5DIFB

Crystal structure of cpeb4 nes peptide in complex with crm1-ran-ranbp1
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
138
structure length
130
Chain Sequence
IHFEPVVTMEEDEEVLYKVRAKLFRFDADAKEWKERGTGDCKFLKNKKTNKVRILMRRDKTLKICANHIIAPEYTLKPNVGSDRSWVYACTADIAEGEAEAFTFAIRFGSKENADKFKEEFEKAQEINKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords GTP-binding nuclear protein Ran
publication title Structural determinants of nuclear export signal orientation in binding to exportin CRM1.
pubmed doi rcsb
source organism Homo sapiens
total genus 31
structure length 130
sequence length 138
ec nomenclature
pdb deposition date 2015-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00638 Ran_BP1 RanBP1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 5difB00
2QKLA 3UZTA 5C5BA 1PFJA 3U7DA 2M38A 1SGHA 2OTXA 2D9VA 3HQCA 2DYNA 4C0AA 1FB8A 2ZPYA 3ODXA 2YSZA 4F7GA 1U27A 2DFKA 1U5DA 4F7UP 2LOXA 3TW1A 1X1GA 3FEHA 3WA0A 1QC6A 1ZM0A 3TVVA 2L1CA 4HB4B 4DX90 2L2IA 2W2WA 2COCA 4A6KA 3ML4A 4GMVA 4HDQA 1LW3A 2ELAA 4DX8A 1EAZA 3AJ4A 5KQ1A 3A8PA 3VOQA 1K5DB 1TXDA 3PSCA 4A6FB 2DTCA 5JP4A 4KAXB 5CLQB 2AL6A 2MDXA 4PQ0A 2I5FA 2EMSA 2R09A 2AEHA 3QWMA 3QBVB 3HK0A 5JLJB 3KRWA 2Z0OA 1LB1A 1X1FA 2P0DA 4HAZB 3O96A 4IAPA 1XKEA 4IOYX 4ZRIA 1FAOA 2VKIA 3T06A 4EKUA 1UNQA 2H7DA 3QIJA 1Y5OA 2D10A 2D2QA 2N0YA 2NZ8B 3F0WA 1EVHA 3LJUX 2EMTA 1TQZA 4TYZA 1AWEA 2LOZA 3FSSA 2QKMA 3PVUA 2ROVA 4EJNA 4XWXA 1DBHA 3U8ZA 2RVBB 2J0KA 2RSGA 5D3XA 3SO6A 1U5FA 1XR0B 2FJLA 2UZSA 1NTYA 3D8EA 1DDVA 1M7RA 1W1DA 2DLWA 4K81A 4A6HA 1U5GA 2EC1A 2I1JA 2LG1A 2P0HA 1MAIA 4HHVA 1KZGA 1QQGA 4KHOA 2K00A 2DKQA 1EGXA 2Z0PA 2W2XD 2CY5A 1WGUA 4BBKA 1V5MA 3CIKA 1P6SA 1PMSA 4HATB 1OQNA 2Y8GA 4CHJA 2K2UA 5J3TA 2YS1A 2X18A 2CRFA 4YONA 4HAUB 2RUKB 5FI1A 2J0JA 1BWNA 1Q67A 3PG7A 5DH9B 2ELBA 5D27A 2GCJA 5C6RA 4HAVB 1TJ6A 5HE2A 4Z2NA 1XCGA 4MT7A 4DXAB 4GMXB 2I1KA 2NMBA 1W1GA 1BAKA 1H4RA 2M14A 2Q13A 2RLOA 4P7IA 1DDMA 1NTVA 1X11A 1X05A 2JP2A 1UEFA 4F7HA 1UNRA 1WVHA 2HTHB 2W2XC 3TO1A 2XQNM 1ISNA 3TCAA 2DX5A 2GS0A 2KUPA 3BJIA 4HB3B 3DXEA 3PVWA 2YS3A 1BTKA 4ZRKA 3KZ1A 3CXBB 1BTNA 1DROA 4HAXB 1J19A 5C5BB 2VRWB 1MKEA 4NSWA 2R0DA 5J3QA 3KRXA 2GJYA 3ULBA 1V5PA 2LKOA 3SYXA 2ROZB 2RNRB 4WJ7A 2MFQA 2KGXB 1V89A 5LOPB 4HB0B 2UVMA 1J0WA 3N7CA 1IRSA 4GZUA 3M1IB 1WGQA 3P7ZA 4K2PA 2DHIA 3ODWA 1E5WA 2DHJA 1U29A 5DHAB 3WYFB 2KCJA 2YT0A 2CODA 3G9WA 