1W1DA

Crystal structure of the pdk1 pleckstrin homology (ph) domain bound to inositol (1,3,4,5)-tetrakisphosphate
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
143
structure length
143
Chain Sequence
PLGSNIEQYIHDLDSNSFELDLQFSEDEKRLLLEKQAGGNPWHQFVENNLILKMGPVDKRKGLFARRRQLLLTEGPHLYYVDPVNKVLKGEIPWSQELRPEAKNFKTFFVHTPNRTYYLMDPSGNAHKWCRKIQEVWRQRYQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords 3-PHOSPHOINOSITIDE DEPENDENT PROTEIN KINASE-1
publication title Structural Insights Into the Regulation of Pdk1 by Phosphoinositides and Inositol Phosphates
pubmed doi rcsb
source organism Homo sapiens
total genus 38
structure length 143
sequence length 143
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2004-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14593 PH_3 PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1w1dA00
3D8FA 1X11A 1V61A 3QBVB 2DN6A 2EMSA 3U7DA 2AL6A 4Z2NA 1QQGA 5DIFB 1U2BA 1X1FA 2D9VA 5C79A 2COAA 2COCA 4YL8A 1P5TA 2COFA 4EKUA 1DDVA 1DROA 1IRSA 4NSWA 1MK9B 1ZC3B 5D3WA 1BAKA 3O96A 3P7ZA 4C0AA 4HAXB 3SO6A 5LOPB 1OMWA 3FSSA 5CLQB 4D0NB 4WVFB 3TW1A 4HHVA 1SGHA 2L2IA 1K5GB 4KAXB 2M38A 4A6HA 2JP2A 1UPQA 2LKOA 2LYDA 3ODWA 3HW2B 2VKIA 4KVGB 4A6KA 5LONB 2EMTA 1AWEA 2MDXA 1WJ1A 1B55A 2M14A 3DXDA 2Y8GA 4HAZB 1Z87A 1MIXA 2DLWA 3PEGA 2CODA 2LOXA 1MK7B 1J0WA 3KSYA 5JHGA 2GJYA 4GXBA 3V5WA 4P7IA 1GC7A 3D8DA 5D3VA 3BJIA 2QKLA 2G35A 2Z0OA 2E2XA 1U5EA 2X18A 3F5RA 1NTVA 4HB3B 5J3TA 3HK0A 4PQ0A 4K17A 2YS5A 3IVFA 1TXDA 1GC6A 1U29A 3GYPA 2R0DA 5C16A 4IFSA 2RUKB 3PVUA 1M7EA 2KCJA 1XD4A 2K2JA 2DKQA 2GCLA 1FOEA 2D11A 2YSZA 1TQZA 3SV1A 4DBBA 1UPRA 2DHKA 2IYBA 2CRFA 3AU4A 2DYNA 3U8ZA 1FHWA 4GMVA 1XODA 4K2PA 4ZRIA 4L6EA 2DHJA 2D9WA 5KQ1A 2KUPA 2YS3A 4TKNA 2UVMA 3VIAA 1TJ6A 2W2XD 2I5FA 1UNQA 2CAYA 3UZTA 1DYNA 2Z0QA 3A8QA 1MIZB 1PFJA 4MK0A 2I1KA 3OANA 2CY4A 3SUZA 4IAPA 4ZRKA 2YT1A 5HE3A 4F7HA 4IOYX 4GMXB 3DXEA 2Q13A 2L1CA 2YF0A 3M1IB 4GN1A 1V89A 2LG1A 2DA0A 2ROZB 3VOQA 5HE2A 4A6FB 2DKPA 1V5PA 3PVLA 5C6RA 1V5MA 2RVBB 3MPXA 3WYFB 3NSUA 3D8EA 1WGUA 2YVCA 3G9WA 3ZVRA 4XWXA 4KHBB 2KGXB 1FHOA 2LOZA 3TO1A 1U5DA 2D9XA 2VRWB 1FGZA 1RRPB 1W1HA 4HAWB 1WG7A 2CY5A 2PZ1A 2RGNB 2H7EA 5L81A 2Y8FA 1X1GA 4A6FA 1UEFA 3PG7A 2UZSA 1SHCA 4Z2MB 2XQNM 3RCPA 2DX1A 2YRYA 1NU2A 3TCAA 2V76A 2FJLA 2N23A 2I5CA 1P6SA 2D9YA 3KZ1A 2HE7A 2P8VA 2GS0A 1KZ7A 2P0HA 2AEHA 2DTCA 2EJ8A 2J0MA 1Y19B 1AQCA 5D27A 3ML4A 1UNRA 5DHFB 3ZDTA 2Y7BA 5HE0A 5EFXA 4Y94A 1DBHA 4HAYB 2D9ZA 1P3RA 1RJ2A 5GOWB 1FHXA 2K00A 4A5KA 3A98B 1EAZA 1Q67A 4HB2B 3PZDA 1NTYA 2NMBA 2P0DA 2MFQA 2UZRA 5JHHA 1BWNA 2P0FA 1E5WA 5KCVA 3CIKA 3MDBC 1BTKA 3ODOA 5KQ4A 4K81A 4KHAA 3KRXA 2W2WA 2BCJA 4HB0B 1XX0A 1OQNA 3TVVA 5J3QA 1PLSA 3DXCA 2DFKA 1U5GA 2ELAA 2J59M 1ISNA 2W2XC 5DI9B 1LW3A 2D2QA 4YONA 5JP4A 5DHAB 2OQBA 1QC6A 2D4QA 3KRWA 2QKMA 4H8SA 2OTXA 4CHJA 2ROVA 5C5BA 3A8PA 1WVHA 1EVHA 3PSCA 4HDQA 2RLOA 4HAVB 4HDOA 2MWNB 3KY9A 1XR0B 2YT0A 1U27A 4WSFA 