1W1DA

Crystal structure of the pdk1 pleckstrin homology (ph) domain bound to inositol (1,3,4,5)-tetrakisphosphate
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
143
structure length
143
Chain Sequence
PLGSNIEQYIHDLDSNSFELDLQFSEDEKRLLLEKQAGGNPWHQFVENNLILKMGPVDKRKGLFARRRQLLLTEGPHLYYVDPVNKVLKGEIPWSQELRPEAKNFKTFFVHTPNRTYYLMDPSGNAHKWCRKIQEVWRQRYQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Insights Into the Regulation of Pdk1 by Phosphoinositides and Inositol Phosphates
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords 3-PHOSPHOINOSITIDE DEPENDENT PROTEIN KINASE-1
total genus 38
structure length 143
sequence length 143
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2004-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14593 PH_3 PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1w1dA00
4IAPA 1KI1B 2I5CA 3M1IB 4A5KA 1LW3A 5D3WA 4Z2MB 1DDVA 2DKQA 3V5WA 1ZM0A 2Y8GA 4KAXB 1QC6A 1U29A 1MPHA 3TCAA 2VRWB 1PLSA 3P6AA 1FB8A 1U2BA 2OTXA 2CY5A 1P6SA 2IYBA 4NSWA 3KY9A 3ODOA 1W1GA 2FJLA 2GCLA 2W2XC 4F7GA 1OMWA 3F5RA 1KZGA 2UVMA 4ZRJA 1BWNA 4HAYB 2GCJA 2P0DA 4MT7A 1EAZA 5JP4A 1MK7B 2Q13A 1E5WA 4BBKA 2YS1A 1XKEA 4GMXB 2RNRB 1W1DA 2ELAA 1BTKA 1GG3A 3TVVA 2MKRA 1UPQA 4P7IA 4PQ0A 2DHIA 4B6HA 4DX90 1LB1A 3PVWA 4CHJA 4CYEA 1X1FA 2DKPA 3A8PA 1WGUA 3F0WA 3PVUA 2CY4A 4GPTB 4K81A 3A8QA 4F7UP 3BINA 4MY6A 1K5DB 2AL6A 3PSCA 5D3XA 2M14A 5CLQB 4H8SA 2XQNM 2D9WA 3U7DA 4PNKA 1FOEA 3MPXA 2UZSA 2KCJA 2ROVA 3RCPA 2LOXA 1ISNA 2V76A 3T06A 4HDQA 1MK9B 4A6FB 4Z2NA 3KSYA 2CODA 3GYPA 4XWXA 1WJ1A 4F7HA 1X05A 4D0NB 2YS5A 5D3VA 3D8EA 3GYOA 2W2WA 2ADZA 1X1GA 2MWNB 4HB4B 3PEGA 5C5BA 5C5BB 3N7CA 2YF0A 4GXBA 3D8FA 4NY0A 2DX5A 2K00A 2X18A 1BAKA 5HE3A 3AJ4A 4KHBB 5FI0A 1UPRA 4ZRKA 4GN1A 1IRSA 3ODWA 2OQBA 3SV1A 3PZDA 2YS3A 3KRXA 4IFSA 4YONA 2N23A 3IVFA 3PG7A 4MK0A 3FEHA 3PVLA 3WA0A 1U5DA 2P0HA 2K2JA 3DXDA 4HAVB 4HB2B 5JHHA 1K5GB 2LYDA 1NU2A 2LKOA 3ML4A 4WVFB 1TQZA 4DX8A 2COAA 1GC6A 2DHJA 2J59M 1BTNA 4HB3B 3VIAA 2GJYA 2D9XA 4EMOA 4HATB 4KHOA 1U5FA 1P5TA 3ODXA 5HE0A 1Y5OA 4KVGB 2ZPYA 3TW1A 1FAOA 1XODA 1OY2A 4EKUA 2YRYA 4HAWB 3ULCA 1V5UA 1UEFA 2W2XD 4EJNA 5HE2A 2D10A 5LONB 2H7DA 1U5GA 1MKEA 2D9ZA 5J3TA 5J3QA 5J3YA 2CRFA 4K2PA 3TFMA 1J19A 3SUZA 2DFKA 5EFXA 1PFJA 2COFA 1B55A 2VSZA 1GC7A 3LJUX 1Y19B 2RGNB 4GZUA 2HE7A 3X23A 3SO6A 2DN6A 2MDXA 3PP2A 1DYNA 2D11A 3AU5A 1DROA 4K2OA 1W1HA 1I2HA 1FHXA 1SGHA 4HAUB 5CLLB 2AEHA 1FHWA 1FHOA 1J0WA 1U5EA 1UNRA 2BCJA 1UNPA 4HB0B 3HQCA 1WI1A 2E2XA 1V5PA 1X11A 3SYXA 5JLJB 1QQGA 2M38A 4YL8A 3O96A 2DYQA 1OQNA 3HW2B 5C6RA 5DI9B 3TO1A 1N3HA 2I1JA 3FM8C 1EF1A 1H10A 1Q67A 2P0FA 3P7ZA 1ZSQA 2YVCA 3ZVRA 1V5MA 4K17A 2D9VA 2DLWA 2QKMA 3AU4A 1DDWA 1AQCA 3OANA 5KQ4A 1P3RA 1EVHA 2DYNA 2RLOA 2G35A 2H7EA 4WJ7A 5DIFB 3MDBC 4C0AA 4HAZB 2QKLA 3DXCA 2Y8FA 2ELBA 1PMSA 1I7AA 2JP2A 2J0JA 1WJMA 2MFQA 1V61A 3QWMA 2DA0A 1DBHA 4WSFA 1SHCA 1MIZB 2Z0OA 2DHKA 1M7RA 3FSSA 3CXBB 2DX1A 1V88A 