1FHXA 5D3VA 1WJ1A 1DYNA 4MY6A 3A98B 1V88A 1XX0A 2OQBA 2DN6A 1RJ2A 3GYPA 2YS5A 1WG7A 3PZDA 5GOWB 2P8VA 3SNHA 1SHCA 3OANA 1ZC3B 3A8QA 1UNPA 2VSZA 1KI1B 3GYOA 3PP2A 3BINA 2RGNB 2LYDA 1MIXA 5EFXA 1Z87A 5JHGA 2H7EA 3ZVRA 3MPXA 1U5EA 2YF0A 4A6FA 4ZRJA 1U2BA 2D4QA 3V5WA 2J59M 1P3RA 1KZ7A 1RRPB 4TKNA 4GN1A 3PVLA 1V61A 2PZ1A 2D9XA 3D8FA 4K17A 1P5TA 4HAYB 5KCVA 1DDWA 1I7AA 1MPHA 2G35A 1WI1A 1NI2A 1GG3A 2N23A 1ZVRA 1GC7A 1FOEA 3HW2B 2IYBA 5L81A 3D8DA 3DXDA 1M7EA 4IFSA 2Y8FA 4HDOA 2HE7A 1X86A 3PEGA 5DHFB 2DHKA 4K2OA 3RCPA 5HE3A 2P0FA 1XD4A 2CY4A 3KSYA 2D11A 1AQCA 3KY9A 4B6HA 1EF1A 1PLSA 4MK0A 5KQ4A 3F5RA 2CAYA 2E2XA 4DBBA 1GC6A 3SUZA 4A5KA 4D0NB 5DIFB 2MKRA 2I5CA 3DXCA 2DA0A 2DKPA 2UZRA 1FGZA 1W1HA 2YVCA 5HE0A 1NU2A 3TFMA 5C79A 1I2HA 2ADZA 2COFA 4WSFA 4KHBB 2MWNB 3NSUA 4KHAA 2Z0QA 3X23A 3MDBC 3IVFA 5CLLB 4WVFB 3ZDTA 5LONB 2D9YA 5J3YA 3SV1A 4CYEA 1FHWA 2BCJA 1UPRA 5HE1A 4Z2MB 4GPTB 2IFSA 3FM8C 1K5GB 4HB2B 1ZC4B 1B55A 2D9ZA 2J0MA 2YRYA 1OMWA 2DYQA 4L6EA 1MK9B 2V76A 4CHMA 2YT1A 1N3HA 4EMOA 4YL8A 4Y94A 1FGYA 2COAA 3VIAA 5C16A 4NY0A 3ODOA 4HAWB 5D3WA 1MIZB 1UPQA 3P6AA 2K2JA 3ULCA 1WJMA 4PNKA 1ZSQA 2DX1A 2Y7BA 5DI9B 3AU4A 4KVGB 5D3YA 4GXBA 1XODA 5JHHA 2GCLA 1V5UA 1FHOA 1MK7B 2D9WA 3AU5A 2EJ8A 1Y19B 5FI0A 1OY2A 4H8SA 1H10A 2LULA
chains in the Genus database with same CATH superfamily
2QKLA 4GOUA 3UZTA 5C5BA 1PFJA 3U7DA 2M38A 1SGHA 2OTXA 2D9VA 3HQCA 2DYNA 4C0AA 1FB8A 2ZPYA 3ODXA 2YSZA 3U12A 4F7GA 1U27A 2DFKA 1U5DA 4F7UP 2LOXA 3TW1A 2Z14A 1X1GA 3FEHA 3WA0A 1QC6A 1ZM0A 3TVVA 2L1CA 4HB4B 4DX90 2L2IA 2W2WA 4A6KA 3ML4A 4GMVA 4HDQA 1LW3A 2ELAA 4DX8A 1EAZA 3AJ4A 5KQ1A 3A8PA 3VOQA 1K5DB 1TXDA 3PSCA 4A6FB 2DTCA 5JP4A 2GUMA 4KAXB 5CLQB 2AL6A 2MDXA 4PQ0A 2I5FA 2EMSA 2K49A 3HIEA 2R09A 2AEHA 3QWMA 3QBVB 3HK0A 5JLJB 3KRWA 2Z0OA 1LB1A 1X1FA 2P0DA 4HAZB 3O96A 4IAPA 2Z13A 1XKEA 4IOYX 4ZRIA 1FAOA 2VKIA 3NWDA 3HSAA 3T06A 4EKUA 1UNQA 2H7DA 3QIJA 1Y5OA 2D10A 2D2QA 2N0YA 2NZ8B 3F0WA 1EVHA 3LJUX 2EMTA 1TQZA 4TYZA 1AWEA 2LOZA 3FSSA 2QKMA 3PVUA 2ROVA 4EJNA 4XWXA 1DBHA 3U8ZA 2RVBB 2J0KA 2RSGA 5D3XA 3SO6A 1U5FA 1XR0B 2FJLA 2UZSA 1NTYA 2KR0A 3D8EA 1DDVA 1M7RA 1W1DA 2DLWA 1MI1A 4K81A 1U5GA 4A6HA 2EC1A 2I1JA 2KIGA 2LG1A 2P0HA 1MAIA 4HHVA 1KZGA 1QQGA 4KHOA 2K00A 2DKQA 1EGXA 2Z0PA 2W2XD 2CY5A 1WGUA 4BBKA 1V5MA 3CIKA 1P6SA 1PMSA 4HATB 1OQNA 3DCXA 2Y8GA 2Z4DA 4CHJA 2K2UA 5J3TA 2YS1A 2X18A 2ZKMX 2CRFA 4YONA 