ B;  1W1G A;  3RCP A;  1E5W A;  2MFQ A;  1FGZ A;  2AEH A;  3U7D A;  2KCJ A;  1TXD A;  2P8V A;  1Z87 A;  1U5F A;  2CAY A;  2RUK B;  3QBV B;  1XCG A;  1U5G A;  2W2X C;  4HB4 B;  2EJ8 A;  1XOD A;  1K5D B;  1OY2 A;  1P5T A;  1NU2 A;  3FSS A;  2D9W A;  5DI9 B;  1X1F A;  3A8Q A;  2LOZ A;  2D2Q A;  4MK0 A;  3TVV A;  2D9X A;  4WSF A;  4HHV A;  1U27 A;  2DKQ A;  2L2I A;  3LJU X;  1DBH A;  5GOW B;  1BTK A;  1QC6 A;  2BCJ A;  2M14 A;  2UVM A;  2GCJ A;  5FI1 A;  1BWN A;  2VRW B;  1TQZ A;  3D8F A;  3WA0 A;  2Q13 A;  3SV1 A;  4HAX B;  2EC1 A;  2VKI A;  3V5W A;  3G9W A;  3VIA A;  3KZ1 A;  1XD4 A;  2YRY A;  3UZT A;  5EFX A;  2ROV A;  3QWM A;  4CHM A;  1EAZ A;  4HAW B;  3D8D A;  1NI2 A;  2VSZ A;  4D0N B;  1UEF A;  1WGQ A;  3TO1 A;  1BTN A;  1OMW A;  2IYB A;  3TCA A;  2DTC A;  4GMV A;  4KHB B;  1FB8 A;  4CHJ A;  2UZS A;  2QKM A;  2DFK A;  5CLQ B;  2YS1 A;  3ZDT A;  4EMO A;  2HE7 A;  3A8P A;  1MAI A;  2RLO A;  2PZ1 A;  1KZG A;  1DYN A;  1WJM A;  1MK9 B;  2EMT A;  2D9Z A;  1TJ6 A;  2D9Y A;  2DN6 A;  1M7R A;  1FAO A;  2DYQ A;  2YS5 A;  1NTY A;  5C16 A;  4PNK A;  2P0D A;  1FGY A;  2OTX A;  1KI1 B;  3FEH A;  5D3V A;  2GCL A;  3ML4 A;  4MT7 A;  5DH9 B;  4ZRJ A;  2LOX A;  2Y8F A;  1UPR A;  4A5K A;  2ROZ B;  4CYE A;  1QQG A;  2K00 A;  1Q67 A;  2COC A;  1LW3 A;  4HAT B;  2I5C A;  2DHI A;  1U5E A;  2DA0 A;  3P7Z A;  1V5P A;  2COA A;  5J3Q A;  2D9V A;  1I2H A;  3AJ4 A;  1SHC A;  4WVF B;  3SYX A;  4B6H A;  2J0M A;  1V5M A;  1K5G B;  1ZM0 A;  4IOY X;  4L6E A;  3KY9 A;  2L1C A;  3NSU A;  1UNQ A;  2YVC A;  3KRW A;  3SUZ A;  5JHH A;  1X05 A;  2JP2 A;  1ISN A;  3CIK A;  4GN1 A;  3WYF B;  4F7H A;  3TFM A;  2W2X D;  5DHA B;  4F7U P;  4Z2M B;  4WJ7 A;  1U5D A; 
#chains in the Genus database with same CATH topology
 2DHK A;  1UNR A;  2FJL A;  4DX8 A;  2AL6 A;  2XQN M;  3AU4 A;  2V76 A;  1OQN A;  1GC7 A;  4GXB A;  2LKO A;  1U29 A;  1WI1 A;  1GG3 A;  4HB0 B;  4C0A A;  2D11 A;  3DXE A;  4PQ0 A;  3PSC A;  4HAY B;  3GYP A;  3DXD A;  1N3H A;  4MY6 A;  2R2Y A;  4HSI A;  2ELB A;  3BJI A;  5L81 A;  4F7G A;  1B55 A;  2X18 A;  1RRP B;  3P6A A;  4K2O A;  4EKU A;  2J59 M;  4Z2N A;  3PVL A;  1U2B A;  3SNH A;  1WG7 A;  4ZRI