1W1DA

Crystal structure of the pdk1 pleckstrin homology (ph) domain bound to inositol (1,3,4,5)-tetrakisphosphate
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
143
structure length
143
Chain Sequence
PLGSNIEQYIHDLDSNSFELDLQFSEDEKRLLLEKQAGGNPWHQFVENNLILKMGPVDKRKGLFARRRQLLLTEGPHLYYVDPVNKVLKGEIPWSQELRPEAKNFKTFFVHTPNRTYYLMDPSGNAHKWCRKIQEVWRQRYQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 3-PHOSPHOINOSITIDE DEPENDENT PROTEIN KINASE-1
publication title Structural Insights Into the Regulation of Pdk1 by Phosphoinositides and Inositol Phosphates
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 38
structure length 143
sequence length 143
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2004-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14593 PH_3 PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1w1dA00
4D0NB 3ZVRA 4HDOA 2R09A 1EVHA 2KGXB 1NI2A 5JHGA 5KCVA 4HAUB 1U29A 5L81A 1P3RA 2H7DA 1FAOA 2YS3A 4YONA 3MPXA 3VOQA 2IFSA 2E2XA 4Y94A 4A6HA 2YT0A 3N7CA 2D9VA 5HE3A 4P7IA 1V88A 2RSGA 4C0AA 1MIXA 1X1FA 4DBBA 4ZRJA 2VKIA 5D3XA 2D9ZA 2M38A 2COAA 2DLWA 2VRWB 4GMXB 4KHAA 5FI0A 1H10A 5C79A 2I5CA 3P7ZA 4A6FA 2DKPA 2YVCA 3SV1A 1RJ2A 4GPTB 2MKRA 3U7DA 1P5TA 1V5PA 4A6KA 2AL6A 3DXDA 1UNPA 2LOZA 4HAYB 4MY6A 4F7HA 2HTHB 4BBKA 2CODA 2ELBA 1AWEA 1EF1A 2Z0PA 3ZDTA 1OMWA 1M7EA 1XR0B 2D4QA 2J0MA 3PZDA 5JLJB 2EMTA 1M7RA 3GYPA 4WSFA 5CLLB 3DXEA 1Z87A 2D9WA 1WG7A 3PVUA 2M14A 4EKUA 4CHMA 2I5FA 4NY0A 2LG1A 1U5FA 2DHJA 2IYBA 2XQNM 1GG3A 2RVBB 4HAZB 4CYEA 2P0HA 2QKMA 2EC1A 5DI9B 1WGUA 1W1HA 3U8ZA 3HQCA 5D3VA 1ZSQA 1DDVA 3BINA 5HE0A 1U27A 5LOPB 4HAWB 1I7AA 3D8EA 1UNQA 2N23A 1U5GA 1Y5OA 5C6RA 2Q13A 2R0DA 5HE2A 3A98B 1BTNA 2YS5A 2Z0QA 4F7UP 4WJ7A 1V5UA 2ROZB 2YSZA 3WYFB 4A5KA 1NU2A 1U2BA 1WVHA 2OQBA 3KRWA 4A6FB 4K17A 4TKNA 3GYOA 2YS1A 2DN6A 2W2WA 1ZC3B 3KSYA 4IAPA 1QC6A 1TXDA 3IVFA 1SHCA 1KZ7A 2LYDA 3BJIA 4GN1A 1MAIA 4IFSA 3NSUA 1XKEA 2Y7BA 2ROVA 1GC7A 1PFJA 1FB8A 1PMSA 2Z0OA 3FEHA 4DXAB 3A8PA 1AQCA 1FGYA 2N0YA 2P0FA 4Z2NA 2GJYA 1NTVA 1MK7B 2AEHA 2J59M 2OTXA 1TQZA 3DXCA 4KHOA 3KZ1A 5DHAB 3O96A 4K2PA 2D11A 3TO1A 3PVWA 3AJ4A 3F0WA 2UZSA 4KAXB 3QIJA 1BTKA 4HATB 3FM8C 4HAXB 1J0WA 4MT7A 1OQNA 2MDXA 3F5RA 2RNRB 1FHWA 1EGXA 2D9YA 1ISNA 4GXBA 5LONB 3PEGA 4WVFB 3TFMA 2DYNA 2CAYA 1XODA 1PLSA 2RLOA 4YL8A 1LB1A 3P6AA 2DKQA 1DDWA 4HAVB 2K2JA 3ULCA 3HW2B 3ODXA 1IRSA 2MWNB 1WI1A 4KHBB 3TW1A 1B55A 3QBVB 2UVMA 2ADZA 1WGQA 5HE1A 3PSCA 2ZPYA 1FHOA 3D8DA 2I1KA 1Q67A 2CY4A 1Y19B 3ODOA 2DTCA 5D3YA 1W1GA 3T06A 4HB0B 2CRFA 2EMSA 2YF0A 1DBHA 4EJNA 5C16A 2NZ8B 2L2IA 2D9XA 1ZM0A 2H7EA 1X11A 2KCJA 1X86A 3WA0A 1E5WA 2COCA 5C5BA 1P6SA 4GZUA 3X23A 2VSZA 2BCJA 2RUKB 1MKEA 5KQ4A 4HB2B 2DHIA 4MK0A 5KQ1A 1XCGA 4L6EA 2P0DA 1XD4A 4IOYX 1FGZA 3KRXA 2GCLA 1TJ6A 1MIZB 1V89A 2J0KA 4XWXA 2J0JA 1KZGA 3ODWA 3A8QA 5DHFB 1QQGA 2W2XD 3FSSA 1GC6A 5JHHA 3SNHA 1U5DA 1W1DA 1U5EA 5D27A 3PG7A 1N3HA 5DIFB 2ELAA 2QKLA 2G35A 1NTYA 