4HAUB 2RUKB 5FI1A 2J0JA 1BWNA 1Q67A 3PG7A 5DH9B 2ELBA 5D27A 2GCJA 5C6RA 4HAVB 1TJ6A 5HE2A 4Z2NA 4OT1A 1XCGA 4KHBA 4MT7A 4DXAB 4GMXB 2I1KA 2NMBA 1W1GA 1BAKA 1H4RA 2M14A 2R2YA 2Q13A 2RLOA 4P7IA 1DDMA 1NTVA 1X11A 1X05A 2JP2A 1UEFA 4F7HA 1UNRA 2NBVA 1WVHA 2HTHB 2W2XC 3TO1A 2XQNM 1ISNA 3TCAA 4QJ4B 2DX5A 2GS0A 2KUPA 3BJIA 4HB3B 3DXEA 3PVWA 2YS3A 1BTKA 4ZRKA 3CXBB 3KZ1A 1BTNA 1DROA 5I2MA 4HAXB 1J19A 5C5BB 2VRWB 1MKEA 4NSWA 4DIXA 2R0DA 5J3QA 3KRXA 2GJYA 3ULBA 1V5PA 2LKOA 3SYXA 2ROZB 2RNRB 2RRFA 4WJ7A 2MFQA 2KGXB 1V89A 5LOPB 4HB0B 2K8EA 2UVMA 1J0WA 3N7CA 1IRSA 4GZUA 3M1IB 1WGQA 3P7ZA 4K2PA 3B77A 2DHIA 3ODWA 1E5WA 2KUQA 4GNKB 2DHJA 4L1RA 4QJ3B 1U29A 5DHAB 3WYFB 2KCJA 2YT0A 2CODA 3G9WA 1FHXA 5D3VA 1WJ1A 1DYNA 4MY6A 3NWAA 3A98B 1V88A 1XX0A 2OQBA 2DN6A 1RJ2A 3GYPA 2YS5A 1WG7A 3PZDA 5GOWB 2P8VA 3SNHA 1SHCA 3OANA 1ZC3B 3A8QA 1UNPA 2VSZA 1KI1B 3GYOA 3PP2A 3BINA 2RGNB 2LYDA 1MIXA 5EFXA 1Z87A 2LULA 5JHGA 2H7EA 3ZVRA 3MPXA 1U5EA 2YF0A 4A6FA 4ZRJA 3FVCA 1U2BA 2D4QA 3V5WA 2J59M 1P3RA 1KZ7A 1RRPB 4TKNA 4GN1A 3PVLA 1V61A 2PZ1A 2D9XA 3D8FA 3A58A 4K17A 1P5TA 4HAYB 5KCVA 1DDWA 1I7AA 1MPHA 2G35A 1WI1A 1NI2A 1GG3A 2N23A 1ZVRA 1GC7A 1FOEA 3HW2B 2IYBA 5L81A 3D8DA 3DXDA 1M7EA 4IFSA 2Y8FA 4CSQA 4HDOA 2HE7A 1X86A 3PEGA 5DHFB 4HSIA 2DHKA 4K2OA 3RCPA 5HE3A 5I2SA 2P0FA 1XD4A 2CY4A 3KSYA 2D11A 1AQCA 3KY9A 4B6HA 4QJ5B 5LG4B 1EF1A 1PLSA 4MK0A 2KIEA 5KQ4A 3F5RA 2CAYA 2E2XA 4DBBA 1GC6A 3SUZA 4A5KA 4D0NB 5DIFB 1T77A 5IRSA 2MKRA 2I5CA 3DXCA 2DA0A 2DKPA 2UZRA 1FGZA 1W1HA 2YVCA 5HE0A 1NU2A 3TFMA 4OSNA 5C79A 1I2HA 2ADZA 2COFA 4WSFA 4KHBB 2YT2A 2MWNB 3NSUA 4KHAA 2Z0QA 4D6WA 3X23A 3MDBC 3IVFA 5CLLB 4WVFB 3ZDTA 5LONB 3NW8A 2D9YA 1ZYIA 5J3YA 3SV1A 2Z59A 4CYEA 1FHWA 2BCJA 1UPRA 5HE1A 4Z2MB 4GPTB 2IFSA 3FM8C 1K5GB 4HB2B 1ZC4B 1B55A 2D9ZA 3OHMB 2J0MA 2YRYA 3NWFA 1OMWA 2DYQA 4L6EA 1MK9B 2V76A 4CHMA 2YT1A 1N3HA 4EMOA 4YL8A 4Y94A 1FGYA 2COAA 3VIAA 5C16A 4NY0A 3ODOA 4HAWB 5D3WA 1MIZB 1UPQA 3P6AA 2K2JA 3ULCA 1WJMA 4PNKA 1ZSQA 2DX1A 2Y7BA 5DI9B 3AU4A 2FJUB 4KVGB 4QXAB 5D3YA 5M4YB 4GXBA 1XODA 5JHHA 2GCLA 1V5UA 1FHOA 1MK7B 2D9WA 3AU5A 2EJ8A 1Y19B 5FI0A 1OY2A 4H8SA 1H10A 2COCA
chains in the Genus database with same CATH topology
