1W1DA

Crystal structure of the pdk1 pleckstrin homology (ph) domain bound to inositol (1,3,4,5)-tetrakisphosphate
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
143
structure length
143
Chain Sequence
PLGSNIEQYIHDLDSNSFELDLQFSEDEKRLLLEKQAGGNPWHQFVENNLILKMGPVDKRKGLFARRRQLLLTEGPHLYYVDPVNKVLKGEIPWSQELRPEAKNFKTFFVHTPNRTYYLMDPSGNAHKWCRKIQEVWRQRYQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 3-PHOSPHOINOSITIDE DEPENDENT PROTEIN KINASE-1
publication title Structural Insights Into the Regulation of Pdk1 by Phosphoinositides and Inositol Phosphates
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 38
structure length 143
sequence length 143
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2004-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14593 PH_3 PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1w1dA00
1TXDA 2W2XC 5C6RA 2M38A 2YS1A 2YS3A 4HDQA 1QC6A 1EVHA 5HE3A 2X18A 2RLOA 3U8ZA 4HAUB 4P7IA 4K2PA 2D9WA 2DHJA 3PVLA 2D9VA 3ULBA 3DXCA 2YS5A 3SNHA 4PNKA 4HB4B 1FOEA 2ELBA 4A6FA 3M1IB 5LOPB 1Y5OA 2N0YA 4EKUA 2QKMA 1I2HA 2KUPA 2YT1A 4IFSA 2CY4A 2LKOA 3N7CA 1IRSA 5CLLB 5JP4A 2DN6A 5HE2A 2K00A 1XKEA 2DX5A 4NY0A 2D9XA 2UVMA 1XD4A 4MK0A 1H10A 3X23A 3NSUA 2DHKA 5J3TA 2NZ8B 1U29A 1WVHA 2Z0PA 1V88A 4A6FB 1UNQA 4KVGB 3PVWA 4F7GA 1NTYA 3BINA 3HW2B 5DHAB 4XWXA 2IFSA 2K2UA 3GYPA 5DIFB 1WI1A 1XODA 1NI2A 1K5DB 1FHXA 4MT7A 2CRFA 4HAZB 4ZRKA 4WSFA 1X05A 4HAVB 2NMBA 1EGXA 2L2IA 3G9WA 2R09A 2E2XA 5FI0A 1WJ1A 2RSGA 2DKQA 3DXDA 1M7EA 1FGYA 5CLQB 2ELAA 2N23A 4HB3B 4TKNA 2D10A 4HHVA 2I1KA 2V76A 2P0DA 2RGNB 1XX0A 3CXBB 1ZVRA 2LOXA 4Z2MB 3HQCA 3PG7A 3KRXA 1W1GA 2H7EA 1OQNA 1K5GB 1RJ2A 3QIJA 4KHBB 5JLJB 1LB1A 1ZC4B 3BJIA 1B55A 4MY6A 3MPXA 2DHIA 1UNPA 2K2JA 4HATB 2EJ8A 2Y7BA 1DROA 1V5PA 2DTCA 2AEHA 3U7DA 2P0HA 4DXAB 2DKPA 2COAA 1UPRA 1BTKA 3QWMA 1GC7A 1BWNA 3SUZA 2UZRA 1Y19B 4D0NB 1X1GA 3KY9A 2DYQA 2L1CA 1P3RA 1EAZA 1P5TA 1UPQA 3F0WA 2OQBA 3KSYA 4KHAA 2JP2A 3RCPA 1RRPB 2LOZA 2FJLA 1J19A 2VRWB 4DX8A 4TYZA 1NU2A 4A6HA 2HE7A 3UZTA 2LG1A 2J59M 3ODXA 2MKRA 2D9ZA 5KQ1A 4IOYX 1BTNA 4DBBA 2GCLA 3LJUX 2EMSA 2J0MA 5D3WA 5KQ4A 2Y8GA 1MIZB 2W2XD 1X1FA 3T06A 1DDWA 1LW3A 2GCJA 3KRWA 3TO1A 1PMSA 4BBKA 3D8FA 4HAYB 5D3YA 1FB8A 1OMWA 2RNRB 1V89A 3A8QA 4A5KA 1FGZA 3SV1A 1TJ6A 5KCVA 4F7UP 2ZPYA 2COFA 1GG3A 2COCA 2MFQA 2W2WA 4GMVA 1PFJA 3ODWA 5C5BA 2D11A 4GZUA 2EMTA 1U2BA 4WVFB 2YF0A 1W1HA 4Z2NA 2ADZA 5HE0A 1XCGA 2HTHB 2DYNA 2D2QA 3ZVRA 3A8PA 1DDVA 4KAXB 1U5EA 2PZ1A 1P6SA 1X11A 5C5BB 1MPHA 2KGXB 1V5UA 2LYDA 4EMOA 5J3QA 1SHCA 5D3VA 1MIXA 2Y8FA 1V5MA 5C79A 4A6KA 2CY5A 4GPTB 4KHOA 1I7AA 4IAPA 2BCJA 4F7HA 3D8DA 3F5RA 1WGUA 2D9YA 5LONB 3PSCA 2DA0A 3AU4A 1DYNA 2I5FA 1W1DA 2DX1A 3AU5A 5FI1A 1TQZA 2M14A 2R0DA 1MK9B 4K81A 1ZC3B 2Z0OA 3FSSA 1X86A 1SGHA 2G35A 2DLWA 1WJMA 1WG7A 3QBVB 4PQ0A 2LULA 1E5WA 1GC6A 4HDOA 3TVVA 4EJNA 2YVCA 3TFMA 1ZM0A 1EF1A 1N3HA 4ZRJA 4HAXB 1U27A 4WJ7A 4K17A 3MDBC 1XR0B 1UEFA 4H8SA 