2L1CA 1XCGA 2UZRA 5D3YA 1U27A 2D9YA 1M7EA 1H4RA 3UZTA 2LOZA 2L2IA 4HHVA 1V89A 1UNQA 5C79A 5HE1A 2Z0PA 3NSUA 1WG7A 2R0DA 2EMSA 1FGZA 3KRWA 1XD4A 2N0YA 1ZVRA 1TXDA 1RRPB 2YT0A 4CHMA 3QIJA 2RVBB 2GS0A 3U8ZA 3CIKA 2Z0QA 2I1KA 1ZC4B 1KZ7A 4A6FA 4HDOA 1NI2A 2KUPA 1AWEA 3G9WA 5FI1A 1XX0A 4ZRIA 3D8DA 2HTHB 2D4QA 5DH9B 2VKIA 1XR0B 4A6HA 3DXEA 4A6KA 2J0KA 2K2UA 1Z87A 4HAXB 2YSZA 3ZDTA 5GOWB 1FGYA 4KHAA 1WGQA 2YT1A 1MIXA 2PZ1A 2RSGA 2Y7BA 3QBVB 2R09A 3KZ1A 2D2QA 2DTCA 2EC1A 5LOPB 2CAYA 1ZC3B 5L81A 4TKNA 1WVHA 2LULA 3WYFB 3BJIA 2NZ8B 4DXAB 2COCA 1X86A 3VOQA 1RJ2A 4TYZA 2EJ8A 2I5FA 2KGXB 2LG1A 2ROZB 5C16A 4GMVA 2NMBA 5JHGA 3ULBA 1NTVA 4IOYX 5KQ1A 2RUKB 5D27A 1MAIA 5KCVA 4Y94A 5DHFB 1EGXA 4DBBA 1TJ6A 3SNHA 4L6EA 2EMTA 3HK0A 2J0MA 1DDMA 3A98B 1NTYA 2P8VA 2IFSA 5DHAB
chains in the Genus database with same CATH superfamily
4IAPA 3U12A 1KI1B 2I5CA 3M1IB 4A5KA 1LW3A 5D3WA 4Z2MB 1DDVA 2DKQA 3V5WA 1ZM0A 2Y8GA 4KAXB 1QC6A 1U29A 1MPHA 3TCAA 2VRWB 1PLSA 3P6AA 1FB8A 1U2BA 2OTXA 2CY5A 1P6SA 2KIGA 2IYBA 4NSWA 3KY9A 3ODOA 1W1GA 2FJLA 2GCLA 2W2XC 4F7GA 1OMWA 3F5RA 1KZGA 4QJ4B 2UVMA 4ZRJA 1BWNA 4HAYB 2GCJA 2P0DA 4MT7A 1EAZA 2NBVA 4GNKB 1MK7B 5JP4A 2Q13A 1E5WA 4BBKA 2YS1A 1XKEA 4GMXB 2RNRB 1W1DA 2ELAA 1BTKA 1GG3A 3TVVA 2MKRA 1UPQA 4P7IA 4PQ0A 2DHIA 4B6HA 4DX90 1LB1A 3PVWA 4CHJA 4CYEA 1X1FA 2DKPA 1ZYIA 3A8PA 1WGUA 4QJ3B 3F0WA 3PVUA 2CY4A 4GPTB 3HIEA 4K81A 3A8QA 4F7UP 3BINA 4MY6A 1K5DB 2AL6A 3PSCA 5D3XA 2M14A 5CLQB 2XQNM 4H8SA 2D9WA 3U7DA 4PNKA 1FOEA 3MPXA 2UZSA 2KCJA 2ROVA 3RCPA 2LOXA 1ISNA 2ZKMX 3DCXA 2V76A 3T06A 4HDQA 1MK9B 4A6FB 2Z4DA 4Z2NA 3KSYA 2CODA 3GYPA 4XWXA 1WJ1A 4F7HA 1X05A 4D0NB 2YS5A 5D3VA 3D8EA 3NWDA 2KR0A 3GYOA 2W2WA 2ADZA 1X1GA 2MWNB 4HB4B 3PEGA 5C5BA 5C5BB 3N7CA 3NWAA 2YF0A 4GXBA 3D8FA 4NY0A 2DX5A 2K00A 2X18A 1BAKA 5HE3A 5LG4B 3AJ4A 4KHBB 5FI0A 1UPRA 4ZRKA 4GN1A 1IRSA 3ODWA 2OQBA 3SV1A 3PZDA 2YS3A 3KRXA 4IFSA 4YONA 2N23A 3IVFA 3PG7A 4MK0A 3FEHA 3PVLA 3WA0A 1U5DA 2P0HA 2K2JA 3DXDA 4HAVB 4HB2B 2K49A 5JHHA 1K5GB 2LYDA 1NU2A 2LKOA 3ML4A 4WVFB 1TQZA 4DX8A 2COAA 2R2YA 1GC6A 2DHJA 3NWFA 3A58A 2J59M 1BTNA 4HB3B 3VIAA 5M4YB 2GJYA 2D9XA 4EMOA 4HATB 4KHOA 1U5FA 1P5TA 3HSAA 3ODXA 2Z59A 5HE0A 1Y5OA 4KVGB 2ZPYA 3TW1A 1FAOA 1XODA 1OY2A 4EKUA 2YRYA 4HAWB 3ULCA 1V5UA 3FVCA 4OSNA 1UEFA 2W2XD 4EJNA 5HE2A 2D10A 5LONB 4OT1A 2H7DA 1U5GA 1MKEA 2D9ZA 5J3TA 5J3QA 5J3YA 2CRFA 4K2PA 3TFMA 1J19A 3SUZA 2DFKA 5EFXA 1PFJA 2COFA 1B55A 2VSZA 1GC7A 3LJUX 1Y19B 2RGNB 4GZUA 2HE7A 3X23A 3SO6A 2DN6A 2MDXA 2Z13A 3PP2A 1DYNA 2D11A 3AU5A 1DROA 4K2OA 1W1HA 1I2HA 1FHXA 2K8EA 1SGHA 4HAUB 5CLLB 2AEHA 1FHWA 1FHOA 1J0WA 4KHBA 1U5EA 1UNRA 2BCJA 1UNPA 4HB0B 4HSIA 3HQCA 2KUQA 1WI1A 2E2XA 1V5PA 1X11A 3SYXA 5JLJB 1QQGA 2M38A 4YL8A 3O96A 2DYQA 1OQNA 3B77A 3HW2B 4D6WA 5C6RA 5DI9B 3TO1A 1N3HA 2I1JA 3FM8C 1EF1A 1H10A 1Q67A 2P0FA 3P7ZA 1ZSQA 2YVCA 5I2SA 3ZVRA 1V5MA 4K17A 5I2MA 2D9VA 2DLWA 2QKMA 3AU4A 1DDWA 4QXAB 1AQCA 3OANA 5KQ4A 1P3RA 1EVHA 