2K2UA 3AU5A 1DROA 2YT1A 1DDMA 1KI1B 1WJ1A 3CIKA 1LW3A 4TYZA 4HDQA 3PVLA 2X18A 1FHXA 2DYQA 4ZRIA 2YRYA 2MFQA 4B6HA 4K81A 2FJLA 5JP4A 2DHKA 1FOEA 2GCJA 5DH9B 1BWNA 2COFA 2DFKA 2RGNB 3RCPA 4NSWA 3SYXA 1K5GB 2D10A 3G9WA 4HHVA 1H4RA 4F7GA 4PNKA 1J19A 1XX0A 2DX1A 2EJ8A 1V61A 4DX8A 2LKOA 4DX90 3TVVA 1X05A 2W2XC 5EFXA 2JP2A 5C5BB 3ML4A 4EMOA 1RRPB 2HE7A 1X1GA 3TCAA 5FI1A 5CLQB 3QWMA 2UZRA 1OY2A 1ZVRA 4HB4B 1UNRA 3M1IB 1EAZA 4Z2MB 3ULBA 4PQ0A 3OANA 1BAKA 4GMVA 1I2HA 2I1JA 2KUPA 2V76A 1WJMA 4H8SA 4KVGB 2K00A 2DX5A 2Y8FA 2NMBA 1UPRA 5D3WA 1K5DB 3PP2A 3SO6A 5J3QA 2LULA 2GS0A 4HB3B 1MK9B 1UEFA 3SUZA 3HK0A 2D2QA 1UPQA 3AU4A 1ZC4B 3KY9A 1DYNA 2P8VA 3VIAA 2CY5A 5J3TA 1V5MA 5GOWB 3D8FA 4K2OA 3V5WA 1SGHA 3MDBC 4CHJA 4ZRKA 5J3YA 3UZTA 2Y8GA 2L1CA 3LJUX 3CXBB 2PZ1A 2DA0A 2LOXA 1MPHA
chains in the Genus database with same CATH superfamily
4D0NB 3ZVRA 4HDOA 2R09A 1EVHA 2KGXB 1NI2A 5JHGA 5KCVA 4HAUB 2FJUB 1U29A 5L81A 1P3RA 2H7DA 1FAOA 2YS3A 4YONA 3MPXA 3VOQA 2IFSA 2E2XA 4Y94A 4A6HA 2YT0A 3N7CA 2D9VA 5HE3A 4P7IA 1V88A 2RSGA 4C0AA 1MIXA 1X1FA 4DBBA 4HSIA 4ZRJA 2VKIA 5D3XA 2D9ZA 2M38A 2COAA 2DLWA 2VRWB 4GMXB 4KHAA 5FI0A 1H10A 5C79A 2I5CA 3P7ZA 4A6FA 2DKPA 2YVCA 3SV1A 1RJ2A 4GPTB 2MKRA 3U7DA 1P5TA 1V5PA 4A6KA 2AL6A 3DXDA 1UNPA 2LOZA 4HAYB 5LG4B 4MY6A 4F7HA 2HTHB 4BBKA 2CODA 2ELBA 2NBVA 1AWEA 1EF1A 2Z0PA 3ZDTA 1OMWA 1M7EA 1XR0B 2D4QA 2J0MA 3PZDA 5JLJB 2EMTA 1M7RA 3GYPA 4WSFA 5CLLB 3DXEA 1Z87A 2D9WA 1WG7A 3PVUA 2M14A 4EKUA 4CHMA 2I5FA 4NY0A 2LG1A 1U5FA 2DHJA 2IYBA 2XQNM 1GG3A 2RVBB 4HAZB 4CYEA 2P0HA 2QKMA 2EC1A 5DI9B 1WGUA 1W1HA 3U8ZA 3HQCA 5D3VA 1ZSQA 1DDVA 3BINA 5HE0A 1U27A 5LOPB 4HAWB 1I7AA 3D8EA 1UNQA 2N23A 1U5GA 1Y5OA 5C6RA 2Q13A 4CSQA 2R0DA 5HE2A 3A98B 1BTNA 2YS5A 2Z0QA 4F7UP 4WJ7A 1V5UA 2ROZB 2YSZA 3WYFB 4A5KA 1NU2A 1U2BA 1WVHA 2OQBA 3KRWA 4A6FB 4K17A 4TKNA 5I2MA 3GYOA 2YS1A 2DN6A 2W2WA 1ZC3B 3KSYA 4IAPA 3B77A 1QC6A 1TXDA 3IVFA 1SHCA 1KZ7A 2LYDA 3BJIA 4KHBA 4GN1A 1MAIA 4GNKB 3NWAA 4IFSA 2GUMA 3NSUA 1XKEA 2Y7BA 2ROVA 3NWDA 1GC7A 1PFJA 1FB8A 1PMSA 2Z0OA 3FEHA 4DXAB 4OT1A 3A8PA 1AQCA 1FGYA 2N0YA 2P0FA 4Z2NA 2GJYA 1NTVA 1MK7B 2AEHA 4QJ3B 2J59M 2OTXA 1TQZA 3DXCA 4KHOA 3KZ1A 5DHAB 3O96A 4K2PA 2D11A 3TO1A 3PVWA 3AJ4A 3F0WA 2UZSA 4KAXB 3QIJA 1BTKA 4HATB 3FM8C 4HAXB 1J0WA 4QJ5B 4MT7A 1OQNA 2MDXA 3F5RA 3OHMB 2RNRB 1FHWA 1EGXA 2D9YA 4D6WA 1ISNA 4GXBA 5LONB 3PEGA 1MI1A 4WVFB 3TFMA 2DYNA 2RRFA 2CAYA 2Z59A 1XODA 4QJ4B 1PLSA 2RLOA 4YL8A 1LB1A 3P6AA 2DKQA 1DDWA 4HAVB 2K2JA 3ULCA 5I2SA 3HW2B 3ODXA 1IRSA 2KUQA 2MWNB 1WI1A 4KHBB 3TW1A 1B55A 4GOUA 3QBVB 2UVMA 2ADZA 1WGQA 5HE1A 3PSCA 2ZPYA 1FHOA 3D8DA 2I1KA 2KIEA 2Z4DA 1Q67A 2CY4A 1Y19B 3ODOA 2DTCA 5D3YA 1W1GA 3T06A 4HB0B 2CRFA 2EMSA 2YF0A 2K49A 1DBHA 4EJNA 4L1RA 5C16A 2NZ8B 2L2IA 2D9XA 1ZM0A 2H7EA 1X11A 2KCJA 1X86A 3WA0A 1E5WA 2COCA 5C5BA 1P6SA 4GZUA 3X23A 2VSZA 2BCJA 2RUKB 1MKEA 5KQ4A 4HB2B 2DHIA 4MK0A 5KQ1A 1XCGA 4L6EA 2P0DA 1XD4A 4IOYX 1FGZA 3KRXA 2GCLA 1TJ6A 