3SYXA 1PLSA 3FEHA 4YONA 3P7ZA 2QKLA 3SO6A 2H7DA 2YT0A 4NSWA 3HK0A 2D4QA 1AQCA 1MK7B 1H4RA 1UNRA 5D3XA 5HE1A 3ML4A 2GJYA 1ISNA 5DH9B 2AL6A 1KZGA 1FHOA 3OANA 1FHWA 2RUKB 3O96A 2IYBA 3ODOA 4L6EA 3CIKA 1M7RA 1DDMA 2J0KA 4HAWB 5JHGA 1KZ7A 4ZRIA 3DXEA 4K2OA 1Z87A 2CODA 1Q67A 1KI1B 3WYFB 4HB2B 2Z0QA 1U5DA 1FAOA 3A98B 3AJ4A 2VSZA 3GYOA 2UZSA 3TW1A 2YSZA 2KCJA 5C16A 5JHHA 2MDXA 4C0AA 4DX90 4B6HA 5L81A 2XQNM 2ROZB 4YL8A 4GMXB 3P6AA 4CHMA 1ZSQA 1QQGA 2P0FA 1J0WA 2P8VA 1U5FA 3ULCA 3WA0A 3V5WA 3VOQA 4Y94A 1NTVA 3PEGA 3PZDA 5J3YA 3IVFA 1DBHA 2ROVA 5DI9B 3TCAA 1MAIA 4CHJA 4HB0B 1OY2A 2CAYA 4CYEA 2I5CA 5DHFB 2MWNB 2J0JA 2GS0A 3VIAA 3D8EA 1AWEA 5D27A 2OTXA 2DFKA 1V61A 2EC1A 2YRYA 4GXBA 5EFXA 4GN1A 5GOWB 3ZDTA 2RVBB 3FM8C 1MKEA 3KZ1A 3PVUA 1BAKA 3PP2A 1U5GA 2Q13A 1WGQA 2VKIA 2I1JA
chains in the Genus database with same CATH superfamily
1TXDA 2W2XC 2ZKMX 5C6RA 2M38A 2YS1A 2YS3A 2RRFA 1QC6A 4HDQA 1EVHA 5HE3A 2X18A 2RLOA 3U8ZA 4HAUB 4P7IA 4K2PA 2D9WA 2KR0A 2DHJA 3PVLA 2D9VA 3ULBA 3DXCA 2YS5A 3SNHA 4CSQA 4PNKA 4HB4B 1FOEA 2ELBA 4A6FA 3M1IB 5LOPB 1Y5OA 2N0YA 4EKUA 3A58A 2QKMA 2NBVA 1I2HA 2KUPA 2YT1A 4IFSA 4QJ4B 2CY4A 2LKOA 3N7CA 1IRSA 5CLLB 5JP4A 2DN6A 5HE2A 4OT1A 2K00A 1XKEA 2DX5A 4NY0A 2D9XA 2UVMA 1XD4A 4MK0A 1H10A 3X23A 3NSUA 2DHKA 5J3TA 2NZ8B 1U29A 1WVHA 2Z0PA 1V88A 4A6FB 1UNQA 4KVGB 3PVWA 2R2YA 4F7GA 1NTYA 3BINA 3HW2B 5DHAB 4XWXA 2IFSA 2K2UA 3GYPA 5DIFB 2KIGA 1WI1A 1XODA 1NI2A 1K5DB 2K49A 1FHXA 4MT7A 2CRFA 4HAZB 4ZRKA 1T77A 4WSFA 1X05A 4HAVB 4KHBA 3U12A 2NMBA 1EGXA 2L2IA 3G9WA 2R09A 2E2XA 5FI0A 1WJ1A 2RSGA 2DKQA 3DXDA 1M7EA 1FGYA 5CLQB 2ELAA 2N23A 4HB3B 4TKNA 2D10A 4HHVA 2I1KA 2V76A 2P0DA 2RGNB 1XX0A 3CXBB 3FVCA 1ZVRA 2LOXA 3HSAA 4Z2MB 3HQCA 5I2MA 3PG7A 3KRXA 1W1GA 2H7EA 1OQNA 2KUQA 1K5GB 1RJ2A 3QIJA 4KHBB 2GUMA 5JLJB 1LB1A 1ZC4B 3BJIA 1B55A 3NWFA 4MY6A 3MPXA 2DHIA 1UNPA 2K2JA 4HATB 2EJ8A 2Y7BA 1DROA 1V5PA 2DTCA 2AEHA 5IRSA 3U7DA 2P0HA 4DXAB 2DKPA 2COAA 1UPRA 1BTKA 3QWMA 1GC7A 1BWNA 3SUZA 2UZRA 1Y19B 2Z13A 4D0NB 2K8EA 1X1GA 3KY9A 2DYQA 4HSIA 2L1CA 1P3RA 1EAZA 1P5TA 1UPQA 3F0WA 2OQBA 3KSYA 4KHAA 2JP2A 3RCPA 1RRPB 2LOZA 2FJLA 1J19A 2VRWB 4DX8A 4TYZA 1NU2A 4A6HA 2HE7A 1MI1A 3UZTA 2LG1A 2J59M 3ODXA 2MKRA 2D9ZA 5KQ1A 4IOYX 1BTNA 4DBBA 2GCLA 3LJUX 2EMSA 2J0MA 5D3WA 5KQ4A 2Y8GA 1MIZB 4D6WA 2W2XD 1X1FA 3T06A 1DDWA 1LW3A 2GCJA 3KRWA 3TO1A 1PMSA 4BBKA 3D8FA 4HAYB 5D3YA 1FB8A 1OMWA 4QJ3B 2RNRB 1V89A 3A8QA 4A5KA 1FGZA 3SV1A 1TJ6A 5KCVA 4F7UP 2ZPYA 2COFA 1GG3A 4DIXA 2COCA 2MFQA 2W2WA 4GMVA 3OHMB 1PFJA 3ODWA 5C5BA 2D11A 4GZUA 2EMTA 1U2BA 4WVFB 2Z14A 2YF0A 1W1HA 4Z2NA 2ADZA 5HE0A 1XCGA 2HTHB 2DYNA 3NWDA 2D2QA 3ZVRA 3A8PA 1DDVA 4KAXB 1U5EA 2PZ1A 1P6SA 2FJUB 1X11A 5C5BB 1MPHA 2KGXB 1V5UA 2LYDA 1ZYIA 4EMOA 5J3QA 3NWAA 5I2SA 1SHCA 5D3VA 1MIXA 2Y8FA 1V5MA 5C79A 4A6KA 2CY5A 4GPTB 4KHOA 1I7AA 4IAPA 2BCJA 4F7HA 3D8DA 3F5RA 1WGUA 2D9YA 5LONB 3PSCA 2DA0A 3AU4A 1DYNA 2I5FA 1W1DA 2DX1A 3AU5A 5FI1A 1TQZA 2M14A 2R0DA 1MK9B 4K81A 1ZC3B 2Z0OA 3FSSA 1X86A 1SGHA 2G35A 2DLWA 1WJMA 1WG7A 3QBVB 4PQ0A 2LULA 3HIEA 1E5WA 1GC6A 4HDOA 3TVVA 4EJNA 2YVCA 3TFMA 1ZM0A 1EF1A 1N3HA 3DCXA 4ZRJA 4HAXB 1U27A 4WJ7A 4K17A 3MDBC 1XR0B 1UEFA 2Z59A 4H8SA 3SYXA 1PLSA 3FEHA 4YONA 3P7ZA 5LG4B 2QKLA 3SO6A 2H7DA 2YT0A 4NSWA 3HK0A 2YT2A 2D4QA 1AQCA 1MK7B 1H4RA 1UNRA 5D3XA 5HE1A 3ML4A 3B77A 2GJYA 1ISNA 5DH9B 2AL6A 4OSNA 1KZGA 5M4YB 1FHOA 3OANA 1FHWA 2RUKB 4QJ5B 3O96A 2IYBA 3ODOA 4L6EA 3CIKA 1M7RA 1DDMA 2J0KA 4HAWB 5JHGA 1KZ7A 4ZRIA 3DXEA 4K2OA 1Z87A 2CODA 1Q67A 1KI1B 3WYFB 4HB2B 2Z0QA 1U5DA 4GOUA 1FAOA 3A98B 3AJ4A 2VSZA 3GYOA 2UZSA 3TW1A 2YSZA 2KCJA 5C16A 5JHHA 2MDXA 4C0AA 4DX90 4B6HA 5L81A 2XQNM 2ROZB 4YL8A 4GMXB 2KIEA 3P6AA 1ZSQA 4CHMA 1QQGA 2P0FA 1J0WA 2P8VA 1U5FA 3ULCA 3WA0A 3V5WA 3VOQA 4Y94A 1NTVA 3PEGA 3PZDA 5J3YA 3IVFA 1DBHA 2ROVA 5DI9B 3TCAA 1MAIA 4CHJA 4HB0B 1OY2A 2CAYA 4CYEA 2I5CA 5DHFB 2MWNB 2J0JA 4GNKB 2GS0A 3VIAA 3D8EA 4L1RA 1AWEA 5D27A 2OTXA 2DFKA 2Z4DA 4QXAB 3NW8A 1V61A 2EC1A 2YRYA 4GXBA 5EFXA 4GN1A 5GOWB 3ZDTA 2RVBB 3FM8C 1MKEA 3KZ1A 3PVUA 1BAKA 3PP2A 1U5GA 2Q13A 1WGQA 2VKIA 2I1JA
chains in the Genus database with same CATH topology
1TXDA 2W2XC 5C6RA 2M38A 2YS1A 2YS3A 4HDQA 1QC6A 1EVHA 5HE3A 2X18A 2RLOA 3U8ZA 4HAUB 4P7IA 4K2PA 2D9WA 2DHJA 3PVLA 2D9VA 3ULBA 3DXCA 2YS5A 3SNHA 4PNKA 4HB4B 1FOEA 2ELBA 4A6FA 3M1IB 5LOPB 1Y5OA 2N0YA 4EKUA 2QKMA 1I2HA 2KUPA 2YT1A 4IFSA 2CY4A 2LKOA 3N7CA 1IRSA 5CLLB 5JP4A 2DN6A 5HE2A 2K00A 1XKEA 2DX5A 4NY0A 2D9XA 2UVMA 1XD4A 4MK0A 1H10A 3X23A 3NSUA 2DHKA 5J3TA 2NZ8B 1U29A 1WVHA 2Z0PA 1V88A 4A6FB 1UNQA 4KVGB 3PVWA 4F7GA 1NTYA 3BINA 3HW2B 5DHAB 4XWXA 2IFSA 2K2UA 3GYPA 5DIFB 1WI1A 1XODA 1NI2A 1K5DB 1FHXA 4MT7A 2CRFA 4HAZB 4ZRKA 4WSFA 1X05A 4HAVB 2NMBA 1EGXA 2L2IA 3G9WA 2R09A 2E2XA 5FI0A 1WJ1A 2RSGA 2DKQA 3DXDA 1M7EA 1FGYA 5CLQB 2ELAA 2N23A 4HB3B 4TKNA 2D10A 4HHVA 2I1KA 2V76A 2P0DA 2RGNB 1XX0A 3CXBB 1ZVRA 2LOXA 4Z2MB 3HQCA 3PG7A 3KRXA 1W1GA 2H7EA 1OQNA 1K5GB 1RJ2A 3QIJA 4KHBB 5JLJB 1LB1A 1ZC4B 3BJIA 1B55A 4MY6A 3MPXA 2DHIA 1UNPA 2K2JA 4HATB 2EJ8A 2Y7BA 1DROA 1V5PA 2DTCA 2AEHA 3U7DA 2P0HA 4DXAB 2DKPA 2COAA 1UPRA 1BTKA 3QWMA 1GC7A 1BWNA 3SUZA 2UZRA 1Y19B 4D0NB 1X1GA 3KY9A 2DYQA 2L1CA 1P3RA 1EAZA 1P5TA 1UPQA 3F0WA 2OQBA 3KSYA 4KHAA 2JP2A 3RCPA 1RRPB 2LOZA 2FJLA 1J19A 2VRWB 4DX8A 4TYZA 1NU2A 4A6HA 2HE7A 3UZTA 2LG1A 2J59M 3ODXA 2MKRA 2D9ZA 5KQ1A 4IOYX 1BTNA 4DBBA 2GCLA 3LJUX 2EMSA 2J0MA 5D3WA 5KQ4A 2Y8GA 1MIZB 2W2XD 1X1FA 3T06A 1DDWA 1LW3A 2GCJA 3KRWA 3TO1A 1PMSA 4BBKA 3D8FA 4HAYB 5D3YA 1FB8A 1OMWA 2RNRB 1V89A 3A8QA 4A5KA 1FGZA 3SV1A 1TJ6A 5KCVA 4F7UP 2ZPYA 2COFA 1GG3A 2COCA 2MFQA 2W2WA 4GMVA 1PFJA 3ODWA 5C5BA 2D11A 4GZUA 2EMTA 1U2BA 4WVFB 2YF0A 1W1HA 4Z2NA 2ADZA 5HE0A 1XCGA 2HTHB 2DYNA 2D2QA 3ZVRA 3A8PA 1DDVA 4KAXB 1U5EA 2PZ1A 1P6SA 1X11A 5C5BB 1MPHA 2KGXB 1V5UA 2LYDA 4EMOA 5J3QA 1SHCA 5D3VA 1MIXA 2Y8FA 1V5MA 5C79A 4A6KA 2CY5A 4GPTB 4KHOA 1I7AA 4IAPA 2BCJA 4F7HA 3D8DA 3F5RA 1WGUA 2D9YA 