A;  2RNR B;  5D3X A;  2YS3 A;  1H10 A;  3FM8 C;  2J0J A;  2OQB A;  1UPQ A;  2KIE A;  4HAZ B;  2E2X A;  5D27 A;  1W1D A;  4GMX B;  1AQC A;  2YT0 A;  1UNP A;  4IFS A;  4EJN A;  3DCX A;  2FJU B;  1BAK A;  1P3R A;  1Y5O A;  2K2U A;  4HB2 B;  3F0W A;  1I7A A;  4TKN A;  4KVG B;  5HE0 A;  2P0H A;  1WGU A;  5C5B A;  5HE3 A;  1FOE A;  5D3W A;  1ZC3 B;  3PVU A;  5KQ4 A;  1ZSQ A;  2RRF A;  1J19 A;  3MPX A;  3QIJ A;  4HB3 B;  4TYZ A;  1KZ7 A;  3MDB C;  3NW8 A;  1SGH A;  3NWF A;  4K17 A;  2DKP A;  3PP2 A;  4XWX A;  2RVB B;  2YT1 A;  2HTH B;  4P7I A;  4KAX B;  3PG7 A;  1AWE A;  1XKE A;  3BIN A;  2NMB A;  3D8E A;  4KHB A;  4K81 A;  4HAV B;  2COD A;  5HE2 A;  2M38 A;  3DXC A;  1FHX A;  3N7C A;  1V5U A;  1EVH A;  2QKL A;  2YF0 A;  3ODX A;  4A6K A;  2DLW A;  5HE1 A;  1FHO A;  2YSZ A;  4DXA B;  1NTV A;  1LB1 A;  2MKR A;  3ULB A;  2DHJ A;  5DIF B;  2DYN A;  4BBK A;  2RSG A;  2R0D A;  4NSW A;  2Z0O A;  1W1H A;  1V88 A;  1PLS A;  2YT2 A;  2DX1 A;  1EF1 A;  3KSY A;  5IRS A;  1MPH A;  4HDO A;  5JP4 A;  3KRX A;  5D3Y A;  2UZR A;  5JLJ B;  1P6S A;  4QJ3 B;  3X23 A;  3PEG A;  3A98 B;  4K2P A;  1MKE A;  3O96 A;  3SO6 A;  3PZD A;  3HW2 B;  2D4Q A;  1MIX A;  2GS0 A;  1M7E A;  2N23 A;  1V61 A;  2P0F A;  2K49 A;  4F7U P;  4YON A;  1H4R A;  2I1K A;  4QXA B;  2D10 A;  2W2W A;  1IRS A;  2LUL A;  4GZU A;  3FVC A;  3ULC A;  2KUP A;  1GC6 A;  1XR0 B;  5CLL B;  1X1G A;  1WVH A;  2K2J A;  3AU5 A;  3ODW A;  1DDW A;  5J3Y A;  3M1I B;  2I1J A;  2I5F A;  2KGX B;  3F5R A;  3PVW A;  3T06 A;  4DX9 0;  2LYD A;  3CXB B;  4ZRK A;  1V89 A;  2R09 A;  5I2S A;  2NZ8 B;  3HK0 A;  2IFS A;  5C79 A;  3U8Z A;  2ZPY A;  1RJ2 A;  4GPT B;  2GJY A;  4CSQ A;  2CY4 A;  4HAU B;  5C6R A;  2CY5 A;  1XX0 A;  1DRO A;  2DX5 A;  4IAP A;  2NBV A;  3HQC A;  3ODO A;  2ADZ A;  1PMS A;  1WJ1 A;  3OAN A;  1DDV A;  2G35 A;  1ZVR A;  2CRF A;  1X11 A;  5J3T A;  2J0K A;  1FHW A;  1ZC4 B;  1PFJ A;  3IVF A;  4QJ4 B;  2COF A;  2MWN B;  4HDQ A;  2Z0Q A;  4A6F B;  2LG1 A;  2EMS A;  5C5B B;  5LON B;  5DHF B;  1Y19 B;  2GUM A;  4A6F A;  5LOP B;  2H7E A;  1DDM A;  5FI0 A;  1X86 A;  4DBB A;  1ZYI A;  5KQ1 A;  4KHA A;  3OHM B;  1MK7 B;  4NY0 A;  2ELA A;  4H8S