1MIZB 1V89A 2J0KA 4XWXA 2J0JA 1KZGA 2K8EA 3ODWA 3A8QA 2YT2A 5DHFB 1T77A 2Z14A 1QQGA 2W2XD 3FSSA 1GC6A 5JHHA 3SNHA 1U5DA 1W1DA 3NWFA 1U5EA 5D27A 3PG7A 1N3HA 5DIFB 2ELAA 2QKLA 2G35A 1NTYA 2K2UA 3AU5A 1DROA 2YT1A 1DDMA 1KI1B 1WJ1A 3CIKA 1LW3A 4TYZA 4HDQA 3PVLA 2X18A 2ZKMX 1FHXA 2DYQA 2Z13A 4ZRIA 2YRYA 2MFQA 4B6HA 4K81A 4DIXA 2FJLA 5JP4A 2DHKA 1FOEA 2GCJA 5DH9B 1BWNA 2COFA 2DFKA 2RGNB 3RCPA 4NSWA 3SYXA 1K5GB 2D10A 3G9WA 3DCXA 4HHVA 1H4RA 3FVCA 4F7GA 4PNKA 1J19A 1XX0A 2DX1A 2EJ8A 2R2YA 1V61A 2KIGA 2LKOA 3NW8A 4DX90 4DX8A 3TVVA 1X05A 2W2XC 5EFXA 2JP2A 5C5BB 3ML4A 3U12A 4EMOA 1RRPB 2HE7A 1X1GA 2KR0A 3TCAA 5FI1A 5M4YB 5CLQB 3QWMA 2UZRA 1OY2A 1ZVRA 4HB4B 1UNRA 3M1IB 4OSNA 1EAZA 3HSAA 4QXAB 4Z2MB 3ULBA 4PQ0A 3OANA 1BAKA 4GMVA 1I2HA 2I1JA 2KUPA 2V76A 1WJMA 4H8SA 4KVGB 2K00A 2DX5A 2Y8FA 5IRSA 2NMBA 1UPRA 1ZYIA 5D3WA 1K5DB 3PP2A 3SO6A 5J3QA 2LULA 2GS0A 4HB3B 3A58A 1MK9B 1UEFA 3SUZA 3HK0A 2D2QA 1UPQA 3AU4A 1ZC4B 3KY9A 1DYNA 2P8VA 3VIAA 2CY5A 5J3TA 1V5MA 5GOWB 3D8FA 4K2OA 3V5WA 1SGHA 3MDBC 4CHJA 3HIEA 4ZRKA 5J3YA 3UZTA 2Y8GA 2L1CA 3LJUX 3CXBB 2PZ1A 2DA0A 2LOXA 1MPHA
chains in the Genus database with same CATH topology
4D0NB 3ZVRA 4HDOA 2R09A 1EVHA 2KGXB 1NI2A 5JHGA 5KCVA 4HAUB 1U29A 5L81A 1P3RA 2H7DA 1FAOA 2YS3A 4YONA 3MPXA 3VOQA 2IFSA 2E2XA 4Y94A 4A6HA 2YT0A 3N7CA 2D9VA 5HE3A 4P7IA 1V88A 2RSGA 4C0AA 1MIXA 1X1FA 4DBBA 4ZRJA 2VKIA 5D3XA 2D9ZA 2M38A 2COAA 2DLWA 2VRWB 4GMXB 4KHAA 5FI0A 1H10A 5C79A 2I5CA 3P7ZA 4A6FA 2DKPA 2YVCA 3SV1A 1RJ2A 4GPTB 2MKRA 3U7DA 1P5TA 1V5PA 4A6KA 2AL6A 3DXDA 1UNPA 2LOZA 4HAYB 4MY6A 4F7HA 2HTHB 4BBKA 2CODA 2ELBA 1AWEA 1EF1A 2Z0PA 3ZDTA 1OMWA 1M7EA 1XR0B 2D4QA 2J0MA 3PZDA 5JLJB 2EMTA 1M7RA 3GYPA 4WSFA 5CLLB 3DXEA 1Z87A 2D9WA 1WG7A 3PVUA 2M14A 4EKUA 4CHMA 2I5FA 4NY0A 2LG1A 1U5FA 2DHJA 2IYBA 2XQNM 1GG3A 2RVBB 4HAZB 4CYEA 2P0HA 2QKMA 2EC1A 5DI9B 1WGUA 1W1HA 3U8ZA 3HQCA 5D3VA 1ZSQA 1DDVA 3BINA 5HE0A 1U27A 5LOPB 4HAWB 1I7AA 3D8EA 1UNQA 2N23A 1U5GA 1Y5OA 5C6RA 2Q13A 2R0DA 5HE2A 3A98B 1BTNA 2YS5A 2Z0QA 4F7UP 4WJ7A 1V5UA 2ROZB 2YSZA 3WYFB 4A5KA 1NU2A 1U2BA 1WVHA 2OQBA 3KRWA 4A6FB 4K17A 4TKNA 3GYOA 2YS1A 2DN6A 2W2WA 1ZC3B 3KSYA 4IAPA 1QC6A 1TXDA 3IVFA 1SHCA 1KZ7A 2LYDA 3BJIA 4GN1A 1MAIA 4IFSA 3NSUA 1XKEA 2Y7BA 2ROVA 1GC7A 1PFJA 1FB8A 1PMSA 2Z0OA 3FEHA 4DXAB 3A8PA 1AQCA 1FGYA 2N0YA 2P0FA 4Z2NA 2GJYA 1NTVA 1MK7B 2AEHA 2J59M 2OTXA 1TQZA 3DXCA 4KHOA 3KZ1A 5DHAB 3O96A 4K2PA 2D11A 3TO1A 3PVWA 3AJ4A 3F0WA 2UZSA 4KAXB 3QIJA 1BTKA 4HATB 3FM8C 4HAXB 1J0WA 4MT7A 1OQNA 2MDXA 3F5RA 2RNRB 1FHWA 1EGXA 2D9YA 1ISNA 4GXBA 5LONB 3PEGA 4WVFB 3TFMA 2DYNA 2CAYA 1XODA 1PLSA 2RLOA 4YL8A 1LB1A 3P6AA 2DKQA 1DDWA 4HAVB 2K2JA 3ULCA 3HW2B 3ODXA 1IRSA 2MWNB 1WI1A 4KHBB 3TW1A 1B55A 3QBVB 2UVMA 2ADZA 1WGQA 5HE1A 3PSCA 2ZPYA 1FHOA 3D8DA 2I1KA 1Q67A 2CY4A 1Y19B 3ODOA 2DTCA 5D3YA 1W1GA 3T06A 4HB0B 2CRFA 2EMSA 2YF0A 1DBHA 4EJNA 5C16A 2NZ8B 2L2IA 2D9XA 1ZM0A 2H7EA 1X11A 2KCJA 1X86A 3WA0A 1E5WA 2COCA 5C5BA 1P6SA 