5LONB 3PSCA 2DA0A 3AU4A 1DYNA 2I5FA 1W1DA 2DX1A 3AU5A 5FI1A 1TQZA 2M14A 2R0DA 1MK9B 4K81A 1ZC3B 2Z0OA 3FSSA 1X86A 1SGHA 2G35A 2DLWA 1WJMA 1WG7A 3QBVB 4PQ0A 2LULA 1E5WA 1GC6A 4HDOA 3TVVA 4EJNA 2YVCA 3TFMA 1ZM0A 1EF1A 1N3HA 4ZRJA 4HAXB 1U27A 4WJ7A 4K17A 3MDBC 1XR0B 1UEFA 4H8SA 3SYXA 1PLSA 3FEHA 4YONA 3P7ZA 2QKLA 3SO6A 2H7DA 2YT0A 4NSWA 3HK0A 2D4QA 1AQCA 1MK7B 1H4RA 1UNRA 5D3XA 5HE1A 3ML4A 2GJYA 1ISNA 5DH9B 2AL6A 1KZGA 1FHOA 3OANA 1FHWA 2RUKB 3O96A 2IYBA 3ODOA 4L6EA 3CIKA 1M7RA 1DDMA 2J0KA 4HAWB 5JHGA 1KZ7A 4ZRIA 3DXEA 4K2OA 1Z87A 2CODA 1Q67A 1KI1B 3WYFB 4HB2B 2Z0QA 1U5DA 1FAOA 3A98B 3AJ4A 2VSZA 3GYOA 2UZSA 3TW1A 2YSZA 2KCJA 5C16A 5JHHA 2MDXA 4C0AA 4DX90 4B6HA 5L81A 2XQNM 2ROZB 4YL8A 4GMXB 3P6AA 4CHMA 1ZSQA 1QQGA 2P0FA 1J0WA 2P8VA 1U5FA 3ULCA 3WA0A 3V5WA 3VOQA 4Y94A 1NTVA 3PEGA 3PZDA 5J3YA 3IVFA 1DBHA 2ROVA 5DI9B 3TCAA 1MAIA 4CHJA 4HB0B 1OY2A 2CAYA 4CYEA 2I5CA 5DHFB 2MWNB 2J0JA 2GS0A 3VIAA 3D8EA 1AWEA 5D27A 2OTXA 2DFKA 1V61A 2EC1A 2YRYA 4GXBA 5EFXA 4GN1A 5GOWB 3ZDTA 2RVBB 3FM8C 1MKEA 3KZ1A 3PVUA 1BAKA 3PP2A 1U5GA 2Q13A 1WGQA 2VKIA 2I1JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TXD A;  2W2X C;  5C6R A;  2M38 A;  2YS1 A;  2YS3 A;  4HDQ A;  1QC6 A;  1EVH A;  5HE3 A;  2X18 A;  2RLO A;  3U8Z A;  4HAU B;  4P7I A;  4K2P A;  2D9W A;  2DHJ A;  3PVL A;  2D9V A;  3ULB A;  3DXC A;  2YS5 A;  3SNH A;  4PNK A;  4HB4 B;  1FOE A;  2ELB A;  4A6F A;  3M1I B;  5LOP B;  1Y5O A;  2N0Y A;  4EKU A;  2QKM A;  1I2H A;  2KUP A;  2YT1 A;  4IFS A;  2CY4 A;  2LKO A;  3N7C A;  1IRS A;  5CLL B;  5JP4 A;  2DN6 A;  5HE2 A;  2K00 A;  1XKE A;  2DX5 A;  4NY0 A;  2D9X A;  2UVM A;  1XD4 A;  4MK0 A;  1H10 A;  3X23 A;  3NSU A;  2DHK A;  5J3T A;  2NZ8 B;  1U29 A;  1WVH A;  2Z0P A;  1V88 A;  4A6F B;  1UNQ A;  4KVG B;  3PVW A;  4F7G A;  1NTY A;  3BIN A;  3HW2 B;  5DHA B;  4XWX A;  2IFS A;  2K2U A;  3GYP A;  5DIF B;  1WI1 A;  1XOD A;  1NI2 A;  1K5D B;  1FHX A;  4MT7 A;  2CRF A;  4HAZ B;  4ZRK A;  4WSF A;  1X05 A;  4HAV B;  2NMB A;  1EGX A;  2L2I A;  3G9W A;  2R09 A;  2E2X A;  5FI0 A;  1WJ1 A;  2RSG A;  2DKQ A;  3DXD A;  1M7E A;  1FGY A;  5CLQ B;  2ELA A;  2N23 A;  4HB3 B;  4TKN A;  2D10 A;  4HHV A;  2I1K A;  2V76 A;  2P0D A;  2RGN B;  1XX0 A;  3CXB B;  1ZVR A;  2LOX A;  4Z2M B;  3HQC A;  3PG7 A;  3KRX A;  1W1G A;  2H7E A;  1OQN A;  1K5G B;  1RJ2 A;  3QIJ A;  4KHB B;  5JLJ B;  1LB1 A;  1ZC4 B;  3BJI A;  1B55 A;  4MY6 A;  3MPX A;  2DHI A;  1UNP A;  2K2J A;  4HAT B;  2EJ8 A;  2Y7B A;  1DRO A;  1V5P A;  2DTC A;  2AEH A;  3U7D A;  2P0H A;  4DXA B;  2DKP A;  2COA A;  1UPR A;  1BTK A;  3QWM A;  1GC7 A;  1BWN A;  3SUZ A;  2UZR A;  1Y19 B;  4D0N B;  1X1G A;  3KY9 A;  2DYQ A;  2L1C A;  1P3R A;  1EAZ A;  1P5T A;  1UPQ A;  3F0W A;  2OQB A;  3KSY A;  4KHA A;  2JP2 A;  3RCP A;  1RRP B;  2LOZ A;  2FJL A;  1J19 A;  2VRW B;  4DX8 A;  4TYZ A;  1NU2 A;  4A6H A;  2HE7 A;  3UZT A;  2LG1 A;  2J59 M;  3ODX A;  2MKR A;  2D9Z A;  