2DYNA 2RLOA 2G35A 2H7EA 4WJ7A 5DIFB 3MDBC 4C0AA 4HAZB 2QKLA 3DXCA 2Y8FA 2ELBA 2RRFA 1PMSA 1I7AA 2JP2A 2J0JA 1WJMA 2MFQA 1V61A 3QWMA 4CSQA 3NW8A 2DA0A 1DBHA 4WSFA 1SHCA 1MIZB 4L1RA 2Z0OA 2DHKA 1M7RA 3FSSA 3CXBB 2DX1A 1V88A 2L1CA 1XCGA 2UZRA 5D3YA 1U27A 2D9YA 1M7EA 1H4RA 3UZTA 5IRSA 2LOZA 2L2IA 4HHVA 1V89A 1UNQA 5C79A 5HE1A 2Z0PA 3NSUA 1WG7A 2R0DA 2EMSA 1FGZA 3KRWA 1XD4A 2N0YA 4QJ5B 1ZVRA 1TXDA 1RRPB 2YT0A 4CHMA 3QIJA 2RVBB 2GS0A 3U8ZA 3CIKA 2Z0QA 2I1KA 1ZC4B 1KZ7A 4A6FA 4HDOA 1NI2A 2KUPA 1AWEA 3G9WA 5FI1A 1XX0A 4ZRIA 3D8DA 2FJUB 2HTHB 2D4QA 5DH9B 2VKIA 1XR0B 4A6HA 3DXEA 4A6KA 2J0KA 2K2UA 1Z87A 4HAXB 2YSZA 3ZDTA 5GOWB 1FGYA 4KHAA 1WGQA 2YT1A 1MIXA 2PZ1A 2RSGA 2Y7BA 3QBVB 2R09A 3KZ1A 2D2QA 2DTCA 4DIXA 2EC1A 5LOPB 2CAYA 1ZC3B 1T77A 5L81A 4TKNA 1WVHA 2LULA 3WYFB 3BJIA 2KIEA 2NZ8B 4DXAB 2COCA 1X86A 3VOQA 1RJ2A 4TYZA 2EJ8A 2GUMA 2I5FA 2KGXB 2LG1A 2YT2A 2ROZB 4GOUA 5C16A 4GMVA 2NMBA 5JHGA 3ULBA 1MI1A 1NTVA 4IOYX 2RUKB 5KQ1A 5D27A 1MAIA 5KCVA 4Y94A 5DHFB 1EGXA 4DBBA 1TJ6A 2Z14A 3SNHA 4L6EA 2EMTA 3HK0A 2J0MA 3OHMB 1DDMA 3A98B 1NTYA 2P8VA 2IFSA 5DHAB
chains in the Genus database with same CATH topology
4IAPA 1KI1B 2I5CA 3M1IB 4A5KA 1LW3A 5D3WA 4Z2MB 1DDVA 2DKQA 3V5WA 1ZM0A 2Y8GA 4KAXB 1QC6A 1U29A 1MPHA 3TCAA 2VRWB 1PLSA 3P6AA 1FB8A 1U2BA 2OTXA 2CY5A 1P6SA 2IYBA 4NSWA 3KY9A 3ODOA 1W1GA 2FJLA 2GCLA 2W2XC 4F7GA 1OMWA 3F5RA 1KZGA 2UVMA 4ZRJA 1BWNA 4HAYB 2GCJA 2P0DA 4MT7A 1EAZA 5JP4A 1MK7B 2Q13A 1E5WA 4BBKA 2YS1A 1XKEA 4GMXB 2RNRB 1W1DA 2ELAA 1BTKA 1GG3A 3TVVA 2MKRA 1UPQA 4P7IA 4PQ0A 2DHIA 4B6HA 4DX90 1LB1A 3PVWA 4CHJA 4CYEA 1X1FA 2DKPA 3A8PA 1WGUA 3F0WA 3PVUA 2CY4A 4GPTB 4K81A 3A8QA 4F7UP 3BINA 4MY6A 1K5DB 2AL6A 3PSCA 5D3XA 2M14A 5CLQB 4H8SA 2XQNM 2D9WA 3U7DA 4PNKA 1FOEA 3MPXA 2UZSA 2KCJA 2ROVA 3RCPA 2LOXA 1ISNA 2V76A 3T06A 4HDQA 1MK9B 4A6FB 4Z2NA 3KSYA 2CODA 3GYPA 4XWXA 1WJ1A 4F7HA 1X05A 4D0NB 2YS5A 5D3VA 3D8EA 3GYOA 2W2WA 2ADZA 1X1GA 2MWNB 4HB4B 3PEGA 5C5BA 5C5BB 3N7CA 2YF0A 4GXBA 3D8FA 4NY0A 2DX5A 2K00A 2X18A 1BAKA 5HE3A 3AJ4A 4KHBB 5FI0A 1UPRA 4ZRKA 4GN1A 1IRSA 3ODWA 2OQBA 3SV1A 3PZDA 2YS3A 3KRXA 4IFSA 4YONA 2N23A 3IVFA 3PG7A 4MK0A 3FEHA 3PVLA 3WA0A 1U5DA 2P0HA 2K2JA 3DXDA 4HAVB 4HB2B 5JHHA 1K5GB 2LYDA 1NU2A 2LKOA 3ML4A 4WVFB 1TQZA 4DX8A 2COAA 1GC6A 2DHJA 2J59M 1BTNA 4HB3B 3VIAA 2GJYA 2D9XA 4EMOA 4HATB 4KHOA 1U5FA 1P5TA 3ODXA 5HE0A 1Y5OA 4KVGB 2ZPYA 3TW1A 1FAOA 1XODA 1OY2A 4EKUA 2YRYA 4HAWB 3ULCA 1V5UA 1UEFA 2W2XD 4EJNA 5HE2A 2D10A 5LONB 2H7DA 1U5GA 1MKEA 2D9ZA 5J3TA 5J3QA 5J3YA 2CRFA 4K2PA 3TFMA 1J19A 3SUZA 2DFKA 5EFXA 1PFJA 2COFA 1B55A 2VSZA 1GC7A 3LJUX 1Y19B 2RGNB 4GZUA 2HE7A 3X23A 3SO6A 2DN6A 2MDXA 3PP2A 1DYNA 2D11A 3AU5A 1DROA 4K2OA 1W1HA 1I2HA 1FHXA 1SGHA 4HAUB 5CLLB 2AEHA 1FHWA 1FHOA 1J0WA 1U5EA 1UNRA 2BCJA 1UNPA 4HB0B 3HQCA 1WI1A 2E2XA 1V5PA 1X11A 3SYXA 5JLJB 1QQGA 2M38A 4YL8A 3O96A 2DYQA 1OQNA 3HW2B 5C6RA 5DI9B 3TO1A 1N3HA 2I1JA 3FM8C 1EF1A 1H10A 1Q67A 2P0FA 3P7ZA 1ZSQA 