2QKLA 3UZTA 5C5BA 1PFJA 3U7DA 2M38A 1SGHA 2OTXA 2D9VA 3HQCA 2DYNA 4C0AA 1FB8A 2ZPYA 3ODXA 2YSZA 4F7GA 1U27A 2DFKA 1U5DA 4F7UP 2LOXA 3TW1A 1X1GA 3FEHA 3WA0A 1QC6A 1ZM0A 3TVVA 2L1CA 4HB4B 4DX90 2L2IA 2W2WA 2COCA 4A6KA 3ML4A 4GMVA 4HDQA 1LW3A 2ELAA 4DX8A 1EAZA 3AJ4A 5KQ1A 3A8PA 3VOQA 1K5DB 1TXDA 3PSCA 4A6FB 2DTCA 5JP4A 4KAXB 5CLQB 2AL6A 2MDXA 4PQ0A 2I5FA 2EMSA 2R09A 2AEHA 3QWMA 3QBVB 3HK0A 5JLJB 3KRWA 2Z0OA 1LB1A 1X1FA 2P0DA 4HAZB 3O96A 4IAPA 1XKEA 4IOYX 4ZRIA 1FAOA 2VKIA 3T06A 4EKUA 1UNQA 2H7DA 3QIJA 1Y5OA 2D10A 2D2QA 2N0YA 2NZ8B 3F0WA 1EVHA 3LJUX 2EMTA 1TQZA 4TYZA 1AWEA 2LOZA 3FSSA 2QKMA 3PVUA 2ROVA 4EJNA 4XWXA 1DBHA 3U8ZA 2RVBB 2J0KA 2RSGA 5D3XA 3SO6A 1U5FA 1XR0B 2FJLA 2UZSA 1NTYA 3D8EA 1DDVA 1M7RA 1W1DA 2DLWA 4K81A 4A6HA 1U5GA 2EC1A 2I1JA 2LG1A 2P0HA 1MAIA 4HHVA 1KZGA 1QQGA 4KHOA 2K00A 2DKQA 1EGXA 2Z0PA 2W2XD 2CY5A 1WGUA 4BBKA 1V5MA 3CIKA 1P6SA 1PMSA 4HATB 1OQNA 2Y8GA 4CHJA 2K2UA 5J3TA 2YS1A 2X18A 2CRFA 4YONA 4HAUB 2RUKB 5FI1A 2J0JA 1BWNA 1Q67A 3PG7A 5DH9B 2ELBA 5D27A 2GCJA 5C6RA 4HAVB 1TJ6A 5HE2A 4Z2NA 1XCGA 4MT7A 4DXAB 4GMXB 2I1KA 2NMBA 1W1GA 1BAKA 1H4RA 2M14A 2Q13A 2RLOA 4P7IA 1DDMA 1NTVA 1X11A 1X05A 2JP2A 1UEFA 4F7HA 1UNRA 1WVHA 2HTHB 2W2XC 3TO1A 2XQNM 1ISNA 3TCAA 2DX5A 2GS0A 2KUPA 3BJIA 4HB3B 3DXEA 3PVWA 2YS3A 1BTKA 4ZRKA 3KZ1A 3CXBB 1BTNA 1DROA 4HAXB 1J19A 5C5BB 2VRWB 1MKEA 4NSWA 2R0DA 5J3QA 3KRXA 2GJYA 3ULBA 1V5PA 2LKOA 3SYXA 2ROZB 2RNRB 4WJ7A 2MFQA 2KGXB 1V89A 5LOPB 4HB0B 2UVMA 1J0WA 3N7CA 1IRSA 4GZUA 3M1IB 1WGQA 3P7ZA 4K2PA 2DHIA 3ODWA 1E5WA 2DHJA 1U29A 5DHAB 3WYFB 2KCJA 2YT0A 2CODA 3G9WA 1FHXA 5D3VA 1WJ1A 1DYNA 4MY6A 3A98B 1V88A 1XX0A 2OQBA 2DN6A 1RJ2A 3GYPA 2YS5A 1WG7A 3PZDA 5GOWB 2P8VA 3SNHA 1SHCA 3OANA 1ZC3B 3A8QA 1UNPA 2VSZA 1KI1B 3GYOA 3PP2A 3BINA 2RGNB 2LYDA 1MIXA 5EFXA 1Z87A 5JHGA 2H7EA 3ZVRA 3MPXA 1U5EA 2YF0A 4A6FA 4ZRJA 1U2BA 2D4QA 3V5WA 2J59M 1P3RA 1KZ7A 1RRPB 4TKNA 4GN1A 3PVLA 1V61A 2PZ1A 2D9XA 3D8FA 4K17A 1P5TA 4HAYB 5KCVA 1DDWA 1I7AA 1MPHA 2G35A 1WI1A 1NI2A 1GG3A 2N23A 1ZVRA 1GC7A 1FOEA 3HW2B 2IYBA 5L81A 3D8DA 3DXDA 1M7EA 4IFSA 2Y8FA 4HDOA 2HE7A 1X86A 3PEGA 5DHFB 2DHKA 4K2OA 3RCPA 5HE3A 2P0FA 1XD4A 2CY4A 3KSYA 2D11A 1AQCA 3KY9A 4B6HA 1EF1A 1PLSA 4MK0A 5KQ4A 3F5RA 2CAYA 2E2XA 4DBBA 1GC6A 3SUZA 4A5KA 4D0NB 5DIFB 2MKRA 2I5CA 3DXCA 2DA0A 2DKPA 2UZRA 1FGZA 1W1HA 2YVCA 5HE0A 1NU2A 3TFMA 5C79A 1I2HA 2ADZA 2COFA 4WSFA 4KHBB 2MWNB 3NSUA 4KHAA 2Z0QA 3X23A 3MDBC 3IVFA 5CLLB 4WVFB 3ZDTA 5LONB 2D9YA 5J3YA 3SV1A 4CYEA 1FHWA 2BCJA 1UPRA 5HE1A 4Z2MB 4GPTB 2IFSA 3FM8C 1K5GB 4HB2B 1ZC4B 1B55A 2D9ZA 2J0MA 2YRYA 1OMWA 2DYQA 4L6EA 1MK9B 2V76A 