5KQ1 A;  4IOY X;  1BTN A;  4DBB A;  2GCL A;  3LJU X;  2EMS A;  2J0M A;  5D3W A;  5KQ4 A;  2Y8G A;  1MIZ B;  2W2X D;  1X1F A;  3T06 A;  1DDW A;  1LW3 A;  2GCJ A;  3KRW A;  3TO1 A;  1PMS A;  4BBK A;  3D8F A;  4HAY B;  5D3Y A;  1FB8 A;  1OMW A;  2RNR B;  1V89 A;  3A8Q A;  4A5K A;  1FGZ A;  3SV1 A;  1TJ6 A;  5KCV A;  4F7U P;  2ZPY A;  2COF A;  1GG3 A;  2COC A;  2MFQ A;  2W2W A;  4GMV A;  1PFJ A;  3ODW A;  5C5B A;  2D11 A;  4GZU A;  2EMT A;  1U2B A;  4WVF B;  2YF0 A;  1W1H A;  4Z2N A;  2ADZ A;  5HE0 A;  1XCG A;  2HTH B;  2DYN A;  2D2Q A;  3ZVR A;  3A8P A;  1DDV A;  4KAX B;  1U5E A;  2PZ1 A;  1P6S A;  1X11 A;  5C5B B;  1MPH A;  2KGX B;  1V5U A;  2LYD A;  4EMO A;  5J3Q A;  1SHC A;  5D3V A;  1MIX A;  2Y8F A;  1V5M A;  5C79 A;  4A6K A;  2CY5 A;  4GPT B;  4KHO A;  1I7A A;  4IAP A;  2BCJ A;  4F7H A;  3D8D A;  3F5R A;  1WGU A;  2D9Y A;  5LON B;  3PSC A;  2DA0 A;  3AU4 A;  1DYN A;  2I5F A;  1W1D A;  2DX1 A;  3AU5 A;  5FI1 A;  1TQZ A;  2M14 A;  2R0D A;  1MK9 B;  4K81 A;  1ZC3 B;  2Z0O A;  3FSS A;  1X86 A;  1SGH A;  2G35 A;  2DLW A;  1WJM A;  1WG7 A;  3QBV B;  4PQ0 A;  2LUL A;  1E5W A;  1GC6 A;  4HDO A;  3TVV A;  4EJN A;  2YVC A;  3TFM A;  1ZM0 A;  1EF1 A;  1N3H A;  4ZRJ A;  4HAX B;  1U27 A;  4WJ7 A;  4K17 A;  3MDB C;  1XR0 B;  1UEF A;  4H8S A;  3SYX A;  1PLS A;  3FEH A;  4YON A;  3P7Z A;  2QKL A;  3SO6 A;  2H7D A;  2YT0 A;  4NSW A;  3HK0 A;  2D4Q A;  1AQC A;  1MK7 B;  1H4R A;  1UNR A;  5D3X A;  5HE1 A;  3ML4 A;  2GJY A;  1ISN A;  5DH9 B;  2AL6 A;  1KZG A;  1FHO A;  3OAN A;  1FHW A;  2RUK B;  3O96 A;  2IYB A;  3ODO A;  4L6E A;  3CIK A;  1M7R A;  1DDM A;  2J0K A;  4HAW B;  5JHG A;  1KZ7 A;  4ZRI A;  3DXE A;  4K2O A;  1Z87 A;  2COD A;  1Q67 A;  1KI1 B;  3WYF B;  4HB2 B;  2Z0Q A;  1U5D A;  1FAO A;  3A98 B;  3AJ4 A;  2VSZ A;  3GYO A;  2UZS A;  3TW1 A;  2YSZ A;  2KCJ A;  5C16 A;  5JHH A;  2MDX A;  4C0A A;  4DX9 0;  4B6H A;  5L81 A;  2XQN M;  2ROZ B;  4YL8 A;  4GMX B;  3P6A A;  4CHM A;  1ZSQ A;  1QQG A;  2P0F A;  1J0W A;  2P8V A;  1U5F A;  3ULC A;  3WA0 A;  3V5W A;  3VOQ A;  4Y94 A;  1NTV A;  3PEG A;  3PZD A;  5J3Y A;  3IVF A;  1DBH A;  2ROV A;  5DI9 B;  3TCA A;  1MAI A;  4CHJ A;  4HB0 B;  1OY2 A;  2CAY A;  4CYE A;  2I5C A;  5DHF B;  2MWN B;  2J0J A;  2GS0 A;  3VIA A;  3D8E A;  1AWE A;  5D27 A;  2OTX A;  2DFK A;  1V61 A;  2EC1 A;  2YRY A;  4GXB A;  5EFX A;  4GN1 A;  5GOW B;  3ZDT A;  2RVB B;  3FM8 C;  1MKE A;  3KZ1 A;  3PVU A;  1BAK A;  3PP2 A;  1U5G A;  2Q13 A;  1WGQ A;  2VKI A;  2I1J A; 
#chains in the Genus database with same CATH topology