4GZUA 3X23A 2VSZA 2BCJA 2RUKB 1MKEA 5KQ4A 4HB2B 2DHIA 4MK0A 5KQ1A 1XCGA 4L6EA 2P0DA 1XD4A 4IOYX 1FGZA 3KRXA 2GCLA 1TJ6A 1MIZB 1V89A 2J0KA 4XWXA 2J0JA 1KZGA 3ODWA 3A8QA 5DHFB 1QQGA 2W2XD 3FSSA 1GC6A 5JHHA 3SNHA 1U5DA 1W1DA 1U5EA 5D27A 3PG7A 1N3HA 5DIFB 2ELAA 2QKLA 2G35A 1NTYA 2K2UA 3AU5A 1DROA 2YT1A 1DDMA 1KI1B 1WJ1A 3CIKA 1LW3A 4TYZA 4HDQA 3PVLA 2X18A 1FHXA 2DYQA 4ZRIA 2YRYA 2MFQA 4B6HA 4K81A 2FJLA 5JP4A 2DHKA 1FOEA 2GCJA 5DH9B 1BWNA 2COFA 2DFKA 2RGNB 3RCPA 4NSWA 3SYXA 1K5GB 2D10A 3G9WA 4HHVA 1H4RA 4F7GA 4PNKA 1J19A 1XX0A 2DX1A 2EJ8A 1V61A 4DX8A 2LKOA 4DX90 3TVVA 1X05A 2W2XC 5EFXA 2JP2A 5C5BB 3ML4A 4EMOA 1RRPB 2HE7A 1X1GA 3TCAA 5FI1A 5CLQB 3QWMA 2UZRA 1OY2A 1ZVRA 4HB4B 1UNRA 3M1IB 1EAZA 4Z2MB 3ULBA 4PQ0A 3OANA 1BAKA 4GMVA 1I2HA 2I1JA 2KUPA 2V76A 1WJMA 4H8SA 4KVGB 2K00A 2DX5A 2Y8FA 2NMBA 1UPRA 5D3WA 1K5DB 3PP2A 3SO6A 5J3QA 2LULA 2GS0A 4HB3B 1MK9B 1UEFA 3SUZA 3HK0A 2D2QA 1UPQA 3AU4A 1ZC4B 3KY9A 1DYNA 2P8VA 3VIAA 2CY5A 5J3TA 1V5MA 5GOWB 3D8FA 4K2OA 3V5WA 1SGHA 3MDBC 4CHJA 4ZRKA 5J3YA 3UZTA 2Y8GA 2L1CA 3LJUX 3CXBB 2PZ1A 2DA0A 2LOXA 1MPHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4D0N B;  3ZVR A;  4HDO A;  2R09 A;  1EVH A;  2KGX B;  1NI2 A;  5JHG A;  5KCV A;  4HAU B;  1U29 A;  5L81 A;  1P3R A;  2H7D A;  1FAO A;  2YS3 A;  4YON A;  3MPX A;  3VOQ A;  2IFS A;  2E2X A;  4Y94 A;  4A6H A;  2YT0 A;  3N7C A;  2D9V A;  5HE3 A;  4P7I A;  1V88 A;  2RSG A;  4C0A A;  1MIX A;  1X1F A;  4DBB A;  4ZRJ A;  2VKI A;  5D3X A;  2D9Z A;  2M38 A;  2COA A;  2DLW A;  2VRW B;  4GMX B;  4KHA A;  5FI0 A;  1H10 A;  5C79 A;  2I5C A;  3P7Z A;  4A6F A;  2DKP A;  2YVC A;  3SV1 A;  1RJ2 A;  4GPT B;  2MKR A;  3U7D A;  1P5T A;  1V5P A;  4A6K A;  2AL6 A;  3DXD A;  1UNP A;  2LOZ A;  4HAY B;  4MY6 A;  4F7H A;  2HTH B;  4BBK A;  2COD A;  2ELB A;  1AWE A;  1EF1 A;  2Z0P A;  3ZDT A;  1OMW A;  1M7E A;  1XR0 B;  2D4Q A;  2J0M A;  3PZD A;  5JLJ B;  2EMT A;  1M7R A;  3GYP A;  4WSF A;  5CLL B;  3DXE A;  1Z87 A;  2D9W A;  1WG7 A;  3PVU A;  2M14 A;  4EKU A;  4CHM A;  2I5F A;  4NY0 A;  2LG1 A;  1U5F A;  2DHJ A;  2IYB A;  2XQN M;  1GG3 A;  2RVB B;  4HAZ B;  4CYE A;  2P0H A;  2QKM A;  2EC1 A;  5DI9 B;  1WGU A;  1W1H A;  3U8Z A;  3HQC A;  5D3V A;  1ZSQ A;  1DDV A;  3BIN A;  5HE0 A;  1U27 A;  5LOP B;  4HAW B;  1I7A A;  3D8E A;  1UNQ A;  2N23 A;  1U5G A;  1Y5O A;  5C6R A;  2Q13 A;  2R0D A;  5HE2 A;  3A98 B;  1BTN A;  2YS5 A;  2Z0Q A;  4F7U P;  4WJ7 A;  1V5U A;  2ROZ B;  2YSZ A;  3WYF B;  4A5K A;  1NU2 A;  1U2B A;  1WVH A;  2OQB A;  3KRW A;  4A6F B;  4K17 A;  4TKN A;  3GYO A;  2YS1 A;  2DN6 A;  2W2W A;  1ZC3 B;  3KSY A;  4IAP A;  1QC6 A;  1TXD A;  3IVF A;  1SHC A;  1KZ7 A;  2LYD A;  3BJI A;  4GN1 A;  1MAI A;  4IFS A;  3NSU A;  1XKE A;  2Y7B A;  2ROV A;  1GC7 A;  1PFJ A;  1FB8 A;  1PMS A;  2Z0O A;  3FEH A;  4DXA B;  3A8P A;  1AQC A;  1FGY A;  2N0Y A;  2P0F A;  4Z2N A;  2GJY A;  1NTV A;  1MK7 B;  2AEH A;  2J59 M;  2OTX A;  