3X23A 4TYZA 5HE1A 1BTNA 1MPHA 1V88A 5DH9B 3PVWA 3P6AA 1EGXA 4WJ7A 2VSZA 1N3HA 3WA0A 4MT7A 1XKEA 2J0KA 3T06A 3LJUX 2ZPYA 1DDWA 5CLLB 1ZC4B 4HATB 2ELBA 1KZGA 4GZUA 4BBKA 1H10A 1V5UA 1Y5OA 5J3YA 4EJNA 2I1JA 2R09A 1I2HA 4B6HA 2H7DA 2NZ8B 3HQCA 5D3XA 2K2UA 2J0JA 1OY2A 2HTHB 1GG3A 3FM8C 1M7RA 1WI1A 1LB1A 3N7CA 1EF1A 3QWMA 3PP2A 4DX8A 1DDMA 1I7AA 1NI2A 4K2OA 3GYOA 3SNHA 2RNRB 4GPTB 2N0YA 2LULA 1J19A 1H4RA 3BINA 3AU5A 4F7UP 5FI0A 2IFSA 4F7GA 1X05A 1MAIA 4DXAB 4PNKA 3F0WA 1X86A 1UNPA 3CXBB 1MKEA 4ZRJA 5C5BB 1XCGA 4DX90 4HB4B 5D3YA 1FGYA 3ULCA 4KHOA 2RSGA 2GCJA 1WGQA 1W1DA 2D10A 1U5FA 2DX5A 3FEHA 1FB8A 3ODXA 1KI1B 3QIJA 5FI1A 4HAUB 2EC1A 1PMSA 4CYEA 1FAOA 2DHIA 4CHMA 2YS1A 2MKRA 2ADZA 4NY0A 1W1GA 3SYXA 5JLJB 3ULBA 1ZM0A 3AJ4A 1K5DB 3TFMA 4EMOA 1ZVRA 1WJMA 1ZSQA 4MY6A 2Z0PA 2DYQA
chains in the Genus database with same CATH superfamily
3D8FA 1X11A 1V61A 4D6WA 3QBVB 2DN6A 2EMSA 3U7DA 2AL6A 4Z2NA 1QQGA 5DIFB 1U2BA 5IRSA 1X1FA 2D9VA 5C79A 2COAA 2COCA 4YL8A 1P5TA 2COFA 4EKUA 1DDVA 1DROA 1IRSA 4NSWA 1MK9B 1ZC3B 5D3WA 1BAKA 3O96A 3P7ZA 4C0AA 4HAXB 3SO6A 5LOPB 1OMWA 3FSSA 5CLQB 4D0NB 4WVFB 3TW1A 4HHVA 1SGHA 1MI1A 2L2IA 2Z13A 1K5GB 4KAXB 2M38A 4A6HA 2JP2A 1UPQA 2LKOA 2LYDA 3ODWA 3HW2B 2VKIA 4KVGB 4A6KA 5LONB 4GNKB 2EMTA 1AWEA 2MDXA 1WJ1A 1B55A 2M14A 3DXDA 2Y8GA 4QXAB 4KHBA 4HAZB 1Z87A 1MIXA 2DLWA 3PEGA 2CODA 2LOXA 1MK7B 1J0WA 3KSYA 5JHGA 3DCXA 2GJYA 3U12A 4GXBA 3V5WA 4P7IA 1GC7A 3D8DA 5D3VA 3BJIA 2QKLA 2G35A 2Z0OA 2E2XA 1U5EA 2X18A 3F5RA 1NTVA 4HB3B 5J3TA 3HK0A 4PQ0A 4K17A 2YS5A 3IVFA 1TXDA 4DIXA 5I2MA 1GC6A 1U29A 3GYPA 2R0DA 5C16A 4IFSA 2RUKB 3PVUA 1M7EA 2KCJA 1XD4A 2K2JA 2DKQA 2GCLA 1FOEA 2D11A 2YSZA 1TQZA 3SV1A 4DBBA 1UPRA 2DHKA 2IYBA 2CRFA 3AU4A 2DYNA 3U8ZA 1FHWA 4GMVA 1XODA 4K2PA 4ZRIA 4L6EA 2DHJA 2D9WA 5KQ1A 2KUPA 2YS3A 2Z14A 4TKNA 2UVMA 3VIAA 1TJ6A 2W2XD 2I5FA 1UNQA 2CAYA 3UZTA 1DYNA 2Z0QA 3A8QA 1MIZB 1PFJA 4MK0A 2I1KA 3OANA 2CY4A 3SUZA 4IAPA 4HSIA 4ZRKA 2YT1A 3OHMB 5HE3A 3HSAA 4F7HA 4IOYX 4GMXB 3DXEA 2Q13A 2L1CA 2YF0A 3M1IB 4GN1A 1V89A 2LG1A 2DA0A 2ROZB 3VOQA 5HE2A 4A6FB 2DKPA 4GOUA 1V5PA 3PVLA 5C6RA 1V5MA 2RVBB 3MPXA 3WYFB 3NSUA 3D8EA 3HIEA 1WGUA 2YVCA 3G9WA 3ZVRA 4XWXA 4KHBB 4L1RA 2KGXB 4OSNA 1FHOA 2LOZA 3TO1A 1U5DA 2D9XA 2VRWB 1FGZA 1RRPB 1W1HA 4HAWB 1WG7A 2CY5A 2PZ1A 2RGNB 2H7EA 5L81A 2Y8FA 1X1GA 4A6FA 1UEFA 3PG7A 2UZSA 1SHCA 4Z2MB 2XQNM 3RCPA 2DX1A 2YRYA 1NU2A 3TCAA 2V76A 2FJLA 2N23A 2RRFA 2I5CA 1P6SA 2D9YA 3KZ1A 2HE7A 2P8VA 5M4YB 2GS0A 1KZ7A 2P0HA 2AEHA 2DTCA 2EJ8A 2J0MA 1Y19B 1AQCA 5D27A 3ML4A 1UNRA 5DHFB 3ZDTA 2Y7BA 5HE0A 5EFXA 4Y94A 1DBHA 4HAYB 2D9ZA 1P3RA 1RJ2A 2YT2A 5GOWB 1FHXA 2K49A 2K00A 4A5KA 3A98B 1EAZA 1Q67A 4HB2B 3PZDA 1NTYA 2NMBA 2Z4DA 2P0DA 2MFQA 2UZRA 5JHHA 2R2YA 1BWNA 2P0FA 1E5WA 5KCVA 4OT1A 3CIKA 3MDBC 1BTKA 3ODOA 5KQ4A 4K81A 4KHAA 3KRXA 2W2WA 2BCJA 4HB0B 1XX0A 1OQNA 3TVVA 2NBVA 5J3QA 1PLSA 3DXCA 2DFKA 4QJ4B 1U5GA 2ELAA 2J59M 1ISNA 2W2XC 5DI9B 1LW3A 2D2QA 4YONA 