 1TXD A;  2W2X C;  2ZKM X;  5C6R A;  2M38 A;  2YS1 A;  2YS3 A;  2RRF A;  1QC6 A;  4HDQ A;  1EVH A;  5HE3 A;  2X18 A;  2RLO A;  3U8Z A;  4HAU B;  4P7I A;  4K2P A;  2D9W A;  2KR0 A;  2DHJ A;  3PVL A;  2D9V A;  3ULB A;  3DXC A;  2YS5 A;  3SNH A;  4CSQ A;  4PNK A;  4HB4 B;  1FOE A;  2ELB A;  4A6F A;  3M1I B;  5LOP B;  1Y5O A;  2N0Y A;  4EKU A;  3A58 A;  2QKM A;  2NBV A;  1I2H A;  2KUP A;  2YT1 A;  4IFS A;  4QJ4 B;  2CY4 A;  2LKO A;  3N7C A;  1IRS A;  5CLL B;  5JP4 A;  2DN6 A;  5HE2 A;  4OT1 A;  2K00 A;  1XKE A;  2DX5 A;  4NY0 A;  2D9X A;  2UVM A;  1XD4 A;  4MK0 A;  1H10 A;  3X23 A;  3NSU A;  2DHK A;  5J3T A;  2NZ8 B;  1U29 A;  1WVH A;  2Z0P A;  1V88 A;  4A6F B;  1UNQ A;  4KVG B;  3PVW A;  2R2Y A;  4F7G A;  1NTY A;  3BIN A;  3HW2 B;  5DHA B;  4XWX A;  2IFS A;  2K2U A;  3GYP A;  5DIF B;  2KIG A;  1WI1 A;  1XOD A;  1NI2 A;  1K5D B;  2K49 A;  1FHX A;  4MT7 A;  2CRF A;  4HAZ B;  4ZRK A;  1T77 A;  4WSF A;  1X05 A;  4HAV B;  4KHB A;  3U12 A;  2NMB A;  1EGX A;  2L2I A;  3G9W A;  2R09 A;  2E2X A;  5FI0 A;  1WJ1 A;  2RSG A;  2DKQ A;  3DXD A;  1M7E A;  1FGY A;  5CLQ B;  2ELA A;  2N23 A;  4HB3 B;  4TKN A;  2D10 A;  4HHV A;  2I1K A;  2V76 A;  2P0D A;  2RGN B;  1XX0 A;  3CXB B;  3FVC A;  1ZVR A;  2LOX A;  3HSA A;  4Z2M B;  3HQC A;  5I2M A;  3PG7 A;  3KRX A;  1W1G A;  2H7E A;  1OQN A;  2KUQ A;  1K5G B;  1RJ2 A;  3QIJ A;  4KHB B;  2GUM A;  5JLJ B;  1LB1 A;  1ZC4 B;  3BJI A;  1B55 A;  3NWF A;  4MY6 A;  3MPX A;  2DHI A;  1UNP A;  2K2J A;  4HAT B;  2EJ8 A;  2Y7B A;  1DRO A;  1V5P A;  2DTC A;  2AEH A;  5IRS A;  3U7D A;  2P0H A;  4DXA B;  2DKP A;  2COA A;  1UPR A;  1BTK A;  3QWM A;  1GC7 A;  1BWN A;  3SUZ A;  2UZR A;  1Y19 B;  2Z13 A;  4D0N B;  2K8E A;  1X1G A;  3KY9 A;  2DYQ A;  4HSI A;  2L1C A;  1P3R A;  1EAZ A;  1P5T A;  1UPQ A;  3F0W A;  2OQB A;  3KSY A;  4KHA A;  2JP2 A;  3RCP A;  1RRP B;  2LOZ A;  2FJL A;  1J19 A;  2VRW B;  4DX8 A;  4TYZ A;  1NU2 A;  4A6H A;  2HE7 A;  1MI1 A;  3UZT A;  2LG1 A;  2J59 M;  3ODX A;  2MKR A;  2D9Z A;  5KQ1 A;  4IOY X;  1BTN A;  4DBB A;  2GCL A;  3LJU X;  2EMS A;  2J0M A;  5D3W A;  5KQ4 A;  2Y8G A;  1MIZ B;  4D6W A;  2W2X D;  1X1F A;  3T06 A;  1DDW A;  1LW3 A;  2GCJ A;  3KRW A;  3TO1 A;  1PMS A;  4BBK A;  3D8F A;  4HAY B;  5D3Y A;  1FB8 A;  1OMW A;  4QJ3 B;  2RNR B;  1V89 A;  3A8Q A;  4A5K A;  1FGZ A;  3SV1 A;  1TJ6 A;  5KCV A;  4F7U P;  2ZPY A;  2COF A;  1GG3 A;  4DIX A;  2COC A;  2MFQ A;  2W2W A;  4GMV A;  3OHM B;  1PFJ A;  3ODW A;  5C5B A;  2D11 A;  4GZU A;  2EMT A;  1U2B A;  4WVF B;  2Z14 A;  2YF0 A;  1W1H A;  4Z2N A;  2ADZ A;  5HE0 A;  1XCG A;  2HTH B;  2DYN A;  3NWD A;  2D2Q A;  3ZVR A;  3A8P A;  1DDV A;  4KAX B;  1U5E A;  2PZ1 A;  1P6S A;  2FJU B;  1X11 A;  5C5B B;  1MPH A;  2KGX B;  1V5U A;  2LYD A;  1ZYI A;  4EMO A;  5J3Q A;  3NWA A;  5I2S A;  1SHC A;  5D3V A;  1MIX A;  2Y8F A;  1V5M A;  5C79 A;  4A6K A;  2CY5 A;  4GPT B;  4KHO A;  1I7A A;  4IAP A;  2BCJ A;  4F7H A;  3D8D A;  3F5R A;  1WGU A;  2D9Y A;  5LON B;  3PSC A;  2DA0 A;  3AU4 A;  1DYN A;  2I5F A;  1W1D A;  2DX1 A;  3AU5 A;  5FI1 A;  1TQZ A;  2M14 A;  2R0D A;  1MK9 B;  4K81 A;  1ZC3 B;  2Z0O A;  3FSS A;  1X86 A;  1SGH A;  2G35 A;  2DLW A;  1WJM A;  1WG7 A;  3QBV B;  4PQ0 A;  2LUL A;  3HIE A;  1E5W A;  1GC6 A;  4HDO A;  3TVV A;  4EJN A;  2YVC A;  3TFM