1TQZ A;  3DXC A;  4KHO A;  3KZ1 A;  5DHA B;  3O96 A;  4K2P A;  2D11 A;  3TO1 A;  3PVW A;  3AJ4 A;  3F0W A;  2UZS A;  4KAX B;  3QIJ A;  1BTK A;  4HAT B;  3FM8 C;  4HAX B;  1J0W A;  4MT7 A;  1OQN A;  2MDX A;  3F5R A;  2RNR B;  1FHW A;  1EGX A;  2D9Y A;  1ISN A;  4GXB A;  5LON B;  3PEG A;  4WVF B;  3TFM A;  2DYN A;  2CAY A;  1XOD A;  1PLS A;  2RLO A;  4YL8 A;  1LB1 A;  3P6A A;  2DKQ A;  1DDW A;  4HAV B;  2K2J A;  3ULC A;  3HW2 B;  3ODX A;  1IRS A;  2MWN B;  1WI1 A;  4KHB B;  3TW1 A;  1B55 A;  3QBV B;  2UVM A;  2ADZ A;  1WGQ A;  5HE1 A;  3PSC A;  2ZPY A;  1FHO A;  3D8D A;  2I1K A;  1Q67 A;  2CY4 A;  1Y19 B;  3ODO A;  2DTC A;  5D3Y A;  1W1G A;  3T06 A;  4HB0 B;  2CRF A;  2EMS A;  2YF0 A;  1DBH A;  4EJN A;  5C16 A;  2NZ8 B;  2L2I A;  2D9X A;  1ZM0 A;  2H7E A;  1X11 A;  2KCJ A;  1X86 A;  3WA0 A;  1E5W A;  2COC A;  5C5B A;  1P6S A;  4GZU A;  3X23 A;  2VSZ A;  2BCJ A;  2RUK B;  1MKE A;  5KQ4 A;  4HB2 B;  2DHI A;  4MK0 A;  5KQ1 A;  1XCG A;  4L6E A;  2P0D A;  1XD4 A;  4IOY X;  1FGZ A;  3KRX A;  2GCL A;  1TJ6 A;  1MIZ B;  1V89 A;  2J0K A;  4XWX A;  2J0J A;  1KZG A;  3ODW A;  3A8Q A;  5DHF B;  1QQG A;  2W2X D;  3FSS A;  1GC6 A;  5JHH A;  3SNH A;  1U5D A;  1W1D A;  1U5E A;  5D27 A;  3PG7 A;  1N3H A;  5DIF B;  2ELA A;  2QKL A;  2G35 A;  1NTY A;  2K2U A;  3AU5 A;  1DRO A;  2YT1 A;  1DDM A;  1KI1 B;  1WJ1 A;  3CIK A;  1LW3 A;  4TYZ A;  4HDQ A;  3PVL A;  2X18 A;  1FHX A;  2DYQ A;  4ZRI A;  2YRY A;  2MFQ A;  4B6H A;  4K81 A;  2FJL A;  5JP4 A;  2DHK A;  1FOE A;  2GCJ A;  5DH9 B;  1BWN A;  2COF A;  2DFK A;  2RGN B;  3RCP A;  4NSW A;  3SYX A;  1K5G B;  2D10 A;  3G9W A;  4HHV A;  1H4R A;  4F7G A;  4PNK A;  1J19 A;  1XX0 A;  2DX1 A;  2EJ8 A;  1V61 A;  4DX8 A;  2LKO A;  4DX9 0;  3TVV A;  1X05 A;  2W2X C;  5EFX A;  2JP2 A;  5C5B B;  3ML4 A;  4EMO A;  1RRP B;  2HE7 A;  1X1G A;  3TCA A;  5FI1 A;  5CLQ B;  3QWM A;  2UZR A;  1OY2 A;  1ZVR A;  4HB4 B;  1UNR A;  3M1I B;  1EAZ A;  4Z2M B;  3ULB A;  4PQ0 A;  3OAN A;  1BAK A;  4GMV A;  1I2H A;  2I1J A;  2KUP A;  2V76 A;  1WJM A;  4H8S A;  4KVG B;  2K00 A;  2DX5 A;  2Y8F A;  2NMB A;  1UPR A;  5D3W A;  1K5D B;  3PP2 A;  3SO6 A;  5J3Q A;  2LUL A;  2GS0 A;  4HB3 B;  1MK9 B;  1UEF A;  3SUZ A;  3HK0 A;  2D2Q A;  1UPQ A;  3AU4 A;  1ZC4 B;  3KY9 A;  1DYN A;  2P8V A;  3VIA A;  2CY5 A;  5J3T A;  1V5M A;  5GOW B;  3D8F A;  4K2O A;  3V5W A;  1SGH A;  3MDB C;  4CHJ A;  4ZRK A;  5J3Y A;  3UZT A;  2Y8G A;  2L1C A;  3LJU X;  3CXB B;  2PZ1 A;  2DA0 A;  2LOX A;  1MPH A; 
#chains in the Genus database with same CATH topology