2YVCA 3ZVRA 1V5MA 4K17A 2D9VA 2DLWA 2QKMA 3AU4A 1DDWA 1AQCA 3OANA 5KQ4A 1P3RA 1EVHA 2DYNA 2RLOA 2G35A 2H7EA 4WJ7A 5DIFB 3MDBC 4C0AA 4HAZB 2QKLA 3DXCA 2Y8FA 2ELBA 1PMSA 1I7AA 2JP2A 2J0JA 1WJMA 2MFQA 1V61A 3QWMA 2DA0A 1DBHA 4WSFA 1SHCA 1MIZB 2Z0OA 2DHKA 1M7RA 3FSSA 3CXBB 2DX1A 1V88A 2L1CA 1XCGA 2UZRA 5D3YA 1U27A 2D9YA 1M7EA 1H4RA 3UZTA 2LOZA 2L2IA 4HHVA 1V89A 1UNQA 5C79A 5HE1A 2Z0PA 3NSUA 1WG7A 2R0DA 2EMSA 1FGZA 3KRWA 1XD4A 2N0YA 1ZVRA 1TXDA 1RRPB 2YT0A 4CHMA 3QIJA 2RVBB 2GS0A 3U8ZA 3CIKA 2Z0QA 2I1KA 1ZC4B 1KZ7A 4A6FA 4HDOA 1NI2A 2KUPA 1AWEA 3G9WA 5FI1A 1XX0A 4ZRIA 3D8DA 2HTHB 2D4QA 5DH9B 2VKIA 1XR0B 4A6HA 3DXEA 4A6KA 2J0KA 2K2UA 1Z87A 4HAXB 2YSZA 3ZDTA 5GOWB 1FGYA 4KHAA 1WGQA 2YT1A 1MIXA 2PZ1A 2RSGA 2Y7BA 3QBVB 2R09A 3KZ1A 2D2QA 2DTCA 2EC1A 5LOPB 2CAYA 1ZC3B 5L81A 4TKNA 1WVHA 2LULA 3WYFB 3BJIA 2NZ8B 4DXAB 2COCA 1X86A 3VOQA 1RJ2A 4TYZA 2EJ8A 2I5FA 2KGXB 2LG1A 2ROZB 5C16A 4GMVA 2NMBA 5JHGA 3ULBA 1NTVA 4IOYX 5KQ1A 2RUKB 5D27A 1MAIA 5KCVA 4Y94A 5DHFB 1EGXA 4DBBA 1TJ6A 3SNHA 4L6EA 2EMTA 3HK0A 2J0MA 1DDMA 3A98B 1NTYA 2P8VA 2IFSA 5DHAB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IAP A;  1KI1 B;  2I5C A;  3M1I B;  4A5K A;  1LW3 A;  5D3W A;  4Z2M B;  1DDV A;  2DKQ A;  3V5W A;  1ZM0 A;  2Y8G A;  4KAX B;  1QC6 A;  1U29 A;  1MPH A;  3TCA A;  2VRW B;  1PLS A;  3P6A A;  1FB8 A;  1U2B A;  2OTX A;  2CY5 A;  1P6S A;  2IYB A;  4NSW A;  3KY9 A;  3ODO A;  1W1G A;  2FJL A;  2GCL A;  2W2X C;  4F7G A;  1OMW A;  3F5R A;  1KZG A;  2UVM A;  4ZRJ A;  1BWN A;  4HAY B;  2GCJ A;  2P0D A;  4MT7 A;  1EAZ A;  5JP4 A;  1MK7 B;  2Q13 A;  1E5W A;  4BBK A;  2YS1 A;  1XKE A;  4GMX B;  2RNR B;  1W1D A;  2ELA A;  1BTK A;  1GG3 A;  3TVV A;  2MKR A;  1UPQ A;  4P7I A;  4PQ0 A;  2DHI A;  4B6H A;  4DX9 0;  1LB1 A;  3PVW A;  4CHJ A;  4CYE A;  1X1F A;  2DKP A;  3A8P A;  1WGU A;  3F0W A;  3PVU A;  2CY4 A;  4GPT B;  4K81 A;  3A8Q A;  4F7U P;  3BIN A;  4MY6 A;  1K5D B;  2AL6 A;  3PSC A;  5D3X A;  2M14 A;  5CLQ B;  4H8S A;  2XQN M;  2D9W A;  3U7D A;  4PNK A;  1FOE A;  3MPX A;  2UZS A;  2KCJ A;  2ROV A;  3RCP A;  2LOX A;  1ISN A;  2V76 A;  3T06 A;  4HDQ A;  1MK9 B;  4A6F B;  4Z2N A;  3KSY A;  2COD A;  3GYP A;  4XWX A;  1WJ1 A;  4F7H A;  1X05 A;  4D0N B;  2YS5 A;  5D3V A;  3D8E A;  3GYO A;  2W2W A;  2ADZ A;  1X1G A;  2MWN B;  4HB4 B;  3PEG A;  5C5B A;  5C5B B;  3N7C A;  2YF0 A;  4GXB A;  3D8F A;  4NY0 A;  2DX5 A;  2K00 A;  2X18 A;  1BAK A;  5HE3 A;  3AJ4 A;  4KHB B;  5FI0 A;  1UPR A;  4ZRK A;  4GN1 A;  1IRS A;  3ODW A;  2OQB A;  3SV1 A;  3PZD A;  2YS3 A;  3KRX A;  4IFS A;  4YON A;  2N23 A;  3IVF A;  3PG7 A;  4MK0 A;  3FEH A;  3PVL A;  3WA0 A;  1U5D A;  2P0H A;  2K2J A;  3DXD A;  4HAV B;  4HB2 B;  5JHH A;  1K5G B;  2LYD A;  1NU2 A;  2LKO A;  3ML4 A;  4WVF B;  1TQZ A;  4DX8 A;  2COA A;  1GC6 A;  2DHJ A;  2J59 M;  1BTN A;  4HB3 B;  3VIA A;  2GJY A;  2D9X A;  4EMO A;  4HAT B;  4KHO A;  1U5F A;  1P5T A;  3ODX A;  5HE0 A;  