5JP4A 5DHAB 2OQBA 1QC6A 1ZYIA 2D4QA 3KRWA 2QKMA 4H8SA 2OTXA 4CHJA 2KR0A 2ROVA 5C5BA 3A8PA 1WVHA 3NWDA 1EVHA 3PSCA 4HDQA 2RLOA 2FJUB 4HAVB 4HDOA 2MWNB 3KY9A 1XR0B 2YT0A 1U27A 4WSFA 3X23A 4TYZA 3NWFA 2K8EA 5HE1A 1BTNA 1MPHA 1V88A 5DH9B 3PVWA 3P6AA 1EGXA 5I2SA 4WJ7A 2VSZA 1N3HA 3WA0A 4MT7A 1XKEA 2J0KA 3T06A 3LJUX 2ZPYA 1DDWA 5CLLB 1ZC4B 2ZKMX 4HATB 2GUMA 2ELBA 1KZGA 4GZUA 4BBKA 1H10A 1V5UA 1Y5OA 5J3YA 4EJNA 2I1JA 2R09A 1I2HA 4B6HA 2H7DA 2NZ8B 3HQCA 5D3XA 2Z59A 2K2UA 2J0JA 1OY2A 2HTHB 1GG3A 3FM8C 1M7RA 1WI1A 1LB1A 3N7CA 1EF1A 3QWMA 3A58A 3PP2A 4DX8A 1DDMA 1I7AA 1NI2A 4K2OA 3GYOA 3SNHA 2RNRB 3NWAA 4GPTB 2N0YA 2LULA 1J19A 1H4RA 3BINA 3AU5A 4F7UP 4QJ3B 5FI0A 2IFSA 4F7GA 1X05A 1MAIA 4DXAB 4PNKA 3F0WA 1X86A 1T77A 1UNPA 3CXBB 1MKEA 4ZRJA 4CSQA 5C5BB 1XCGA 4DX90 4HB4B 5D3YA 5LG4B 1FGYA 3B77A 3ULCA 4KHOA 2RSGA 2GCJA 1WGQA 1W1DA 2D10A 1U5FA 2DX5A 2KUQA 3FEHA 1FB8A 3ODXA 1KI1B 3QIJA 5FI1A 4HAUB 2EC1A 1PMSA 4CYEA 1FAOA 2DHIA 3FVCA 4CHMA 2YS1A 2MKRA 2ADZA 4NY0A 1W1GA 3SYXA 5JLJB 3ULBA 1ZM0A 3AJ4A 1K5DB 2KIEA 3TFMA 4EMOA 1ZVRA 1WJMA 1ZSQA 4QJ5B 4MY6A 2KIGA 2Z0PA 3NW8A 2DYQA
chains in the Genus database with same CATH topology
3D8FA 1X11A 1V61A 3QBVB 2DN6A 2EMSA 3U7DA 2AL6A 4Z2NA 1QQGA 5DIFB 1U2BA 1X1FA 2D9VA 5C79A 2COAA 2COCA 4YL8A 1P5TA 2COFA 4EKUA 1DDVA 1DROA 1IRSA 4NSWA 1MK9B 1ZC3B 5D3WA 1BAKA 3O96A 3P7ZA 4C0AA 4HAXB 3SO6A 5LOPB 1OMWA 3FSSA 5CLQB 4D0NB 4WVFB 3TW1A 4HHVA 1SGHA 2L2IA 1K5GB 4KAXB 2M38A 4A6HA 2JP2A 1UPQA 2LKOA 2LYDA 3ODWA 3HW2B 2VKIA 4KVGB 4A6KA 5LONB 2EMTA 1AWEA 2MDXA 1WJ1A 1B55A 2M14A 3DXDA 2Y8GA 4HAZB 1Z87A 1MIXA 2DLWA 3PEGA 2CODA 2LOXA 1MK7B 1J0WA 3KSYA 5JHGA 2GJYA 4GXBA 3V5WA 4P7IA 1GC7A 3D8DA 5D3VA 3BJIA 2QKLA 2G35A 2Z0OA 2E2XA 1U5EA 2X18A 3F5RA 1NTVA 4HB3B 5J3TA 3HK0A 4PQ0A 4K17A 2YS5A 3IVFA 1TXDA 1GC6A 1U29A 3GYPA 2R0DA 5C16A 4IFSA 2RUKB 3PVUA 1M7EA 2KCJA 1XD4A 2K2JA 2DKQA 2GCLA 1FOEA 2D11A 2YSZA 1TQZA 3SV1A 4DBBA 1UPRA 2DHKA 2IYBA 2CRFA 3AU4A 2DYNA 3U8ZA 1FHWA 4GMVA 1XODA 4K2PA 4ZRIA 4L6EA 2DHJA 2D9WA 5KQ1A 2KUPA 2YS3A 4TKNA 2UVMA 3VIAA 1TJ6A 2W2XD 2I5FA 1UNQA 2CAYA 3UZTA 1DYNA 2Z0QA 3A8QA 1MIZB 1PFJA 4MK0A 2I1KA 3OANA 2CY4A 3SUZA 4IAPA 4ZRKA 2YT1A 5HE3A 4F7HA 4IOYX 4GMXB 3DXEA 2Q13A 2L1CA 2YF0A 3M1IB 4GN1A 1V89A 2LG1A 2DA0A 2ROZB 3VOQA 5HE2A 4A6FB 2DKPA 1V5PA 3PVLA 5C6RA 1V5MA 2RVBB 3MPXA 3WYFB 3NSUA 3D8EA 1WGUA 2YVCA 3G9WA 3ZVRA 4XWXA 4KHBB 2KGXB 1FHOA 2LOZA 3TO1A 1U5DA 2D9XA 2VRWB 1FGZA 1RRPB 1W1HA 4HAWB 1WG7A 2CY5A 2PZ1A 2RGNB 2H7EA 5L81A 2Y8FA 1X1GA 4A6FA 1UEFA 3PG7A 2UZSA 1SHCA 4Z2MB 2XQNM 3RCPA 2DX1A 2YRYA 1NU2A 3TCAA 2V76A 2FJLA 2N23A 2I5CA 1P6SA 2D9YA 3KZ1A 2HE7A 2P8VA 2GS0A 1KZ7A 2P0HA 2AEHA 2DTCA 2EJ8A 2J0MA 1Y19B 1AQCA 5D27A 3ML4A 1UNRA 5DHFB 3ZDTA 2Y7BA 5HE0A 5EFXA 4Y94A 1DBHA 4HAYB 2D9ZA 1P3RA 1RJ2A 5GOWB 1FHXA 2K00A 4A5KA 3A98B 1EAZA 1Q67A 4HB2B 3PZDA 1NTYA 2NMBA 2P0DA 2MFQA 2UZRA 5JHHA 1BWNA 2P0FA 1E5WA 5KCVA 3CIKA 3MDBC 1BTKA 3ODOA 5KQ4A 4K81A 4KHAA 