 4D0N B;  3ZVR A;  4HDO A;  2R09 A;  1EVH A;  2KGX B;  1NI2 A;  5JHG A;  5KCV A;  4HAU B;  2FJU B;  1U29 A;  5L81 A;  1P3R A;  2H7D A;  1FAO A;  2YS3 A;  4YON A;  3MPX A;  3VOQ A;  2IFS A;  2E2X A;  4Y94 A;  4A6H A;  2YT0 A;  3N7C A;  2D9V A;  5HE3 A;  4P7I A;  1V88 A;  2RSG A;  4C0A A;  1MIX A;  1X1F A;  4DBB A;  4HSI A;  4ZRJ A;  2VKI A;  5D3X A;  2D9Z A;  2M38 A;  2COA A;  2DLW A;  2VRW B;  4GMX B;  4KHA A;  5FI0 A;  1H10 A;  5C79 A;  2I5C A;  3P7Z A;  4A6F A;  2DKP A;  2YVC A;  3SV1 A;  1RJ2 A;  4GPT B;  2MKR A;  3U7D A;  1P5T A;  1V5P A;  4A6K A;  2AL6 A;  3DXD A;  1UNP A;  2LOZ A;  4HAY B;  5LG4 B;  4MY6 A;  4F7H A;  2HTH B;  4BBK A;  2COD A;  2ELB A;  2NBV A;  1AWE A;  1EF1 A;  2Z0P A;  3ZDT A;  1OMW A;  1M7E A;  1XR0 B;  2D4Q A;  2J0M A;  3PZD A;  5JLJ B;  2EMT A;  1M7R A;  3GYP A;  4WSF A;  5CLL B;  3DXE A;  1Z87 A;  2D9W A;  1WG7 A;  3PVU A;  2M14 A;  4EKU A;  4CHM A;  2I5F A;  4NY0 A;  2LG1 A;  1U5F A;  2DHJ A;  2IYB A;  2XQN M;  1GG3 A;  2RVB B;  4HAZ B;  4CYE A;  2P0H A;  2QKM A;  2EC1 A;  5DI9 B;  1WGU A;  1W1H A;  3U8Z A;  3HQC A;  5D3V A;  1ZSQ A;  1DDV A;  3BIN A;  5HE0 A;  1U27 A;  5LOP B;  4HAW B;  1I7A A;  3D8E A;  1UNQ A;  2N23 A;  1U5G A;  1Y5O A;  5C6R A;  2Q13 A;  4CSQ A;  2R0D A;  5HE2 A;  3A98 B;  1BTN A;  2YS5 A;  2Z0Q A;  4F7U P;  4WJ7 A;  1V5U A;  2ROZ B;  2YSZ A;  3WYF B;  4A5K A;  1NU2 A;  1U2B A;  1WVH A;  2OQB A;  3KRW A;  4A6F B;  4K17 A;  4TKN A;  5I2M A;  3GYO A;  2YS1 A;  2DN6 A;  2W2W A;  1ZC3 B;  3KSY A;  4IAP A;  3B77 A;  1QC6 A;  1TXD A;  3IVF A;  1SHC A;  1KZ7 A;  2LYD A;  3BJI A;  4KHB A;  4GN1 A;  1MAI A;  4GNK B;  3NWA A;  4IFS A;  2GUM A;  3NSU A;  1XKE A;  2Y7B A;  2ROV A;  3NWD A;  1GC7 A;  1PFJ A;  1FB8 A;  1PMS A;  2Z0O A;  3FEH A;  4DXA B;  4OT1 A;  3A8P A;  1AQC A;  1FGY A;  2N0Y A;  2P0F A;  4Z2N A;  2GJY A;  1NTV A;  1MK7 B;  2AEH A;  4QJ3 B;  2J59 M;  2OTX A;  1TQZ A;  3DXC A;  4KHO A;  3KZ1 A;  5DHA B;  3O96 A;  4K2P A;  2D11 A;  3TO1 A;  3PVW A;  3AJ4 A;  3F0W A;  2UZS A;  4KAX B;  3QIJ A;  1BTK A;  4HAT B;  3FM8 C;  4HAX B;  1J0W A;  4QJ5 B;  4MT7 A;  1OQN A;  2MDX A;  3F5R A;  3OHM B;  2RNR B;  1FHW A;  1EGX A;  2D9Y A;  4D6W A;  1ISN A;  4GXB A;  5LON B;  3PEG A;  1MI1 A;  4WVF B;  3TFM A;  2DYN A;  2RRF A;  2CAY A;  2Z59 A;  1XOD A;  4QJ4 B;  1PLS A;  2RLO A;  4YL8 A;  1LB1 A;  3P6A A;  2DKQ A;  1DDW A;  4HAV B;  2K2J A;  3ULC A;  5I2S A;  3HW2 B;  3ODX A;  1IRS A;  2KUQ A;  2MWN B;  1WI1 A;  4KHB B;  3TW1 A;  1B55 A;  4GOU A;  3QBV B;  2UVM A;  2ADZ A;  1WGQ A;  5HE1 A;  3PSC A;  2ZPY A;  1FHO A;  3D8D A;  2I1K A;  2KIE A;  2Z4D A;  1Q67 A;  2CY4 A;  1Y19 B;  3ODO A;  2DTC A;  5D3Y A;  1W1G A;  3T06 A;  4HB0 B;  2CRF A;  2EMS A;  2YF0 A;  2K49 A;  1DBH A;  4EJN A;  4L1R A;  5C16 A;  2NZ8 B;  2L2I A;  2D9X A;  1ZM0 A;  2H7E A;  1X11 A;  2KCJ A;  1X86 A;  3WA0 A;  1E5W A;  2COC A;  5C5B A;  1P6S A;  4GZU A;  3X23 A;  2VSZ A;  2BCJ A;  2RUK B;  1MKE A;  5KQ4 A;  4HB2 B;  2DHI A;  4MK0 A;  5KQ1 A;  1XCG A;  4L6E A;  2P0D A;  1XD4 A;  4IOY X;  1FGZ A;  3KRX A;  2GCL A;  1TJ6 A;  1MIZ B;  1V89 A;  2J0K A;  4XWX A;  2J0J A;  1KZG A;  2K8E A;  3ODW A;  3A8Q A;  2YT2 A;  5DHF B;  1T77 A;  2Z14 A;  1QQG A;  2W2X D;  3FSS A;  1GC6 A;  5JHH A;  3SNH A;  1U5D A;  1W1D A;  3NWF