1Y5O A;  4KVG B;  2ZPY A;  3TW1 A;  1FAO A;  1XOD A;  1OY2 A;  4EKU A;  2YRY A;  4HAW B;  3ULC A;  1V5U A;  1UEF A;  2W2X D;  4EJN A;  5HE2 A;  2D10 A;  5LON B;  2H7D A;  1U5G A;  1MKE A;  2D9Z A;  5J3T A;  5J3Q A;  5J3Y A;  2CRF A;  4K2P A;  3TFM A;  1J19 A;  3SUZ A;  2DFK A;  5EFX A;  1PFJ A;  2COF A;  1B55 A;  2VSZ A;  1GC7 A;  3LJU X;  1Y19 B;  2RGN B;  4GZU A;  2HE7 A;  3X23 A;  3SO6 A;  2DN6 A;  2MDX A;  3PP2 A;  1DYN A;  2D11 A;  3AU5 A;  1DRO A;  4K2O A;  1W1H A;  1I2H A;  1FHX A;  1SGH A;  4HAU B;  5CLL B;  2AEH A;  1FHW A;  1FHO A;  1J0W A;  1U5E A;  1UNR A;  2BCJ A;  1UNP A;  4HB0 B;  3HQC A;  1WI1 A;  2E2X A;  1V5P A;  1X11 A;  3SYX A;  5JLJ B;  1QQG A;  2M38 A;  4YL8 A;  3O96 A;  2DYQ A;  1OQN A;  3HW2 B;  5C6R A;  5DI9 B;  3TO1 A;  1N3H A;  2I1J A;  3FM8 C;  1EF1 A;  1H10 A;  1Q67 A;  2P0F A;  3P7Z A;  1ZSQ A;  2YVC A;  3ZVR A;  1V5M A;  4K17 A;  2D9V A;  2DLW A;  2QKM A;  3AU4 A;  1DDW A;  1AQC A;  3OAN A;  5KQ4 A;  1P3R A;  1EVH A;  2DYN A;  2RLO A;  2G35 A;  2H7E A;  4WJ7 A;  5DIF B;  3MDB C;  4C0A A;  4HAZ B;  2QKL A;  3DXC A;  2Y8F A;  2ELB A;  1PMS A;  1I7A A;  2JP2 A;  2J0J A;  1WJM A;  2MFQ A;  1V61 A;  3QWM A;  2DA0 A;  1DBH A;  4WSF A;  1SHC A;  1MIZ B;  2Z0O A;  2DHK A;  1M7R A;  3FSS A;  3CXB B;  2DX1 A;  1V88 A;  2L1C A;  1XCG A;  2UZR A;  5D3Y A;  1U27 A;  2D9Y A;  1M7E A;  1H4R A;  3UZT A;  2LOZ A;  2L2I A;  4HHV A;  1V89 A;  1UNQ A;  5C79 A;  5HE1 A;  2Z0P A;  3NSU A;  1WG7 A;  2R0D A;  2EMS A;  1FGZ A;  3KRW A;  1XD4 A;  2N0Y A;  1ZVR A;  1TXD A;  1RRP B;  2YT0 A;  4CHM A;  3QIJ A;  2RVB B;  2GS0 A;  3U8Z A;  3CIK A;  2Z0Q A;  2I1K A;  1ZC4 B;  1KZ7 A;  4A6F A;  4HDO A;  1NI2 A;  2KUP A;  1AWE A;  3G9W A;  5FI1 A;  1XX0 A;  4ZRI A;  3D8D A;  2HTH B;  2D4Q A;  5DH9 B;  2VKI A;  1XR0 B;  4A6H A;  3DXE A;  4A6K A;  2J0K A;  2K2U A;  1Z87 A;  4HAX B;  2YSZ A;  3ZDT A;  5GOW B;  1FGY A;  4KHA A;  1WGQ A;  2YT1 A;  1MIX A;  2PZ1 A;  2RSG A;  2Y7B A;  3QBV B;  2R09 A;  3KZ1 A;  2D2Q A;  2DTC A;  2EC1 A;  5LOP B;  2CAY A;  1ZC3 B;  5L81 A;  4TKN A;  1WVH A;  2LUL A;  3WYF B;  3BJI A;  2NZ8 B;  4DXA B;  2COC A;  1X86 A;  3VOQ A;  1RJ2 A;  4TYZ A;  2EJ8 A;  2I5F A;  2KGX B;  2LG1 A;  2ROZ B;  5C16 A;  4GMV A;  2NMB A;  5JHG A;  3ULB A;  1NTV A;  4IOY X;  5KQ1 A;  2RUK B;  5D27 A;  1MAI A;  5KCV A;  4Y94 A;  5DHF B;  1EGX A;  4DBB A;  1TJ6 A;  3SNH A;  4L6E A;  2EMT A;  3HK0 A;  2J0M A;  1DDM A;  3A98 B;  1NTY A;  2P8V A;  2IFS A;  5DHA B; 
#chains in the Genus database with same CATH topology