A;  2H7D A;  2K8E A;  4Y94 A;  5JHG A;  2Z0P A;  2MDX A;  4A6H A;  2N0Y A;  3ZVR A;  3GYO A;  4OT1 A;  5KCV A;  2Y8G A;  2RGN B;  1J0W A;  3VOQ A;  3TW1 A;  2Y7B A;  4KHO A;  1EGX A;  4YL8 A;  1MIZ B;  1W1G A;  3RCP A;  1E5W A;  4D6W A;  2MFQ A;  3NWD A;  1FGZ A;  2AEH A;  3HSA A;  3U7D A;  2KCJ A;  1TXD A;  2P8V A;  1Z87 A;  3NWA A;  4DIX A;  1U5F A;  2CAY A;  2RUK B;  3QBV B;  1XCG A;  1U5G A;  2W2X C;  4HB4 B;  2EJ8 A;  1XOD A;  1K5D B;  4OSN A;  1OY2 A;  1P5T A;  1NU2 A;  3FSS A;  2D9W A;  5DI9 B;  1X1F A;  3A8Q A;  2LOZ A;  2D2Q A;  5M4Y B;  4MK0 A;  3TVV A;  2D9X A;  4GOU A;  4WSF A;  4HHV A;  1U27 A;  2DKQ A;  2L2I A;  3LJU X;  1DBH A;  5GOW B;  1BTK A;  1QC6 A;  2BCJ A;  2M14 A;  2UVM A;  2GCJ A;  5FI1 A;  1BWN A;  2VRW B;  1TQZ A;  3D8F A;  3WA0 A;  3U12 A;  2Q13 A;  3SV1 A;  4HAX B;  2EC1 A;  2VKI A;  3V5W A;  3G9W A;  3VIA A;  3KZ1 A;  1XD4 A;  2YRY A;  3UZT A;  5EFX A;  2ROV A;  3QWM A;  2Z4D A;  4CHM A;  2KIG A;  1EAZ A;  3HIE A;  4HAW B;  4L1R A;  3D8D A;  1NI2 A;  2VSZ A;  4D0N B;  3B77 A;  1UEF A;  1WGQ A;  3TO1 A;  4QJ5 B;  1BTN A;  2Z59 A;  1OMW A;  2IYB A;  3TCA A;  2DTC A;  4GMV A;  4KHB B;  1FB8 A;  1T77 A;  4CHJ A;  2UZS A;  2QKM A;  2DFK A;  5CLQ B;  2YS1 A;  3ZDT A;  4EMO A;  2HE7 A;  3A58 A;  3A8P A;  1MAI A;  2RLO A;  2PZ1 A;  5LG4 B;  1KZG A;  1DYN A;  1WJM A;  1MK9 B;  2EMT A;  2D9Z A;  1TJ6 A;  2D9Y A;  2DN6 A;  1M7R A;  1FAO A;  2DYQ A;  2YS5 A;  1NTY A;  5C16 A;  4PNK A;  2P0D A;  1FGY A;  2OTX A;  1KI1 B;  3FEH A;  5D3V A;  2GCL A;  3ML4 A;  2KR0 A;  4MT7 A;  5DH9 B;  2KUQ A;  4ZRJ A;  2LOX A;  2Y8F A;  1UPR A;  4A5K A;  2ROZ B;  4CYE A;  5I2M A;  1QQG A;  2K00 A;  1Q67 A;  2COC A;  2Z14 A;  1LW3 A;  4HAT B;  2I5C A;  2DHI A;  4GNK B;  1U5E A;  2DA0 A;  3P7Z A;  1V5P A;  2COA A;  5J3Q A;  2D9V A;  1MI1 A;  1I2H A;  3AJ4 A;  1SHC A;  4WVF B;  3SYX A;  4B6H A;  2J0M A;  1V5M A;  2Z13 A;  1K5G B;  1ZM0 A;  4IOY X;  4L6E A;  3KY9 A;  2L1C A;  3NSU A;  1UNQ A;  2YVC A;  3KRW A;  3SUZ A;  5JHH A;  1X05 A;  2JP2 A;  1ISN A;  3CIK A;  4GN1 A;  3WYF B;  4F7H A;  3TFM A;  2W2X D;  5DHA B;  2ZKM X;  4Z2M B;  4WJ7 A;  1U5D A; 