A;  1U5E A;  5D27 A;  3PG7 A;  1N3H A;  5DIF B;  2ELA A;  2QKL A;  2G35 A;  1NTY A;  2K2U A;  3AU5 A;  1DRO A;  2YT1 A;  1DDM A;  1KI1 B;  1WJ1 A;  3CIK A;  1LW3 A;  4TYZ A;  4HDQ A;  3PVL A;  2X18 A;  2ZKM X;  1FHX A;  2DYQ A;  2Z13 A;  4ZRI A;  2YRY A;  2MFQ A;  4B6H A;  4K81 A;  4DIX A;  2FJL A;  5JP4 A;  2DHK A;  1FOE A;  2GCJ A;  5DH9 B;  1BWN A;  2COF A;  2DFK A;  2RGN B;  3RCP A;  4NSW A;  3SYX A;  1K5G B;  2D10 A;  3G9W A;  3DCX A;  4HHV A;  1H4R A;  3FVC A;  4F7G A;  4PNK A;  1J19 A;  1XX0 A;  2DX1 A;  2EJ8 A;  2R2Y A;  1V61 A;  2KIG A;  2LKO A;  3NW8 A;  4DX9 0;  4DX8 A;  3TVV A;  1X05 A;  2W2X C;  5EFX A;  2JP2 A;  5C5B B;  3ML4 A;  3U12 A;  4EMO A;  1RRP B;  2HE7 A;  1X1G A;  2KR0 A;  3TCA A;  5FI1 A;  5M4Y B;  5CLQ B;  3QWM A;  2UZR A;  1OY2 A;  1ZVR A;  4HB4 B;  1UNR A;  3M1I B;  4OSN A;  1EAZ A;  3HSA A;  4QXA B;  4Z2M B;  3ULB A;  4PQ0 A;  3OAN A;  1BAK A;  4GMV A;  1I2H A;  2I1J A;  2KUP A;  2V76 A;  1WJM A;  4H8S A;  4KVG B;  2K00 A;  2DX5 A;  2Y8F A;  5IRS A;  2NMB A;  1UPR A;  1ZYI A;  5D3W A;  1K5D B;  3PP2 A;  3SO6 A;  5J3Q A;  2LUL A;  2GS0 A;  4HB3 B;  3A58 A;  1MK9 B;  1UEF A;  3SUZ A;  3HK0 A;  2D2Q A;  1UPQ A;  3AU4 A;  1ZC4 B;  3KY9 A;  1DYN A;  2P8V A;  3VIA A;  2CY5 A;  5J3T A;  1V5M A;  5GOW B;  3D8F A;  4K2O A;  3V5W A;  1SGH A;  3MDB C;  4CHJ A;  3HIE A;  4ZRK A;  5J3Y A;  3UZT A;  2Y8G A;  2L1C A;  3LJU X;  3CXB B;  2PZ1 A;  2DA0 A;  2LOX A;  1MPH A; 
#chains in the Genus database with same CATH homology
 4D0N B;  3ZVR A;  4HDO A;  2R09 A;  1EVH A;  2KGX B;  1NI2 A;  5JHG A;  5KCV A;  4HAU B;  1U29 A;  5L81 A;  1P3R A;  2H7D A;  1FAO A;  2YS3 A;  4YON A;  3MPX A;  3VOQ A;  2IFS A;  2E2X A;  4Y94 A;  4A6H A;  2YT0 A;  3N7C A;  2D9V A;  5HE3 A;  4P7I A;  1V88 A;  2RSG A;  4C0A A;  1MIX A;  1X1F A;  4DBB A;  4ZRJ A;  2VKI A;  5D3X A;  2D9Z A;  2M38 A;  2COA A;  2DLW A;  2VRW B;  4GMX B;  4KHA A;  5FI0 A;  1H10 A;  5C79 A;  2I5C A;  3P7Z A;  4A6F A;  2DKP A;  2YVC A;  3SV1 A;  1RJ2 A;  4GPT B;  2MKR A;  3U7D A;  1P5T A;  1V5P A;  4A6K A;  2AL6 A;  3DXD A;  1UNP A;  2LOZ A;  4HAY B;  4MY6 A;  4F7H A;  2HTH B;  4BBK A;  2COD A;  2ELB A;  1AWE A;  1EF1 A;  2Z0P A;  3ZDT A;  1OMW A;  1M7E A;  1XR0 B;  2D4Q A;  2J0M A;  3PZD A;  5JLJ B;  2EMT A;  1M7R A;  3GYP A;  4WSF A;  5CLL B;  3DXE A;  1Z87 A;  2D9W A;  1WG7 A;  3PVU A;  2M14 A;  4EKU A;  4CHM A;  2I5F A;  4NY0 A;  2LG1 A;  1U5F A;  2DHJ A;  2IYB A;  2XQN M;  1GG3 A;  2RVB B;  4HAZ B;  4CYE A;  2P0H A;  2QKM A;  2EC1 A;  5DI9 B;  1WGU A;  1W1H A;  3U8Z A;  3HQC A;  5D3V A;  1ZSQ A;  1DDV A;  3BIN A;  5HE0 A;  1U27 A;  5LOP B;  4HAW B;  1I7A A;  3D8E A;  1UNQ A;  2N23 A;  1U5G A;  1Y5O A;  5C6R A;  2Q13 A;  2R0D A;  5HE2 A;  3A98 B;  1BTN A;  2YS5 A;  2Z0Q A;  4F7U P;  4WJ7 A;  1V5U A;  2ROZ B;  2YSZ A;  3WYF B;  4A5K A;  1NU2 A;  1U2B A;  1WVH A;  2OQB A;  3KRW A;  4A6F B;  4K17 A;  4TKN A;  