A;  1ZM0 A;  1EF1 A;  1N3H A;  3DCX A;  4ZRJ A;  4HAX B;  1U27 A;  4WJ7 A;  4K17 A;  3MDB C;  1XR0 B;  1UEF A;  2Z59 A;  4H8S A;  3SYX A;  1PLS A;  3FEH A;  4YON A;  3P7Z A;  5LG4 B;  2QKL A;  3SO6 A;  2H7D A;  2YT0 A;  4NSW A;  3HK0 A;  2YT2 A;  2D4Q A;  1AQC A;  1MK7 B;  1H4R A;  1UNR A;  5D3X A;  5HE1 A;  3ML4 A;  3B77 A;  2GJY A;  1ISN A;  5DH9 B;  2AL6 A;  4OSN A;  1KZG A;  5M4Y B;  1FHO A;  3OAN A;  1FHW A;  2RUK B;  4QJ5 B;  3O96 A;  2IYB A;  3ODO A;  4L6E A;  3CIK A;  1M7R A;  1DDM A;  2J0K A;  4HAW B;  5JHG A;  1KZ7 A;  4ZRI A;  3DXE A;  4K2O A;  1Z87 A;  2COD A;  1Q67 A;  1KI1 B;  3WYF B;  4HB2 B;  2Z0Q A;  1U5D A;  4GOU A;  1FAO A;  3A98 B;  3AJ4 A;  2VSZ A;  3GYO A;  2UZS A;  3TW1 A;  2YSZ A;  2KCJ A;  5C16 A;  5JHH A;  2MDX A;  4C0A A;  4DX9 0;  4B6H A;  5L81 A;  2XQN M;  2ROZ B;  4YL8 A;  4GMX B;  2KIE A;  3P6A A;  1ZSQ A;  4CHM A;  1QQG A;  2P0F A;  1J0W A;  2P8V A;  1U5F A;  3ULC A;  3WA0 A;  3V5W A;  3VOQ A;  4Y94 A;  1NTV A;  3PEG A;  3PZD A;  5J3Y A;  3IVF A;  1DBH A;  2ROV A;  5DI9 B;  3TCA A;  1MAI A;  4CHJ A;  4HB0 B;  1OY2 A;  2CAY A;  4CYE A;  2I5C A;  5DHF B;  2MWN B;  2J0J A;  4GNK B;  2GS0 A;  3VIA A;  3D8E A;  4L1R A;  1AWE A;  5D27 A;  2OTX A;  2DFK A;  2Z4D A;  4QXA B;  3NW8 A;  1V61 A;  2EC1 A;  2YRY A;  4GXB A;  5EFX A;  4GN1 A;  5GOW B;  3ZDT A;  2RVB B;  3FM8 C;  1MKE A;  3KZ1 A;  3PVU A;  1BAK A;  3PP2 A;  1U5G A;  2Q13 A;  1WGQ A;  2VKI A;  2I1J A; 
#chains in the Genus database with same CATH homology
 1TXD A;  2W2X C;  5C6R A;  2M38 A;  2YS1 A;  2YS3 A;  4HDQ A;  1QC6 A;  1EVH A;  5HE3 A;  2X18 A;  2RLO A;  3U8Z A;  4HAU B;  4P7I A;  4K2P A;  2D9W A;  2DHJ A;  3PVL A;  2D9V A;  3ULB A;  3DXC A;  2YS5 A;  3SNH A;  4PNK A;  4HB4 B;  1FOE A;  2ELB A;  4A6F A;  3M1I B;  5LOP B;  1Y5O A;  2N0Y A;  4EKU A;  2QKM A;  1I2H A;  2KUP A;  2YT1 A;  4IFS A;  2CY4 A;  2LKO A;  3N7C A;  1IRS A;  5CLL B;  5JP4 A;  2DN6 A;  5HE2 A;  2K00 A;  1XKE A;  2DX5 A;  4NY0 A;  2D9X A;  2UVM A;  1XD4 A;  4MK0 A;  1H10 A;  3X23 A;  3NSU A;  2DHK A;  5J3T A;  2NZ8 B;  1U29 A;  1WVH A;  2Z0P A;  1V88 A;  4A6F B;  1UNQ A;  4KVG B;  3PVW A;  4F7G A;  1NTY A;  3BIN A;  3HW2 B;  5DHA B;  4XWX A;  2IFS A;  2K2U A;  3GYP A;  5DIF B;  1WI1 A;  1XOD A;  1NI2 A;  1K5D B;  1FHX A;  4MT7 A;  2CRF A;  4HAZ B;  4ZRK A;  4WSF A;  1X05 A;  4HAV B;  2NMB A;  1EGX A;  2L2I A;  3G9W A;  2R09 A;  2E2X A;  5FI0 A;  1WJ1 A;  2RSG A;  2DKQ A;  3DXD A;  1M7E A;  1FGY A;  5CLQ B;  2ELA A;  2N23 A;  4HB3 B;  4TKN A;  2D10 A;  4HHV A;  2I1K A;  2V76 A;  2P0D A;  2RGN B;  1XX0 A;  3CXB B;  1ZVR A;  2LOX A;  4Z2M B;  3HQC A;  3PG7 A;  3KRX A;  1W1G A;  2H7E A;  1OQN A;  1K5G B;  1RJ2 A;  3QIJ A;  4KHB B;  5JLJ B;  1LB1 A;  1ZC4 B;  3BJI A;  1B55 A;  4MY6 A;  3MPX A;  2DHI A;  1UNP A;  2K2J A;  4HAT B;  2EJ8 A;  2Y7B A;  1DRO A;  1V5P A;  2DTC A;  2AEH A;  3U7D A;  2P0H A;  4DXA B;  2DKP A;  