3KRXA 2W2WA 2BCJA 4HB0B 1XX0A 1OQNA 3TVVA 5J3QA 1PLSA 3DXCA 2DFKA 1U5GA 2ELAA 2J59M 1ISNA 2W2XC 5DI9B 1LW3A 2D2QA 4YONA 5JP4A 5DHAB 2OQBA 1QC6A 2D4QA 3KRWA 2QKMA 4H8SA 2OTXA 4CHJA 2ROVA 5C5BA 3A8PA 1WVHA 1EVHA 3PSCA 4HDQA 2RLOA 4HAVB 4HDOA 2MWNB 3KY9A 1XR0B 2YT0A 1U27A 4WSFA 3X23A 4TYZA 5HE1A 1BTNA 1MPHA 1V88A 5DH9B 3PVWA 3P6AA 1EGXA 4WJ7A 2VSZA 1N3HA 3WA0A 4MT7A 1XKEA 2J0KA 3T06A 3LJUX 2ZPYA 1DDWA 5CLLB 1ZC4B 4HATB 2ELBA 1KZGA 4GZUA 4BBKA 1H10A 1V5UA 1Y5OA 5J3YA 4EJNA 2I1JA 2R09A 1I2HA 4B6HA 2H7DA 2NZ8B 3HQCA 5D3XA 2K2UA 2J0JA 1OY2A 2HTHB 1GG3A 3FM8C 1M7RA 1WI1A 1LB1A 3N7CA 1EF1A 3QWMA 3PP2A 4DX8A 1DDMA 1I7AA 1NI2A 4K2OA 3GYOA 3SNHA 2RNRB 4GPTB 2N0YA 2LULA 1J19A 1H4RA 3BINA 3AU5A 4F7UP 5FI0A 2IFSA 4F7GA 1X05A 1MAIA 4DXAB 4PNKA 3F0WA 1X86A 1UNPA 3CXBB 1MKEA 4ZRJA 5C5BB 1XCGA 4DX90 4HB4B 5D3YA 1FGYA 3ULCA 4KHOA 2RSGA 2GCJA 1WGQA 1W1DA 2D10A 1U5FA 2DX5A 3FEHA 1FB8A 3ODXA 1KI1B 3QIJA 5FI1A 4HAUB 2EC1A 1PMSA 4CYEA 1FAOA 2DHIA 4CHMA 2YS1A 2MKRA 2ADZA 4NY0A 1W1GA 3SYXA 5JLJB 3ULBA 1ZM0A 3AJ4A 1K5DB 3TFMA 4EMOA 1ZVRA 1WJMA 1ZSQA 4MY6A 2Z0PA 2DYQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D8F A;  1X11 A;  1V61 A;  3QBV B;  2DN6 A;  2EMS A;  3U7D A;  2AL6 A;  4Z2N A;  1QQG A;  5DIF B;  1U2B A;  1X1F A;  2D9V A;  5C79 A;  2COA A;  2COC A;  4YL8 A;  1P5T A;  2COF A;  4EKU A;  1DDV A;  1DRO A;  1IRS A;  4NSW A;  1MK9 B;  1ZC3 B;  5D3W A;  1BAK A;  3O96 A;  3P7Z A;  4C0A A;  4HAX B;  3SO6 A;  5LOP B;  1OMW A;  3FSS A;  5CLQ B;  4D0N B;  4WVF B;  3TW1 A;  4HHV A;  1SGH A;  2L2I A;  1K5G B;  4KAX B;  2M38 A;  4A6H A;  2JP2 A;  1UPQ A;  2LKO A;  2LYD A;  3ODW A;  3HW2 B;  2VKI A;  4KVG B;  4A6K A;  5LON B;  2EMT A;  1AWE A;  2MDX A;  1WJ1 A;  1B55 A;  2M14 A;  3DXD A;  2Y8G A;  4HAZ B;  1Z87 A;  1MIX A;  2DLW A;  3PEG A;  2COD A;  2LOX A;  1MK7 B;  1J0W A;  3KSY A;  5JHG A;  2GJY A;  4GXB A;  3V5W A;  4P7I A;  1GC7 A;  3D8D A;  5D3V A;  3BJI A;  2QKL A;  2G35 A;  2Z0O A;  2E2X A;  1U5E A;  2X18 A;  3F5R A;  1NTV A;  4HB3 B;  5J3T A;  3HK0 A;  4PQ0 A;  4K17 A;  2YS5 A;  3IVF A;  1TXD A;  1GC6 A;  1U29 A;  3GYP A;  2R0D A;  5C16 A;  4IFS A;  2RUK B;  3PVU A;  1M7E A;  2KCJ A;  1XD4 A;  2K2J A;  2DKQ A;  2GCL A;  1FOE A;  2D11 A;  2YSZ A;  1TQZ A;  3SV1 A;  4DBB A;  1UPR A;  2DHK A;  2IYB A;  2CRF A;  3AU4 A;  2DYN A;  3U8Z A;  1FHW A;  4GMV A;  1XOD A;  4K2P A;  4ZRI A;  4L6E A;  2DHJ A;  2D9W A;  5KQ1 A;  2KUP A;  2YS3 A;  4TKN A;  2UVM A;  3VIA A;  1TJ6 A;  2W2X D;  2I5F A;  1UNQ A;  2CAY A;  3UZT A;  1DYN A;  2Z0Q A;  3A8Q A;  1MIZ B;  1PFJ A;  4MK0 A;  2I1K A;  3OAN A;  2CY4 A;  3SUZ A;  4IAP A;  4ZRK A;  2YT1 A;  5HE3 A;  4F7H A;  4IOY X;  4GMX B;  3DXE A;  2Q13 A;  2L1C A;  2YF0 A;  3M1I B;  4GN1 A;  1V89 A;  2LG1 A;  2DA0 A;  2ROZ B;  3VOQ A;  5HE2 A;  4A6F B;  2DKP A;  1V5P A;  3PVL A;  5C6R A;  1V5M A;  2RVB B;  3MPX A;  3WYF B;  3NSU A;  3D8E A;  1WGU A;  2YVC A;  3G9W A;  