3GYO A;  2YS1 A;  2DN6 A;  2W2W A;  1ZC3 B;  3KSY A;  4IAP A;  1QC6 A;  1TXD A;  3IVF A;  1SHC A;  1KZ7 A;  2LYD A;  3BJI A;  4GN1 A;  1MAI A;  4IFS A;  3NSU A;  1XKE A;  2Y7B A;  2ROV A;  1GC7 A;  1PFJ A;  1FB8 A;  1PMS A;  2Z0O A;  3FEH A;  4DXA B;  3A8P A;  1AQC A;  1FGY A;  2N0Y A;  2P0F A;  4Z2N A;  2GJY A;  1NTV A;  1MK7 B;  2AEH A;  2J59 M;  2OTX A;  1TQZ A;  3DXC A;  4KHO A;  3KZ1 A;  5DHA B;  3O96 A;  4K2P A;  2D11 A;  3TO1 A;  3PVW A;  3AJ4 A;  3F0W A;  2UZS A;  4KAX B;  3QIJ A;  1BTK A;  4HAT B;  3FM8 C;  4HAX B;  1J0W A;  4MT7 A;  1OQN A;  2MDX A;  3F5R A;  2RNR B;  1FHW A;  1EGX A;  2D9Y A;  1ISN A;  4GXB A;  5LON B;  3PEG A;  4WVF B;  3TFM A;  2DYN A;  2CAY A;  1XOD A;  1PLS A;  2RLO A;  4YL8 A;  1LB1 A;  3P6A A;  2DKQ A;  1DDW A;  4HAV B;  2K2J A;  3ULC A;  3HW2 B;  3ODX A;  1IRS A;  2MWN B;  1WI1 A;  4KHB B;  3TW1 A;  1B55 A;  3QBV B;  2UVM A;  2ADZ A;  1WGQ A;  5HE1 A;  3PSC A;  2ZPY A;  1FHO A;  3D8D A;  2I1K A;  1Q67 A;  2CY4 A;  1Y19 B;  3ODO A;  2DTC A;  5D3Y A;  1W1G A;  3T06 A;  4HB0 B;  2CRF A;  2EMS A;  2YF0 A;  1DBH A;  4EJN A;  5C16 A;  2NZ8 B;  2L2I A;  2D9X A;  1ZM0 A;  2H7E A;  1X11 A;  2KCJ A;  1X86 A;  3WA0 A;  1E5W A;  2COC A;  5C5B A;  1P6S A;  4GZU A;  3X23 A;  2VSZ A;  2BCJ A;  2RUK B;  1MKE A;  5KQ4 A;  4HB2 B;  2DHI A;  4MK0 A;  5KQ1 A;  1XCG A;  4L6E A;  2P0D A;  1XD4 A;  4IOY X;  1FGZ A;  3KRX A;  2GCL A;  1TJ6 A;  1MIZ B;  1V89 A;  2J0K A;  4XWX A;  2J0J A;  1KZG A;  3ODW A;  3A8Q A;  5DHF B;  1QQG A;  2W2X D;  3FSS A;  1GC6 A;  5JHH A;  3SNH A;  1U5D A;  1W1D A;  1U5E A;  5D27 A;  3PG7 A;  1N3H A;  5DIF B;  2ELA A;  2QKL A;  2G35 A;  1NTY A;  2K2U A;  3AU5 A;  1DRO A;  2YT1 A;  1DDM A;  1KI1 B;  1WJ1 A;  3CIK A;  1LW3 A;  4TYZ A;  4HDQ A;  3PVL A;  2X18 A;  1FHX A;  2DYQ A;  4ZRI A;  2YRY A;  2MFQ A;  4B6H A;  4K81 A;  2FJL A;  5JP4 A;  2DHK A;  1FOE A;  2GCJ A;  5DH9 B;  1BWN A;  2COF A;  2DFK A;  2RGN B;  3RCP A;  4NSW A;  3SYX A;  1K5G B;  2D10 A;  3G9W A;  4HHV A;  1H4R A;  4F7G A;  4PNK A;  1J19 A;  1XX0 A;  2DX1 A;  2EJ8 A;  1V61 A;  4DX8 A;  2LKO A;  4DX9 0;  3TVV A;  1X05 A;  2W2X C;  5EFX A;  2JP2 A;  5C5B B;  3ML4 A;  4EMO A;  1RRP B;  2HE7 A;  1X1G A;  3TCA A;  5FI1 A;  5CLQ B;  3QWM A;  2UZR A;  1OY2 A;  1ZVR A;  4HB4 B;  1UNR A;  3M1I B;  1EAZ A;  4Z2M B;  3ULB A;  4PQ0 A;  3OAN A;  1BAK A;  4GMV A;  1I2H A;  2I1J A;  2KUP A;  2V76 A;  1WJM A;  4H8S A;  4KVG B;  2K00 A;  2DX5 A;  2Y8F A;  2NMB A;  1UPR A;  5D3W A;  1K5D B;  3PP2 A;  3SO6 A;  5J3Q A;  2LUL A;  2GS0 A;  4HB3 B;  1MK9 B;  1UEF A;  3SUZ A;  3HK0 A;  2D2Q A;  1UPQ A;  3AU4 A;  1ZC4 B;  3KY9 A;  1DYN A;  2P8V A;  3VIA A;  2CY5 A;  5J3T A;  1V5M A;  5GOW B;  3D8F A;  4K2O A;  3V5W A;  1SGH A;  3MDB C;  4CHJ A;  4ZRK A;  5J3Y A;  3UZT A;  2Y8G A;  2L1C A;  3LJU X;  3CXB B;  2PZ1 A;  2DA0 A;  2LOX A;  1MPH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...