 4IAP A;  3U12 A;  1KI1 B;  2I5C A;  3M1I B;  4A5K A;  1LW3 A;  5D3W A;  4Z2M B;  1DDV A;  2DKQ A;  3V5W A;  1ZM0 A;  2Y8G A;  4KAX B;  1QC6 A;  1U29 A;  1MPH A;  3TCA A;  2VRW B;  1PLS A;  3P6A A;  1FB8 A;  1U2B A;  2OTX A;  2CY5 A;  1P6S A;  2KIG A;  2IYB A;  4NSW A;  3KY9 A;  3ODO A;  1W1G A;  2FJL A;  2GCL A;  2W2X C;  4F7G A;  1OMW A;  3F5R A;  1KZG A;  4QJ4 B;  2UVM A;  4ZRJ A;  1BWN A;  4HAY B;  2GCJ A;  2P0D A;  4MT7 A;  1EAZ A;  2NBV A;  4GNK B;  1MK7 B;  5JP4 A;  2Q13 A;  1E5W A;  4BBK A;  2YS1 A;  1XKE A;  4GMX B;  2RNR B;  1W1D A;  2ELA A;  1BTK A;  1GG3 A;  3TVV A;  2MKR A;  1UPQ A;  4P7I A;  4PQ0 A;  2DHI A;  4B6H A;  4DX9 0;  1LB1 A;  3PVW A;  4CHJ A;  4CYE A;  1X1F A;  2DKP A;  1ZYI A;  3A8P A;  1WGU A;  4QJ3 B;  3F0W A;  3PVU A;  2CY4 A;  4GPT B;  3HIE A;  4K81 A;  3A8Q A;  4F7U P;  3BIN A;  4MY6 A;  1K5D B;  2AL6 A;  3PSC A;  5D3X A;  2M14 A;  5CLQ B;  2XQN M;  4H8S A;  2D9W A;  3U7D A;  4PNK A;  1FOE A;  3MPX A;  2UZS A;  2KCJ A;  2ROV A;  3RCP A;  2LOX A;  1ISN A;  2ZKM X;  3DCX A;  2V76 A;  3T06 A;  4HDQ A;  1MK9 B;  4A6F B;  2Z4D A;  4Z2N A;  3KSY A;  2COD A;  3GYP A;  4XWX A;  1WJ1 A;  4F7H A;  1X05 A;  4D0N B;  2YS5 A;  5D3V A;  3D8E A;  3NWD A;  2KR0 A;  3GYO A;  2W2W A;  2ADZ A;  1X1G A;  2MWN B;  4HB4 B;  3PEG A;  5C5B A;  5C5B B;  3N7C A;  3NWA A;  2YF0 A;  4GXB A;  3D8F A;  4NY0 A;  2DX5 A;  2K00 A;  2X18 A;  1BAK A;  5HE3 A;  5LG4 B;  3AJ4 A;  4KHB B;  5FI0 A;  1UPR A;  4ZRK A;  4GN1 A;  1IRS A;  3ODW A;  2OQB A;  3SV1 A;  3PZD A;  2YS3 A;  3KRX A;  4IFS A;  4YON A;  2N23 A;  3IVF A;  3PG7 A;  4MK0 A;  3FEH A;  3PVL A;  3WA0 A;  1U5D A;  2P0H A;  2K2J A;  3DXD A;  4HAV B;  4HB2 B;  2K49 A;  5JHH A;  1K5G B;  2LYD A;  1NU2 A;  2LKO A;  3ML4 A;  4WVF B;  1TQZ A;  4DX8 A;  2COA A;  2R2Y A;  1GC6 A;  2DHJ A;  3NWF A;  3A58 A;  2J59 M;  1BTN A;  4HB3 B;  3VIA A;  5M4Y B;  2GJY A;  2D9X A;  4EMO A;  4HAT B;  4KHO A;  1U5F A;  1P5T A;  3HSA A;  3ODX A;  2Z59 A;  5HE0 A;  1Y5O A;  4KVG B;  2ZPY A;  3TW1 A;  1FAO A;  1XOD A;  1OY2 A;  4EKU A;  2YRY A;  4HAW B;  3ULC A;  1V5U A;  3FVC A;  4OSN A;  1UEF A;  2W2X D;  4EJN A;  5HE2 A;  2D10 A;  5LON B;  4OT1 A;  2H7D A;  1U5G A;  1MKE A;  2D9Z A;  5J3T A;  5J3Q A;  5J3Y A;  2CRF A;  4K2P A;  3TFM A;  1J19 A;  3SUZ A;  2DFK A;  5EFX A;  1PFJ A;  2COF A;  1B55 A;  2VSZ A;  1GC7 A;  3LJU X;  1Y19 B;  2RGN B;  4GZU A;  2HE7 A;  3X23 A;  3SO6 A;  2DN6 A;  2MDX A;  2Z13 A;  3PP2 A;  1DYN A;  2D11 A;  3AU5 A;  1DRO A;  4K2O A;  1W1H A;  1I2H A;  1FHX A;  2K8E A;  1SGH A;  4HAU B;  5CLL B;  2AEH A;  1FHW A;  1FHO A;  1J0W A;  4KHB A;  1U5E A;  1UNR A;  2BCJ A;  1UNP A;  4HB0 B;  4HSI A;  3HQC A;  2KUQ A;  1WI1 A;  2E2X A;  1V5P A;  1X11 A;  3SYX A;  5JLJ B;  1QQG A;  2M38 A;  4YL8 A;  3O96 A;  2DYQ A;  1OQN A;  3B77 A;  3HW2 B;  4D6W A;  5C6R A;  5DI9 B;  3TO1 A;  1N3H A;  2I1J A;  3FM8 C;  1EF1 A;  1H10 A;  1Q67 A;  2P0F A;  3P7Z A;  1ZSQ A;  2YVC A;  5I2S A;  3ZVR A;  1V5M A;  4K17 A;  5I2M A;  2D9V A;  2DLW A;  2QKM A;  3AU4 A;  1DDW A;  4QXA B;  1AQC A;  3OAN A;  5KQ4 A;  1P3R A;  1EVH A;  2DYN A;  2RLO A;  2G35 A;  2H7E A;  4WJ7 A;  5DIF B;  3MDB C;  4C0A A;  4HAZ B;  2QKL A;  3DXC A;  2Y8F A;  2ELB A;  2RRF A;  1PMS A;  1I7A A;  2JP2 A;  2J0J A;  1WJM A;  2MFQ A;  