3ZVR A;  4XWX A;  4KHB B;  2KGX B;  1FHO A;  2LOZ A;  3TO1 A;  1U5D A;  2D9X A;  2VRW B;  1FGZ A;  1RRP B;  1W1H A;  4HAW B;  1WG7 A;  2CY5 A;  2PZ1 A;  2RGN B;  2H7E A;  5L81 A;  2Y8F A;  1X1G A;  4A6F A;  1UEF A;  3PG7 A;  2UZS A;  1SHC A;  4Z2M B;  2XQN M;  3RCP A;  2DX1 A;  2YRY A;  1NU2 A;  3TCA A;  2V76 A;  2FJL A;  2N23 A;  2I5C A;  1P6S A;  2D9Y A;  3KZ1 A;  2HE7 A;  2P8V A;  2GS0 A;  1KZ7 A;  2P0H A;  2AEH A;  2DTC A;  2EJ8 A;  2J0M A;  1Y19 B;  1AQC A;  5D27 A;  3ML4 A;  1UNR A;  5DHF B;  3ZDT A;  2Y7B A;  5HE0 A;  5EFX A;  4Y94 A;  1DBH A;  4HAY B;  2D9Z A;  1P3R A;  1RJ2 A;  5GOW B;  1FHX A;  2K00 A;  4A5K A;  3A98 B;  1EAZ A;  1Q67 A;  4HB2 B;  3PZD A;  1NTY A;  2NMB A;  2P0D A;  2MFQ A;  2UZR A;  5JHH A;  1BWN A;  2P0F A;  1E5W A;  5KCV A;  3CIK A;  3MDB C;  1BTK A;  3ODO A;  5KQ4 A;  4K81 A;  4KHA A;  3KRX A;  2W2W A;  2BCJ A;  4HB0 B;  1XX0 A;  1OQN A;  3TVV A;  5J3Q A;  1PLS A;  3DXC A;  2DFK A;  1U5G A;  2ELA A;  2J59 M;  1ISN A;  2W2X C;  5DI9 B;  1LW3 A;  2D2Q A;  4YON A;  5JP4 A;  5DHA B;  2OQB A;  1QC6 A;  2D4Q A;  3KRW A;  2QKM A;  4H8S A;  2OTX A;  4CHJ A;  2ROV A;  5C5B A;  3A8P A;  1WVH A;  1EVH A;  3PSC A;  4HDQ A;  2RLO A;  4HAV B;  4HDO A;  2MWN B;  3KY9 A;  1XR0 B;  2YT0 A;  1U27 A;  4WSF A;  3X23 A;  4TYZ A;  5HE1 A;  1BTN A;  1MPH A;  1V88 A;  5DH9 B;  3PVW A;  3P6A A;  1EGX A;  4WJ7 A;  2VSZ A;  1N3H A;  3WA0 A;  4MT7 A;  1XKE A;  2J0K A;  3T06 A;  3LJU X;  2ZPY A;  1DDW A;  5CLL B;  1ZC4 B;  4HAT B;  2ELB A;  1KZG A;  4GZU A;  4BBK A;  1H10 A;  1V5U A;  1Y5O A;  5J3Y A;  4EJN A;  2I1J A;  2R09 A;  1I2H A;  4B6H A;  2H7D A;  2NZ8 B;  3HQC A;  5D3X A;  2K2U A;  2J0J A;  1OY2 A;  2HTH B;  1GG3 A;  3FM8 C;  1M7R A;  1WI1 A;  1LB1 A;  3N7C A;  1EF1 A;  3QWM A;  3PP2 A;  4DX8 A;  1DDM A;  1I7A A;  1NI2 A;  4K2O A;  3GYO A;  3SNH A;  2RNR B;  4GPT B;  2N0Y A;  2LUL A;  1J19 A;  1H4R A;  3BIN A;  3AU5 A;  4F7U P;  5FI0 A;  2IFS A;  4F7G A;  1X05 A;  1MAI A;  4DXA B;  4PNK A;  3F0W A;  1X86 A;  1UNP A;  3CXB B;  1MKE A;  4ZRJ A;  5C5B B;  1XCG A;  4DX9 0;  4HB4 B;  5D3Y A;  1FGY A;  3ULC A;  4KHO A;  2RSG A;  2GCJ A;  1WGQ A;  1W1D A;  2D10 A;  1U5F A;  2DX5 A;  3FEH A;  1FB8 A;  3ODX A;  1KI1 B;  3QIJ A;  5FI1 A;  4HAU B;  2EC1 A;  1PMS A;  4CYE A;  1FAO A;  2DHI A;  4CHM A;  2YS1 A;  2MKR A;  2ADZ A;  4NY0 A;  1W1G A;  3SYX A;  5JLJ B;  3ULB A;  1ZM0 A;  3AJ4 A;  1K5D B;  3TFM A;  4EMO A;  1ZVR A;  1WJM A;  1ZSQ A;  4MY6 A;  2Z0P A;  2DYQ A; 
#chains in the Genus database with same CATH topology