4CHMA 2YT1A 1N3HA 4EMOA 4YL8A 4Y94A 1FGYA 2COAA 3VIAA 5C16A 4NY0A 3ODOA 4HAWB 5D3WA 1MIZB 1UPQA 3P6AA 2K2JA 3ULCA 1WJMA 4PNKA 1ZSQA 2DX1A 2Y7BA 5DI9B 3AU4A 4KVGB 5D3YA 4GXBA 1XODA 5JHHA 2GCLA 1V5UA 1FHOA 1MK7B 2D9WA 3AU5A 2EJ8A 1Y19B 5FI0A 1OY2A 4H8SA 1H10A 2LULA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QKL A;  3UZT A;  5C5B A;  1PFJ A;  3U7D A;  2M38 A;  1SGH A;  2OTX A;  2D9V A;  3HQC A;  2DYN A;  4C0A A;  1FB8 A;  2ZPY A;  3ODX A;  2YSZ A;  4F7G A;  1U27 A;  2DFK A;  1U5D A;  4F7U P;  2LOX A;  3TW1 A;  1X1G A;  3FEH A;  3WA0 A;  1QC6 A;  1ZM0 A;  3TVV A;  2L1C A;  4HB4 B;  4DX9 0;  2L2I A;  2W2W A;  2COC A;  4A6K A;  3ML4 A;  4GMV A;  4HDQ A;  1LW3 A;  2ELA A;  4DX8 A;  1EAZ A;  3AJ4 A;  5KQ1 A;  3A8P A;  3VOQ A;  1K5D B;  1TXD A;  3PSC A;  4A6F B;  2DTC A;  5JP4 A;  4KAX B;  5CLQ B;  2AL6 A;  2MDX A;  4PQ0 A;  2I5F A;  2EMS A;  2R09 A;  2AEH A;  3QWM A;  3QBV B;  3HK0 A;  5JLJ B;  3KRW A;  2Z0O A;  1LB1 A;  1X1F A;  2P0D A;  4HAZ B;  3O96 A;  4IAP A;  1XKE A;  4IOY X;  4ZRI A;  1FAO A;  2VKI A;  3T06 A;  4EKU A;  1UNQ A;  2H7D A;  3QIJ A;  1Y5O A;  2D10 A;  2D2Q A;  2N0Y A;  2NZ8 B;  3F0W A;  1EVH A;  3LJU X;  2EMT A;  1TQZ A;  4TYZ A;  1AWE A;  2LOZ A;  3FSS A;  2QKM A;  3PVU A;  2ROV A;  4EJN A;  4XWX A;  1DBH A;  3U8Z A;  2RVB B;  2J0K A;  2RSG A;  5D3X A;  3SO6 A;  1U5F A;  1XR0 B;  2FJL A;  2UZS A;  1NTY A;  3D8E A;  1DDV A;  1M7R A;  1W1D A;  2DLW A;  4K81 A;  4A6H A;  1U5G A;  2EC1 A;  2I1J A;  2LG1 A;  2P0H A;  1MAI A;  4HHV A;  1KZG A;  1QQG A;  4KHO A;  2K00 A;  2DKQ A;  1EGX A;  2Z0P A;  2W2X D;  2CY5 A;  1WGU A;  4BBK A;  1V5M A;  3CIK A;  1P6S A;  1PMS A;  4HAT B;  1OQN A;  2Y8G A;  4CHJ A;  2K2U A;  5J3T A;  2YS1 A;  2X18 A;  2CRF A;  4YON A;  4HAU B;  2RUK B;  5FI1 A;  2J0J A;  1BWN A;  1Q67 A;  3PG7 A;  5DH9 B;  2ELB A;  5D27 A;  2GCJ A;  5C6R A;  4HAV B;  1TJ6 A;  5HE2 A;  4Z2N A;  1XCG A;  4MT7 A;  4DXA B;  4GMX B;  2I1K A;  2NMB A;  1W1G A;  1BAK A;  1H4R A;  2M14 A;  2Q13 A;  2RLO A;  4P7I A;  1DDM A;  1NTV A;  1X11 A;  1X05 A;  2JP2 A;  1UEF A;  4F7H A;  1UNR A;  1WVH A;  2HTH B;  2W2X C;  3TO1 A;  2XQN M;  1ISN A;  3TCA A;  2DX5 A;  2GS0 A;  2KUP A;  3BJI A;  4HB3 B;  3DXE A;  3PVW A;  2YS3 A;  1BTK A;  4ZRK A;  3KZ1 A;  3CXB B;  1BTN A;  1DRO A;  4HAX B;  1J19 A;  5C5B B;  2VRW B;  1MKE A;  4NSW A;  2R0D A;  5J3Q A;  3KRX