1V61 A;  3QWM A;  4CSQ A;  3NW8 A;  2DA0 A;  1DBH A;  4WSF A;  1SHC A;  1MIZ B;  4L1R A;  2Z0O A;  2DHK A;  1M7R A;  3FSS A;  3CXB B;  2DX1 A;  1V88 A;  2L1C A;  1XCG A;  2UZR A;  5D3Y A;  1U27 A;  2D9Y A;  1M7E A;  1H4R A;  3UZT A;  5IRS A;  2LOZ A;  2L2I A;  4HHV A;  1V89 A;  1UNQ A;  5C79 A;  5HE1 A;  2Z0P A;  3NSU A;  1WG7 A;  2R0D A;  2EMS A;  1FGZ A;  3KRW A;  1XD4 A;  2N0Y A;  4QJ5 B;  1ZVR A;  1TXD A;  1RRP B;  2YT0 A;  4CHM A;  3QIJ A;  2RVB B;  2GS0 A;  3U8Z A;  3CIK A;  2Z0Q A;  2I1K A;  1ZC4 B;  1KZ7 A;  4A6F A;  4HDO A;  1NI2 A;  2KUP A;  1AWE A;  3G9W A;  5FI1 A;  1XX0 A;  4ZRI A;  3D8D A;  2FJU B;  2HTH B;  2D4Q A;  5DH9 B;  2VKI A;  1XR0 B;  4A6H A;  3DXE A;  4A6K A;  2J0K A;  2K2U A;  1Z87 A;  4HAX B;  2YSZ A;  3ZDT A;  5GOW B;  1FGY A;  4KHA A;  1WGQ A;  2YT1 A;  1MIX A;  2PZ1 A;  2RSG A;  2Y7B A;  3QBV B;  2R09 A;  3KZ1 A;  2D2Q A;  2DTC A;  4DIX A;  2EC1 A;  5LOP B;  2CAY A;  1ZC3 B;  1T77 A;  5L81 A;  4TKN A;  1WVH A;  2LUL A;  3WYF B;  3BJI A;  2KIE A;  2NZ8 B;  4DXA B;  2COC A;  1X86 A;  3VOQ A;  1RJ2 A;  4TYZ A;  2EJ8 A;  2GUM A;  2I5F A;  2KGX B;  2LG1 A;  2YT2 A;  2ROZ B;  4GOU A;  5C16 A;  4GMV A;  2NMB A;  5JHG A;  3ULB A;  1MI1 A;  1NTV A;  4IOY X;  2RUK B;  5KQ1 A;  5D27 A;  1MAI A;  5KCV A;  4Y94 A;  5DHF B;  1EGX A;  4DBB A;  1TJ6 A;  2Z14 A;  3SNH A;  4L6E A;  2EMT A;  3HK0 A;  2J0M A;  3OHM B;  1DDM A;  3A98 B;  1NTY A;  2P8V A;  2IFS A;  5DHA B; 
#chains in the Genus database with same CATH homology
 4IAP A;  1KI1 B;  2I5C A;  3M1I B;  4A5K A;  1LW3 A;  5D3W A;  4Z2M B;  1DDV A;  2DKQ A;  3V5W A;  1ZM0 A;  2Y8G A;  4KAX B;  1QC6 A;  1U29 A;  1MPH A;  3TCA A;  2VRW B;  1PLS A;  3P6A A;  1FB8 A;  1U2B A;  2OTX A;  2CY5 A;  1P6S A;  2IYB A;  4NSW A;  3KY9 A;  3ODO A;  1W1G A;  2FJL A;  2GCL A;  2W2X C;  4F7G A;  1OMW A;  3F5R A;  1KZG A;  2UVM A;  4ZRJ A;  1BWN A;  4HAY B;  2GCJ A;  2P0D A;  4MT7 A;  1EAZ A;  5JP4 A;  1MK7 B;  2Q13 A;  1E5W A;  4BBK A;  2YS1 A;  1XKE A;  4GMX B;  2RNR B;  1W1D A;  2ELA A;  1BTK A;  1GG3 A;  3TVV A;  2MKR A;  1UPQ A;  4P7I A;  4PQ0 A;  2DHI A;  4B6H A;  4DX9 0;  1LB1 A;  3PVW A;  4CHJ A;  4CYE A;  1X1F A;  2DKP A;  3A8P A;  1WGU A;  3F0W A;  3PVU A;  2CY4 A;  4GPT B;  4K81 A;  3A8Q A;  4F7U P;  3BIN A;  4MY6 A;  1K5D B;  2AL6 A;  3PSC A;  5D3X A;  2M14 A;  5CLQ B;  4H8S A;  2XQN M;  2D9W A;  3U7D A;  4PNK A;  1FOE A;  3MPX A;  2UZS A;  2KCJ A;  2ROV A;  3RCP A;  2LOX A;  1ISN A;  2V76 A;  3T06 A;  4HDQ A;  1MK9 B;  4A6F B;  4Z2N A;  3KSY A;  2COD A;  3GYP A;  4XWX A;  1WJ1 A;  4F7H A;  1X05 A;  4D0N B;  2YS5 A;  5D3V A;  3D8E A;  3GYO A;  2W2W A;  2ADZ A;  1X1G A;  2MWN B;  4HB4 B;  3PEG A;  5C5B A;  5C5B B;  3N7C A;  2YF0 A;  4GXB A;  3D8F A;  4NY0 A;  2DX5 A;  2K00 A;  2X18 A;  1BAK A;  5HE3 A;  3AJ4 A;  4KHB B;  5FI0 A;  1UPR A;  4ZRK A;  4GN1 A;  1IRS A;  3ODW A;  2OQB A;  3SV1 A;  3PZD A;  2YS3 A;  3KRX