 3D8F A;  1X11 A;  1V61 A;  4D6W A;  3QBV B;  2DN6 A;  2EMS A;  3U7D A;  2AL6 A;  4Z2N A;  1QQG A;  5DIF B;  1U2B A;  5IRS A;  1X1F A;  2D9V A;  5C79 A;  2COA A;  2COC A;  4YL8 A;  1P5T A;  2COF A;  4EKU A;  1DDV A;  1DRO A;  1IRS A;  4NSW A;  1MK9 B;  1ZC3 B;  5D3W A;  1BAK A;  3O96 A;  3P7Z A;  4C0A A;  4HAX B;  3SO6 A;  5LOP B;  1OMW A;  3FSS A;  5CLQ B;  4D0N B;  4WVF B;  3TW1 A;  4HHV A;  1SGH A;  1MI1 A;  2L2I A;  2Z13 A;  1K5G B;  4KAX B;  2M38 A;  4A6H A;  2JP2 A;  1UPQ A;  2LKO A;  2LYD A;  3ODW A;  3HW2 B;  2VKI A;  4KVG B;  4A6K A;  5LON B;  4GNK B;  2EMT A;  1AWE A;  2MDX A;  1WJ1 A;  1B55 A;  2M14 A;  3DXD A;  2Y8G A;  4QXA B;  4KHB A;  4HAZ B;  1Z87 A;  1MIX A;  2DLW A;  3PEG A;  2COD A;  2LOX A;  1MK7 B;  1J0W A;  3KSY A;  5JHG A;  3DCX A;  2GJY A;  3U12 A;  4GXB A;  3V5W A;  4P7I A;  1GC7 A;  3D8D A;  5D3V A;  3BJI A;  2QKL A;  2G35 A;  2Z0O A;  2E2X A;  1U5E A;  2X18 A;  3F5R A;  1NTV A;  4HB3 B;  5J3T A;  3HK0 A;  4PQ0 A;  4K17 A;  2YS5 A;  3IVF A;  1TXD A;  4DIX A;  5I2M A;  1GC6 A;  1U29 A;  3GYP A;  2R0D A;  5C16 A;  4IFS A;  2RUK B;  3PVU A;  1M7E A;  2KCJ A;  1XD4 A;  2K2J A;  2DKQ A;  2GCL A;  1FOE A;  2D11 A;  2YSZ A;  1TQZ A;  3SV1 A;  4DBB A;  1UPR A;  2DHK A;  2IYB A;  2CRF A;  3AU4 A;  2DYN A;  3U8Z A;  1FHW A;  4GMV A;  1XOD A;  4K2P A;  4ZRI A;  4L6E A;  2DHJ A;  2D9W A;  5KQ1 A;  2KUP A;  2YS3 A;  2Z14 A;  4TKN A;  2UVM A;  3VIA A;  1TJ6 A;  2W2X D;  2I5F A;  1UNQ A;  2CAY A;  3UZT A;  1DYN A;  2Z0Q A;  3A8Q A;  1MIZ B;  1PFJ A;  4MK0 A;  2I1K A;  3OAN A;  2CY4 A;  3SUZ A;  4IAP A;  4HSI A;  4ZRK A;  2YT1 A;  3OHM B;  5HE3 A;  3HSA A;  4F7H A;  4IOY X;  4GMX B;  3DXE A;  2Q13 A;  2L1C A;  2YF0 A;  3M1I B;  4GN1 A;  1V89 A;  2LG1 A;  2DA0 A;  2ROZ B;  3VOQ A;  5HE2 A;  4A6F B;  2DKP A;  4GOU A;  1V5P A;  3PVL A;  5C6R A;  1V5M A;  2RVB B;  3MPX A;  3WYF B;  3NSU A;  3D8E A;  3HIE A;  1WGU A;  2YVC A;  3G9W A;  3ZVR A;  4XWX A;  4KHB B;  4L1R A;  2KGX B;  4OSN A;  1FHO A;  2LOZ A;  3TO1 A;  1U5D A;  2D9X A;  2VRW B;  1FGZ A;  1RRP B;  1W1H A;  4HAW B;  1WG7 A;  2CY5 A;  2PZ1 A;  2RGN B;  2H7E A;  5L81 A;  2Y8F A;  1X1G A;  4A6F A;  1UEF A;  3PG7 A;  2UZS A;  1SHC A;  4Z2M B;  2XQN M;  3RCP A;  2DX1 A;  2YRY A;  1NU2 A;  3TCA A;  2V76 A;  2FJL A;  2N23 A;  2RRF A;  2I5C A;  1P6S A;  2D9Y A;  3KZ1 A;  2HE7 A;  2P8V A;  5M4Y B;  2GS0 A;  1KZ7 A;  2P0H A;  2AEH A;  2DTC A;  2EJ8 A;  2J0M A;  1Y19 B;  1AQC A;  5D27 A;  3ML4 A;  1UNR A;  5DHF B;  3ZDT A;  2Y7B A;  5HE0 A;  5EFX A;  4Y94 A;  1DBH A;  4HAY B;  2D9Z A;  1P3R A;  1RJ2 A;  2YT2 A;  5GOW B;  1FHX A;  2K49 A;  2K00 A;  4A5K A;  3A98 B;  1EAZ A;  1Q67 A;  4HB2 B;  3PZD A;  1NTY A;  2NMB A;  2Z4D A;  2P0D A;  2MFQ A;  2UZR A;  5JHH A;  2R2Y A;  1BWN A;  2P0F A;  1E5W A;  5KCV A;  4OT1 A;  3CIK A;  3MDB C;  1BTK A;  3ODO A;  5KQ4 A;  4K81 A;  4KHA A;  3KRX A;  2W2W A;  2BCJ A;  4HB0 B;  1XX0 A;  1OQN A;  3TVV A;  2NBV A;  5J3Q A;  1PLS A;  3DXC A;  2DFK A;  4QJ4 B;  1U5G A;  2ELA A;  2J59 M;  1ISN A;  2W2X C;  5DI9 B;  1LW3 A;  2D2Q A;  4YON A;  5JP4 A;  5DHA B;  2OQB A;  1QC6 A;  1ZYI A;  2D4Q A;  3KRW A;  2QKM A;  4H8S A;  2OTX A;  4CHJ A;  2KR0 A;  2ROV A;  5C5B A;  3A8P A;  1WVH A;  3NWD A;  1EVH A;  3PSC A;  4HDQ A;  2RLO A;  2FJU B;  