A;  2GJY A;  3ULB A;  1V5P A;  2LKO A;  3SYX A;  2ROZ B;  2RNR B;  4WJ7 A;  2MFQ A;  2KGX B;  1V89 A;  5LOP B;  4HB0 B;  2UVM A;  1J0W A;  3N7C A;  1IRS A;  4GZU A;  3M1I B;  1WGQ A;  3P7Z A;  4K2P A;  2DHI A;  3ODW A;  1E5W A;  2DHJ A;  1U29 A;  5DHA B;  3WYF B;  2KCJ A;  2YT0 A;  2COD A;  3G9W A;  1FHX A;  5D3V A;  1WJ1 A;  1DYN A;  4MY6 A;  3A98 B;  1V88 A;  1XX0 A;  2OQB A;  2DN6 A;  1RJ2 A;  3GYP A;  2YS5 A;  1WG7 A;  3PZD A;  5GOW B;  2P8V A;  3SNH A;  1SHC A;  3OAN A;  1ZC3 B;  3A8Q A;  1UNP A;  2VSZ A;  1KI1 B;  3GYO A;  3PP2 A;  3BIN A;  2RGN B;  2LYD A;  1MIX A;  5EFX A;  1Z87 A;  5JHG A;  2H7E A;  3ZVR A;  3MPX A;  1U5E A;  2YF0 A;  4A6F A;  4ZRJ A;  1U2B A;  2D4Q A;  3V5W A;  2J59 M;  1P3R A;  1KZ7 A;  1RRP B;  4TKN A;  4GN1 A;  3PVL A;  1V61 A;  2PZ1 A;  2D9X A;  3D8F A;  4K17 A;  1P5T A;  4HAY B;  5KCV A;  1DDW A;  1I7A A;  1MPH A;  2G35 A;  1WI1 A;  1NI2 A;  1GG3 A;  2N23 A;  1ZVR A;  1GC7 A;  1FOE A;  3HW2 B;  2IYB A;  5L81 A;  3D8D A;  3DXD A;  1M7E A;  4IFS A;  2Y8F A;  4HDO A;  2HE7 A;  1X86 A;  3PEG A;  5DHF B;  2DHK A;  4K2O A;  3RCP A;  5HE3 A;  2P0F A;  1XD4 A;  2CY4 A;  3KSY A;  2D11 A;  1AQC A;  3KY9 A;  4B6H A;  1EF1 A;  1PLS A;  4MK0 A;  5KQ4 A;  3F5R A;  2CAY A;  2E2X A;  4DBB A;  1GC6 A;  3SUZ A;  4A5K A;  4D0N B;  5DIF B;  2MKR A;  2I5C A;  3DXC A;  2DA0 A;  2DKP A;  2UZR A;  1FGZ A;  1W1H A;  2YVC A;  5HE0 A;  1NU2 A;  3TFM A;  5C79 A;  1I2H A;  2ADZ A;  2COF A;  4WSF A;  4KHB B;  2MWN B;  3NSU A;  4KHA A;  2Z0Q A;  3X23 A;  3MDB C;  3IVF A;  5CLL B;  4WVF B;  3ZDT A;  5LON B;  2D9Y A;  5J3Y A;  3SV1 A;  4CYE A;  1FHW A;  2BCJ A;  1UPR A;  5HE1 A;  4Z2M B;  4GPT B;  2IFS A;  3FM8 C;  1K5G B;  4HB2 B;  1ZC4 B;  1B55 A;  2D9Z A;  2J0M A;  2YRY A;  1OMW A;  2DYQ A;  4L6E A;  1MK9 B;  2V76 A;  4CHM A;  2YT1 A;  1N3H A;  4EMO A;  4YL8 A;  4Y94 A;  1FGY A;  2COA A;  3VIA A;  5C16 A;  4NY0 A;  3ODO A;  4HAW B;  5D3W A;  1MIZ B;  1UPQ A;  3P6A A;  2K2J A;  3ULC A;  1WJM A;  4PNK A;  1ZSQ A;  2DX1 A;  2Y7B A;  5DI9 B;  3AU4 A;  4KVG B;  5D3Y A;  4GXB A;  1XOD A;  5JHH A;  2GCL A;  1V5U A;  1FHO A;  1MK7 B;  2D9W A;  3AU5 A;  2EJ8 A;  1Y19 B;  5FI0 A;  1OY2 A;  4H8S A;  1H10 A;  2LUL A; 
#chains in the Genus database with same CATH topology