A;  4IFS A;  4YON A;  2N23 A;  3IVF A;  3PG7 A;  4MK0 A;  3FEH A;  3PVL A;  3WA0 A;  1U5D A;  2P0H A;  2K2J A;  3DXD A;  4HAV B;  4HB2 B;  5JHH A;  1K5G B;  2LYD A;  1NU2 A;  2LKO A;  3ML4 A;  4WVF B;  1TQZ A;  4DX8 A;  2COA A;  1GC6 A;  2DHJ A;  2J59 M;  1BTN A;  4HB3 B;  3VIA A;  2GJY A;  2D9X A;  4EMO A;  4HAT B;  4KHO A;  1U5F A;  1P5T A;  3ODX A;  5HE0 A;  1Y5O A;  4KVG B;  2ZPY A;  3TW1 A;  1FAO A;  1XOD A;  1OY2 A;  4EKU A;  2YRY A;  4HAW B;  3ULC A;  1V5U A;  1UEF A;  2W2X D;  4EJN A;  5HE2 A;  2D10 A;  5LON B;  2H7D A;  1U5G A;  1MKE A;  2D9Z A;  5J3T A;  5J3Q A;  5J3Y A;  2CRF A;  4K2P A;  3TFM A;  1J19 A;  3SUZ A;  2DFK A;  5EFX A;  1PFJ A;  2COF A;  1B55 A;  2VSZ A;  1GC7 A;  3LJU X;  1Y19 B;  2RGN B;  4GZU A;  2HE7 A;  3X23 A;  3SO6 A;  2DN6 A;  2MDX A;  3PP2 A;  1DYN A;  2D11 A;  3AU5 A;  1DRO A;  4K2O A;  1W1H A;  1I2H A;  1FHX A;  1SGH A;  4HAU B;  5CLL B;  2AEH A;  1FHW A;  1FHO A;  1J0W A;  1U5E A;  1UNR A;  2BCJ A;  1UNP A;  4HB0 B;  3HQC A;  1WI1 A;  2E2X A;  1V5P A;  1X11 A;  3SYX A;  5JLJ B;  1QQG A;  2M38 A;  4YL8 A;  3O96 A;  2DYQ A;  1OQN A;  3HW2 B;  5C6R A;  5DI9 B;  3TO1 A;  1N3H A;  2I1J A;  3FM8 C;  1EF1 A;  1H10 A;  1Q67 A;  2P0F A;  3P7Z A;  1ZSQ A;  2YVC A;  3ZVR A;  1V5M A;  4K17 A;  2D9V A;  2DLW A;  2QKM A;  3AU4 A;  1DDW A;  1AQC A;  3OAN A;  5KQ4 A;  1P3R A;  1EVH A;  2DYN A;  2RLO A;  2G35 A;  2H7E A;  4WJ7 A;  5DIF B;  3MDB C;  4C0A A;  4HAZ B;  2QKL A;  3DXC A;  2Y8F A;  2ELB A;  1PMS A;  1I7A A;  2JP2 A;  2J0J A;  1WJM A;  2MFQ A;  1V61 A;  3QWM A;  2DA0 A;  1DBH A;  4WSF A;  1SHC A;  1MIZ B;  2Z0O A;  2DHK A;  1M7R A;  3FSS A;  3CXB B;  2DX1 A;  1V88 A;  2L1C A;  1XCG A;  2UZR A;  5D3Y A;  1U27 A;  2D9Y A;  1M7E A;  1H4R A;  3UZT A;  2LOZ A;  2L2I A;  4HHV A;  1V89 A;  1UNQ A;  5C79 A;  5HE1 A;  2Z0P A;  3NSU A;  1WG7 A;  2R0D A;  2EMS A;  1FGZ A;  3KRW A;  1XD4 A;  2N0Y A;  1ZVR A;  1TXD A;  1RRP B;  2YT0 A;  4CHM A;  3QIJ A;  2RVB B;  2GS0 A;  3U8Z A;  3CIK A;  2Z0Q A;  2I1K A;  1ZC4 B;  1KZ7 A;  4A6F A;  4HDO A;  1NI2 A;  2KUP A;  1AWE A;  3G9W A;  5FI1 A;  1XX0 A;  4ZRI A;  3D8D A;  2HTH B;  2D4Q A;  5DH9 B;  2VKI A;  1XR0 B;  4A6H A;  3DXE A;  4A6K A;  2J0K A;  2K2U A;  1Z87 A;  4HAX B;  2YSZ A;  3ZDT A;  5GOW B;  1FGY A;  4KHA A;  1WGQ A;  2YT1 A;  1MIX A;  2PZ1 A;  2RSG A;  2Y7B A;  3QBV B;  2R09 A;  3KZ1 A;  2D2Q A;  2DTC A;  2EC1 A;  5LOP B;  2CAY A;  1ZC3 B;  5L81 A;  4TKN A;  1WVH A;  2LUL A;  3WYF B;  3BJI A;  2NZ8 B;  4DXA B;  2COC A;  1X86 A;  3VOQ A;  1RJ2 A;  4TYZ A;  2EJ8 A;  2I5F A;  2KGX B;  2LG1 A;  2ROZ B;  5C16 A;  4GMV A;  2NMB A;  5JHG A;  3ULB A;  1NTV A;  4IOY X;  5KQ1 A;  2RUK B;  5D27 A;  1MAI A;  5KCV A;  4Y94 A;  5DHF B;  1EGX A;  4DBB A;  1TJ6 A;  3SNH A;  4L6E A;  2EMT A;  3HK0 A;  2J0M A;  1DDM A;  3A98 B;  1NTY A;  2P8V A;  2IFS A;  5DHA B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...