2COA A;  1UPR A;  1BTK A;  3QWM A;  1GC7 A;  1BWN A;  3SUZ A;  2UZR A;  1Y19 B;  4D0N B;  1X1G A;  3KY9 A;  2DYQ A;  2L1C A;  1P3R A;  1EAZ A;  1P5T A;  1UPQ A;  3F0W A;  2OQB A;  3KSY A;  4KHA A;  2JP2 A;  3RCP A;  1RRP B;  2LOZ A;  2FJL A;  1J19 A;  2VRW B;  4DX8 A;  4TYZ A;  1NU2 A;  4A6H A;  2HE7 A;  3UZT A;  2LG1 A;  2J59 M;  3ODX A;  2MKR A;  2D9Z A;  5KQ1 A;  4IOY X;  1BTN A;  4DBB A;  2GCL A;  3LJU X;  2EMS A;  2J0M A;  5D3W A;  5KQ4 A;  2Y8G A;  1MIZ B;  2W2X D;  1X1F A;  3T06 A;  1DDW A;  1LW3 A;  2GCJ A;  3KRW A;  3TO1 A;  1PMS A;  4BBK A;  3D8F A;  4HAY B;  5D3Y A;  1FB8 A;  1OMW A;  2RNR B;  1V89 A;  3A8Q A;  4A5K A;  1FGZ A;  3SV1 A;  1TJ6 A;  5KCV A;  4F7U P;  2ZPY A;  2COF A;  1GG3 A;  2COC A;  2MFQ A;  2W2W A;  4GMV A;  1PFJ A;  3ODW A;  5C5B A;  2D11 A;  4GZU A;  2EMT A;  1U2B A;  4WVF B;  2YF0 A;  1W1H A;  4Z2N A;  2ADZ A;  5HE0 A;  1XCG A;  2HTH B;  2DYN A;  2D2Q A;  3ZVR A;  3A8P A;  1DDV A;  4KAX B;  1U5E A;  2PZ1 A;  1P6S A;  1X11 A;  5C5B B;  1MPH A;  2KGX B;  1V5U A;  2LYD A;  4EMO A;  5J3Q A;  1SHC A;  5D3V A;  1MIX A;  2Y8F A;  1V5M A;  5C79 A;  4A6K A;  2CY5 A;  4GPT B;  4KHO A;  1I7A A;  4IAP A;  2BCJ A;  4F7H A;  3D8D A;  3F5R A;  1WGU A;  2D9Y A;  5LON B;  3PSC A;  2DA0 A;  3AU4 A;  1DYN A;  2I5F A;  1W1D A;  2DX1 A;  3AU5 A;  5FI1 A;  1TQZ A;  2M14 A;  2R0D A;  1MK9 B;  4K81 A;  1ZC3 B;  2Z0O A;  3FSS A;  1X86 A;  1SGH A;  2G35 A;  2DLW A;  1WJM A;  1WG7 A;  3QBV B;  4PQ0 A;  2LUL A;  1E5W A;  1GC6 A;  4HDO A;  3TVV A;  4EJN A;  2YVC A;  3TFM A;  1ZM0 A;  1EF1 A;  1N3H A;  4ZRJ A;  4HAX B;  1U27 A;  4WJ7 A;  4K17 A;  3MDB C;  1XR0 B;  1UEF A;  4H8S A;  3SYX A;  1PLS A;  3FEH A;  4YON A;  3P7Z A;  2QKL A;  3SO6 A;  2H7D A;  2YT0 A;  4NSW A;  3HK0 A;  2D4Q A;  1AQC A;  1MK7 B;  1H4R A;  1UNR A;  5D3X A;  5HE1 A;  3ML4 A;  2GJY A;  1ISN A;  5DH9 B;  2AL6 A;  1KZG A;  1FHO A;  3OAN A;  1FHW A;  2RUK B;  3O96 A;  2IYB A;  3ODO A;  4L6E A;  3CIK A;  1M7R A;  1DDM A;  2J0K A;  4HAW B;  5JHG A;  1KZ7 A;  4ZRI A;  3DXE A;  4K2O A;  1Z87 A;  2COD A;  1Q67 A;  1KI1 B;  3WYF B;  4HB2 B;  2Z0Q A;  1U5D A;  1FAO A;  3A98 B;  3AJ4 A;  2VSZ A;  3GYO A;  2UZS A;  3TW1 A;  2YSZ A;  2KCJ A;  5C16 A;  5JHH A;  2MDX A;  4C0A A;  4DX9 0;  4B6H A;  5L81 A;  2XQN M;  2ROZ B;  4YL8 A;  4GMX B;  3P6A A;  4CHM A;  1ZSQ A;  1QQG A;  2P0F A;  1J0W A;  2P8V A;  1U5F A;  3ULC A;  3WA0 A;  3V5W A;  3VOQ A;  4Y94 A;  1NTV A;  3PEG A;  3PZD A;  5J3Y A;  3IVF A;  1DBH A;  2ROV A;  5DI9 B;  3TCA A;  1MAI A;  4CHJ A;  4HB0 B;  1OY2 A;  2CAY A;  4CYE A;  2I5C A;  5DHF B;  2MWN B;  2J0J A;  2GS0 A;  3VIA A;  3D8E A;  1AWE A;  5D27 A;  2OTX A;  2DFK A;  1V61 A;  2EC1 A;  2YRY A;  4GXB A;  5EFX A;  4GN1 A;  5GOW B;  3ZDT A;  2RVB B;  3FM8 C;  1MKE A;  3KZ1 A;  3PVU A;  1BAK A;  3PP2 A;  1U5G A;  2Q13 A;  1WGQ A;  2VKI A;  2I1J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...