4HAV B;  4HDO A;  2MWN B;  3KY9 A;  1XR0 B;  2YT0 A;  1U27 A;  4WSF A;  3X23 A;  4TYZ A;  3NWF A;  2K8E A;  5HE1 A;  1BTN A;  1MPH A;  1V88 A;  5DH9 B;  3PVW A;  3P6A A;  1EGX A;  5I2S A;  4WJ7 A;  2VSZ A;  1N3H A;  3WA0 A;  4MT7 A;  1XKE A;  2J0K A;  3T06 A;  3LJU X;  2ZPY A;  1DDW A;  5CLL B;  1ZC4 B;  2ZKM X;  4HAT B;  2GUM A;  2ELB A;  1KZG A;  4GZU A;  4BBK A;  1H10 A;  1V5U A;  1Y5O A;  5J3Y A;  4EJN A;  2I1J A;  2R09 A;  1I2H A;  4B6H A;  2H7D A;  2NZ8 B;  3HQC A;  5D3X A;  2Z59 A;  2K2U A;  2J0J A;  1OY2 A;  2HTH B;  1GG3 A;  3FM8 C;  1M7R A;  1WI1 A;  1LB1 A;  3N7C A;  1EF1 A;  3QWM A;  3A58 A;  3PP2 A;  4DX8 A;  1DDM A;  1I7A A;  1NI2 A;  4K2O A;  3GYO A;  3SNH A;  2RNR B;  3NWA A;  4GPT B;  2N0Y A;  2LUL A;  1J19 A;  1H4R A;  3BIN A;  3AU5 A;  4F7U P;  4QJ3 B;  5FI0 A;  2IFS A;  4F7G A;  1X05 A;  1MAI A;  4DXA B;  4PNK A;  3F0W A;  1X86 A;  1T77 A;  1UNP A;  3CXB B;  1MKE A;  4ZRJ A;  4CSQ A;  5C5B B;  1XCG A;  4DX9 0;  4HB4 B;  5D3Y A;  5LG4 B;  1FGY A;  3B77 A;  3ULC A;  4KHO A;  2RSG A;  2GCJ A;  1WGQ A;  1W1D A;  2D10 A;  1U5F A;  2DX5 A;  2KUQ A;  3FEH A;  1FB8 A;  3ODX A;  1KI1 B;  3QIJ A;  5FI1 A;  4HAU B;  2EC1 A;  1PMS A;  4CYE A;  1FAO A;  2DHI A;  3FVC A;  4CHM A;  2YS1 A;  2MKR A;  2ADZ A;  4NY0 A;  1W1G A;  3SYX A;  5JLJ B;  3ULB A;  1ZM0 A;  3AJ4 A;  1K5D B;  2KIE A;  3TFM A;  4EMO A;  1ZVR A;  1WJM A;  1ZSQ A;  4QJ5 B;  4MY6 A;  2KIG A;  2Z0P A;  3NW8 A;  2DYQ A; 
#chains in the Genus database with same CATH homology
 3D8F A;  1X11 A;  1V61 A;  3QBV B;  2DN6 A;  2EMS A;  3U7D A;  2AL6 A;  4Z2N A;  1QQG A;  5DIF B;  1U2B A;  1X1F A;  2D9V A;  5C79 A;  2COA A;  2COC A;  4YL8 A;  1P5T A;  2COF A;  4EKU A;  1DDV A;  1DRO A;  1IRS A;  4NSW A;  1MK9 B;  1ZC3 B;  5D3W A;  1BAK A;  3O96 A;  3P7Z A;  4C0A A;  4HAX B;  3SO6 A;  5LOP B;  1OMW A;  3FSS A;  5CLQ B;  4D0N B;  4WVF B;  3TW1 A;  4HHV A;  1SGH A;  2L2I A;  1K5G B;  4KAX B;  2M38 A;  4A6H A;  2JP2 A;  1UPQ A;  2LKO A;  2LYD A;  3ODW A;  3HW2 B;  2VKI A;  4KVG B;  4A6K A;  5LON B;  2EMT A;  1AWE A;  2MDX A;  1WJ1 A;  1B55 A;  2M14 A;  3DXD A;  2Y8G A;  4HAZ B;  1Z87 A;  1MIX A;  2DLW A;  3PEG A;  2COD A;  2LOX A;  1MK7 B;  1J0W A;  3KSY A;  5JHG A;  2GJY A;  4GXB A;  3V5W A;  4P7I A;  1GC7 A;  3D8D A;  5D3V A;  3BJI A;  2QKL A;  2G35 A;  2Z0O A;  2E2X A;  1U5E A;  2X18 A;  3F5R A;  1NTV A;  4HB3 B;  5J3T A;  3HK0 A;  4PQ0 A;  4K17 A;  2YS5 A;  3IVF A;  1TXD A;  1GC6 A;  1U29 A;  3GYP A;  2R0D A;  5C16 A;  4IFS A;  2RUK B;  3PVU A;  1M7E A;  2KCJ A;  1XD4 A;  2K2J A;  2DKQ A;  2GCL A;  1FOE A;  2D11 A;  2YSZ A;  1TQZ A;  3SV1 A;  4DBB A;  1UPR A;  2DHK A;  2IYB A;  2CRF A;  3AU4 A;  2DYN A;  3U8Z A;  1FHW A;  4GMV A;  1XOD A;  4K2P A;  4ZRI A;  4L6E A;  2DHJ A;  2D9W A;  5KQ1 A;  2KUP A;  2YS3 A;  4TKN A;  2UVM A;  3VIA A;  1TJ6 A;  2W2X D;  2I5F A;  1UNQ A;  2CAY A;  3UZT A;  1DYN A;  2Z0Q A;  3A8Q A;  