 2QKL A;  4GOU A;  3UZT A;  5C5B A;  1PFJ A;  3U7D A;  2M38 A;  1SGH A;  2OTX A;  2D9V A;  3HQC A;  2DYN A;  4C0A A;  1FB8 A;  2ZPY A;  3ODX A;  2YSZ A;  3U12 A;  4F7G A;  1U27 A;  2DFK A;  1U5D A;  4F7U P;  2LOX A;  3TW1 A;  2Z14 A;  1X1G A;  3FEH A;  3WA0 A;  1QC6 A;  1ZM0 A;  3TVV A;  2L1C A;  4HB4 B;  4DX9 0;  2L2I A;  2W2W A;  4A6K A;  3ML4 A;  4GMV A;  4HDQ A;  1LW3 A;  2ELA A;  4DX8 A;  1EAZ A;  3AJ4 A;  5KQ1 A;  3A8P A;  3VOQ A;  1K5D B;  1TXD A;  3PSC A;  4A6F B;  2DTC A;  5JP4 A;  2GUM A;  4KAX B;  5CLQ B;  2AL6 A;  2MDX A;  4PQ0 A;  2I5F A;  2EMS A;  2K49 A;  3HIE A;  2R09 A;  2AEH A;  3QWM A;  3QBV B;  3HK0 A;  5JLJ B;  3KRW A;  2Z0O A;  1LB1 A;  1X1F A;  2P0D A;  4HAZ B;  3O96 A;  4IAP A;  2Z13 A;  1XKE A;  4IOY X;  4ZRI A;  1FAO A;  2VKI A;  3NWD A;  3HSA A;  3T06 A;  4EKU A;  1UNQ A;  2H7D A;  3QIJ A;  1Y5O A;  2D10 A;  2D2Q A;  2N0Y A;  2NZ8 B;  3F0W A;  1EVH A;  3LJU X;  2EMT A;  1TQZ A;  4TYZ A;  1AWE A;  2LOZ A;  3FSS A;  2QKM A;  3PVU A;  2ROV A;  4EJN A;  4XWX A;  1DBH A;  3U8Z A;  2RVB B;  2J0K A;  2RSG A;  5D3X A;  3SO6 A;  1U5F A;  1XR0 B;  2FJL A;  2UZS A;  1NTY A;  2KR0 A;  3D8E A;  1DDV A;  1M7R A;  1W1D A;  2DLW A;  1MI1 A;  4K81 A;  1U5G A;  4A6H A;  2EC1 A;  2I1J A;  2KIG A;  2LG1 A;  2P0H A;  1MAI A;  4HHV A;  1KZG A;  1QQG A;  4KHO A;  2K00 A;  2DKQ A;  1EGX A;  2Z0P A;  2W2X D;  2CY5 A;  1WGU A;  4BBK A;  1V5M A;  3CIK A;  1P6S A;  1PMS A;  4HAT B;  1OQN A;  3DCX A;  2Y8G A;  2Z4D A;  4CHJ A;  2K2U A;  5J3T A;  2YS1 A;  2X18 A;  2ZKM X;  2CRF A;  4YON A;  4HAU B;  2RUK B;  5FI1 A;  2J0J A;  1BWN A;  1Q67 A;  3PG7 A;  5DH9 B;  2ELB A;  5D27 A;  2GCJ A;  5C6R A;  4HAV B;  1TJ6 A;  5HE2 A;  4Z2N A;  4OT1 A;  1XCG A;  4KHB A;  4MT7 A;  4DXA B;  4GMX B;  2I1K A;  2NMB A;  1W1G A;  1BAK A;  1H4R A;  2M14 A;  2R2Y A;  2Q13 A;  2RLO A;  4P7I A;  1DDM A;  1NTV A;  1X11 A;  1X05 A;  2JP2 A;  1UEF A;  4F7H A;  1UNR A;  2NBV A;  1WVH A;  2HTH B;  2W2X C;  3TO1 A;  2XQN M;  1ISN A;  3TCA A;  4QJ4 B;  2DX5 A;  2GS0 A;  2KUP A;  3BJI A;  4HB3 B;  3DXE A;  3PVW A;  2YS3 A;  1BTK A;  4ZRK A;  3CXB B;  3KZ1 A;  1BTN A;  1DRO A;  5I2M A;  4HAX B;  1J19 A;  5C5B B;  2VRW B;  1MKE A;  4NSW A;  4DIX A;  2R0D A;  5J3Q A;  3KRX A;  2GJY A;  3ULB A;  1V5P A;  2LKO A;  3SYX A;  2ROZ B;  2RNR B;  2RRF A;  4WJ7 A;  2MFQ A;  2KGX B;  1V89 A;  5LOP B;  4HB0 B;  2K8E A;  2UVM A;  1J0W A;  3N7C A;  1IRS A;  4GZU A;  3M1I B;  1WGQ A;  3P7Z A;  4K2P A;  