#chains in the Genus database with same CATH homology
 2DHK A;  1UNR A;  2FJL A;  4DX8 A;  2AL6 A;  2XQN M;  3AU4 A;  2V76 A;  1OQN A;  1GC7 A;  4GXB A;  2LKO A;  1U29 A;  1WI1 A;  1GG3 A;  4HB0 B;  4C0A A;  2D11 A;  3DXE A;  4PQ0 A;  3PSC A;  4HAY B;  3GYP A;  3DXD A;  1N3H A;  4MY6 A;  2ELB A;  3BJI A;  5L81 A;  4F7G A;  1B55 A;  2X18 A;  1RRP B;  3P6A A;  4K2O A;  4EKU A;  2J59 M;  4Z2N A;  3PVL A;  1U2B A;  3SNH A;  1WG7 A;  4ZRI A;  2RNR B;  5D3X A;  2YS3 A;  1H10 A;  3FM8 C;  2J0J A;  2OQB A;  1UPQ A;  4HAZ B;  2E2X A;  5D27 A;  1W1D A;  4GMX B;  1AQC A;  2YT0 A;  1UNP A;  4IFS A;  4EJN A;  1BAK A;  1P3R A;  1Y5O A;  2K2U A;  4HB2 B;  3F0W A;  1I7A A;  4TKN A;  4KVG B;  5HE0 A;  2P0H A;  1WGU A;  5C5B A;  5HE3 A;  1FOE A;  5D3W A;  1ZC3 B;  3PVU A;  5KQ4 A;  1ZSQ A;  1J19 A;  3MPX A;  3QIJ A;  4HB3 B;  4TYZ A;  1KZ7 A;  3MDB C;  1SGH A;  4K17 A;  2DKP A;  3PP2 A;  4XWX A;  2RVB B;  2YT1 A;  2HTH B;  4P7I A;  4KAX B;  3PG7 A;  1AWE A;  1XKE A;  3BIN A;  2NMB A;  3D8E A;  4K81 A;  4HAV B;  2COD A;  5HE2 A;  2M38 A;  3DXC A;  1FHX A;  3N7C A;  1V5U A;  1EVH A;  2QKL A;  2YF0 A;  3ODX A;  4A6K A;  2DLW A;  5HE1 A;  1FHO A;  2YSZ A;  4DXA B;  1NTV A;  1LB1 A;  2MKR A;  3ULB A;  2DHJ A;  5DIF B;  2DYN A;  4BBK A;  2RSG A;  2R0D A;  4NSW A;  2Z0O A;  1W1H A;  1V88 A;  1PLS A;  2DX1 A;  1EF1 A;  3KSY A;  1MPH A;  4HDO A;  5JP4 A;  3KRX A;  5D3Y A;  2UZR A;  5JLJ B;  1P6S A;  3X23 A;  3PEG A;  3A98 B;  4K2P A;  1MKE A;  3O96 A;  3SO6 A;  3PZD A;  3HW2 B;  2D4Q A;  1MIX A;  2GS0 A;  1M7E A;  2N23 A;  1V61 A;  2P0F A;  4YON A;  1H4R A;  2I1K A;  2D10 A;  2W2W A;  1IRS A;  2LUL A;  4GZU A;  3ULC A;  2KUP A;  1GC6 A;  1XR0 B;  5CLL B;  1X1G A;  1WVH A;  2K2J A;  3AU5 A;  3ODW A;  1DDW A;  5J3Y A;  3M1I B;  2I1J A;  2I5F A;  2KGX B;  3F5R A;  3PVW A;  3T06 A;  4DX9 0;  2LYD A;  3CXB B;  4ZRK A;  1V89 A;  2R09 A;  2NZ8 B;  3HK0 A;  2IFS A;  5C79 A;  3U8Z A;  2ZPY A;  1RJ2 A;  4GPT B;  2GJY A;  2CY4 A;  4HAU B;  5C6R A;  2CY5 A;  1XX0 A;  1DRO A;  2DX5 A;  4IAP A;  3HQC A;  3ODO A;  2ADZ A;  1PMS A;  1WJ1 A;  3OAN A;  1DDV A;  2G35 A;  1ZVR A;  2CRF A;  1X11 A;  5J3T A;  2J0K A;  1FHW A;  1ZC4 B;  1PFJ A;  3IVF A;  2COF A;  2MWN B;  4HDQ A;  2Z0Q A;  4A6F B;  2LG1 A;  2EMS A;  5C5B B;  5LON B;  5DHF B;  1Y19 B;  4A6F A;  5LOP B;  2H7E A;  1DDM A;  5FI0 A;  1X86 A;  4DBB A;  5KQ1 A;  4KHA A;  1MK7 B;  4NY0 A;  2ELA A;  4H8S A;  2H7D A;  4Y94 A;  5JHG A;  2Z0P A;  2MDX A;  4A6H A;  2N0Y A;  3ZVR A;  3GYO A;  5KCV A;  2Y8G A;  2RGN B;  1J0W A;  3VOQ A;  3TW1 A;  2Y7B A;  4KHO A;  1EGX A;  4YL8 A;  1MIZ B;  1W1G A;  3RCP A;  1E5W A;  2MFQ A;  1FGZ A;  2AEH A;  3U7D A;  2KCJ A;  1TXD A;  2P8V A;  1Z87 A;  1U5F A;  2CAY A;  2RUK B;  3QBV B;  1XCG A;  1U5G A;  2W2X C;  4HB4 B;  2EJ8 A;  1XOD A;  1K5D B;  1OY2 A;  1P5T A;  1NU2 A;  3FSS A;  2D9W A;  5DI9 B;  1X1F A;  3A8Q A;  2LOZ A;  2D2Q A;  4MK0 A;  3TVV A;  2D9X A;  4WSF A;  4HHV A;  1U27 A;  2DKQ A;  2L2I A;  3LJU X;  1DBH A;  5GOW B;  1BTK A;  1QC6 A;  2BCJ A;  2M14 A;  2UVM A;  2GCJ A;  5FI1 A;  1BWN A;  2VRW B;  1TQZ A;  3D8F A;  3WA0 A;  2Q13 A;  3SV1 A;  4HAX B;  2EC1 A;  2VKI A;  3V5W A;  3G9W A;  3VIA A;  3KZ1 A;  1XD4 A;  2YRY A;  3UZT A;  5EFX A;  2ROV A;  3QWM A;  4CHM A;  1EAZ A;  4HAW B;  3D8D A;  1NI2 A;  2VSZ A;  4D0N B;  1UEF A;  1WGQ A;  3TO1 A;  1BTN A;  1OMW A;  2IYB A;  3TCA A;  2DTC A;  4GMV A;  4KHB B;  1FB8 A;  4CHJ A;  2UZS A;  2QKM A;  2DFK A;  5CLQ B;  2YS1 A;  3ZDT A;  4EMO A;  2HE7 A;  3A8P A;  1MAI A;  2RLO A;  2PZ1 A;  1KZG A;  1DYN A;  1WJM A;  1MK9 B;  2EMT A;  2D9Z A;  1TJ6 A;  2D9Y A;  2DN6 A;  1M7R A;  1FAO A;  2DYQ A;  2YS5 A;  1NTY A;  5C16 A;  4PNK A;  2P0D A;  1FGY A;  2OTX A;  1KI1 B;  3FEH A;  5D3V A;  2GCL A;  3ML4 A;  4MT7 A;  5DH9 B;  4ZRJ A;  2LOX A;  2Y8F A;  1UPR A;  4A5K A;  2ROZ B;  4CYE A;  1QQG A;  2K00 A;  1Q67 A;  2COC A;  1LW3 A;  4HAT B;  2I5C A;  2DHI A;  1U5E A;  2DA0 A;  3P7Z A;  1V5P A;  2COA A;  5J3Q A;  2D9V A;  1I2H A;  3AJ4 A;  1SHC A;  4WVF B;  3SYX A;  4B6H A;  2J0M A;  1V5M A;  1K5G B;  1ZM0 A;  4IOY X;  4L6E A;  3KY9 A;  2L1C A;  3NSU A;  1UNQ A;  2YVC A;  3KRW A;  3SUZ A;  5JHH A;  1X05 A;  2JP2 A;  1ISN A;  3CIK A;  4GN1 A;  3WYF B;  4F7H A;  3TFM A;  2W2X D;  5DHA B;  4F7U P;  4Z2M B;  4WJ7 A;  1U5D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...