1MIZ B;  1PFJ A;  4MK0 A;  2I1K A;  3OAN A;  2CY4 A;  3SUZ A;  4IAP A;  4ZRK A;  2YT1 A;  5HE3 A;  4F7H A;  4IOY X;  4GMX B;  3DXE A;  2Q13 A;  2L1C A;  2YF0 A;  3M1I B;  4GN1 A;  1V89 A;  2LG1 A;  2DA0 A;  2ROZ B;  3VOQ A;  5HE2 A;  4A6F B;  2DKP A;  1V5P A;  3PVL A;  5C6R A;  1V5M A;  2RVB B;  3MPX A;  3WYF B;  3NSU A;  3D8E A;  1WGU A;  2YVC A;  3G9W A;  3ZVR A;  4XWX A;  4KHB B;  2KGX B;  1FHO A;  2LOZ A;  3TO1 A;  1U5D A;  2D9X A;  2VRW B;  1FGZ A;  1RRP B;  1W1H A;  4HAW B;  1WG7 A;  2CY5 A;  2PZ1 A;  2RGN B;  2H7E A;  5L81 A;  2Y8F A;  1X1G A;  4A6F A;  1UEF A;  3PG7 A;  2UZS A;  1SHC A;  4Z2M B;  2XQN M;  3RCP A;  2DX1 A;  2YRY A;  1NU2 A;  3TCA A;  2V76 A;  2FJL A;  2N23 A;  2I5C A;  1P6S A;  2D9Y A;  3KZ1 A;  2HE7 A;  2P8V A;  2GS0 A;  1KZ7 A;  2P0H A;  2AEH A;  2DTC A;  2EJ8 A;  2J0M A;  1Y19 B;  1AQC A;  5D27 A;  3ML4 A;  1UNR A;  5DHF B;  3ZDT A;  2Y7B A;  5HE0 A;  5EFX A;  4Y94 A;  1DBH A;  4HAY B;  2D9Z A;  1P3R A;  1RJ2 A;  5GOW B;  1FHX A;  2K00 A;  4A5K A;  3A98 B;  1EAZ A;  1Q67 A;  4HB2 B;  3PZD A;  1NTY A;  2NMB A;  2P0D A;  2MFQ A;  2UZR A;  5JHH A;  1BWN A;  2P0F A;  1E5W A;  5KCV A;  3CIK A;  3MDB C;  1BTK A;  3ODO A;  5KQ4 A;  4K81 A;  4KHA A;  3KRX A;  2W2W A;  2BCJ A;  4HB0 B;  1XX0 A;  1OQN A;  3TVV A;  5J3Q A;  1PLS A;  3DXC A;  2DFK A;  1U5G A;  2ELA A;  2J59 M;  1ISN A;  2W2X C;  5DI9 B;  1LW3 A;  2D2Q A;  4YON A;  5JP4 A;  5DHA B;  2OQB A;  1QC6 A;  2D4Q A;  3KRW A;  2QKM A;  4H8S A;  2OTX A;  4CHJ A;  2ROV A;  5C5B A;  3A8P A;  1WVH A;  1EVH A;  3PSC A;  4HDQ A;  2RLO A;  4HAV B;  4HDO A;  2MWN B;  3KY9 A;  1XR0 B;  2YT0 A;  1U27 A;  4WSF A;  3X23 A;  4TYZ A;  5HE1 A;  1BTN A;  1MPH A;  1V88 A;  5DH9 B;  3PVW A;  3P6A A;  1EGX A;  4WJ7 A;  2VSZ A;  1N3H A;  3WA0 A;  4MT7 A;  1XKE A;  2J0K A;  3T06 A;  3LJU X;  2ZPY A;  1DDW A;  5CLL B;  1ZC4 B;  4HAT B;  2ELB A;  1KZG A;  4GZU A;  4BBK A;  1H10 A;  1V5U A;  1Y5O A;  5J3Y A;  4EJN A;  2I1J A;  2R09 A;  1I2H A;  4B6H A;  2H7D A;  2NZ8 B;  3HQC A;  5D3X A;  2K2U A;  2J0J A;  1OY2 A;  2HTH B;  1GG3 A;  3FM8 C;  1M7R A;  1WI1 A;  1LB1 A;  3N7C A;  1EF1 A;  3QWM A;  3PP2 A;  4DX8 A;  1DDM A;  1I7A A;  1NI2 A;  4K2O A;  3GYO A;  3SNH A;  2RNR B;  4GPT B;  2N0Y A;  2LUL A;  1J19 A;  1H4R A;  3BIN A;  3AU5 A;  4F7U P;  5FI0 A;  2IFS A;  4F7G A;  1X05 A;  1MAI A;  4DXA B;  4PNK A;  3F0W A;  1X86 A;  1UNP A;  3CXB B;  1MKE A;  4ZRJ A;  5C5B B;  1XCG A;  4DX9 0;  4HB4 B;  5D3Y A;  1FGY A;  3ULC A;  4KHO A;  2RSG A;  2GCJ A;  1WGQ A;  1W1D A;  2D10 A;  1U5F A;  2DX5 A;  3FEH A;  1FB8 A;  3ODX A;  1KI1 B;  3QIJ A;  5FI1 A;  4HAU B;  2EC1 A;  1PMS A;  4CYE A;  1FAO A;  2DHI A;  4CHM A;  2YS1 A;  2MKR A;  2ADZ A;  4NY0 A;  1W1G A;  3SYX A;  5JLJ B;  3ULB A;  1ZM0 A;  3AJ4 A;  1K5D B;  3TFM A;  4EMO A;  1ZVR A;  1WJM A;  1ZSQ A;  4MY6 A;  2Z0P A;  2DYQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...