3B77 A;  2DHI A;  3ODW A;  1E5W A;  2KUQ A;  4GNK B;  2DHJ A;  4L1R A;  4QJ3 B;  1U29 A;  5DHA B;  3WYF B;  2KCJ A;  2YT0 A;  2COD A;  3G9W A;  1FHX A;  5D3V A;  1WJ1 A;  1DYN A;  4MY6 A;  3NWA A;  3A98 B;  1V88 A;  1XX0 A;  2OQB A;  2DN6 A;  1RJ2 A;  3GYP A;  2YS5 A;  1WG7 A;  3PZD A;  5GOW B;  2P8V A;  3SNH A;  1SHC A;  3OAN A;  1ZC3 B;  3A8Q A;  1UNP A;  2VSZ A;  1KI1 B;  3GYO A;  3PP2 A;  3BIN A;  2RGN B;  2LYD A;  1MIX A;  5EFX A;  1Z87 A;  2LUL A;  5JHG A;  2H7E A;  3ZVR A;  3MPX A;  1U5E A;  2YF0 A;  4A6F A;  4ZRJ A;  3FVC A;  1U2B A;  2D4Q A;  3V5W A;  2J59 M;  1P3R A;  1KZ7 A;  1RRP B;  4TKN A;  4GN1 A;  3PVL A;  1V61 A;  2PZ1 A;  2D9X A;  3D8F A;  3A58 A;  4K17 A;  1P5T A;  4HAY B;  5KCV A;  1DDW A;  1I7A A;  1MPH A;  2G35 A;  1WI1 A;  1NI2 A;  1GG3 A;  2N23 A;  1ZVR A;  1GC7 A;  1FOE A;  3HW2 B;  2IYB A;  5L81 A;  3D8D A;  3DXD A;  1M7E A;  4IFS A;  2Y8F A;  4CSQ A;  4HDO A;  2HE7 A;  1X86 A;  3PEG A;  5DHF B;  4HSI A;  2DHK A;  4K2O A;  3RCP A;  5HE3 A;  5I2S A;  2P0F A;  1XD4 A;  2CY4 A;  3KSY A;  2D11 A;  1AQC A;  3KY9 A;  4B6H A;  4QJ5 B;  5LG4 B;  1EF1 A;  1PLS A;  4MK0 A;  2KIE A;  5KQ4 A;  3F5R A;  2CAY A;  2E2X A;  4DBB A;  1GC6 A;  3SUZ A;  4A5K A;  4D0N B;  5DIF B;  1T77 A;  5IRS A;  2MKR A;  2I5C A;  3DXC A;  2DA0 A;  2DKP A;  2UZR A;  1FGZ A;  1W1H A;  2YVC A;  5HE0 A;  1NU2 A;  3TFM A;  4OSN A;  5C79 A;  1I2H A;  2ADZ A;  2COF A;  4WSF A;  4KHB B;  2YT2 A;  2MWN B;  3NSU A;  4KHA A;  2Z0Q A;  4D6W A;  3X23 A;  3MDB C;  3IVF A;  5CLL B;  4WVF B;  3ZDT A;  5LON B;  3NW8 A;  2D9Y A;  1ZYI A;  5J3Y A;  3SV1 A;  2Z59 A;  4CYE A;  1FHW A;  2BCJ A;  1UPR A;  5HE1 A;  4Z2M B;  4GPT B;  2IFS A;  3FM8 C;  1K5G B;  4HB2 B;  1ZC4 B;  1B55 A;  2D9Z A;  3OHM B;  2J0M A;  2YRY A;  3NWF A;  1OMW A;  2DYQ A;  4L6E A;  1MK9 B;  2V76 A;  4CHM A;  2YT1 A;  1N3H A;  4EMO A;  4YL8 A;  4Y94 A;  1FGY A;  2COA A;  3VIA A;  5C16 A;  4NY0 A;  3ODO A;  4HAW B;  5D3W A;  1MIZ B;  1UPQ A;  3P6A A;  2K2J A;  3ULC A;  1WJM A;  4PNK A;  1ZSQ A;  2DX1 A;  2Y7B A;  5DI9 B;  3AU4 A;  2FJU B;  4KVG B;  4QXA B;  5D3Y A;  5M4Y B;  4GXB A;  1XOD A;  5JHH A;  2GCL A;  1V5U A;  1FHO A;  1MK7 B;  2D9W A;  3AU5 A;  2EJ8 A;  1Y19 B;  5FI0 A;  1OY2 A;  4H8S A;  1H10 A;  2COC A; 
#chains in the Genus database with same CATH homology
 2QKL A;  3UZT A;  5C5B A;  1PFJ A;  3U7D A;  2M38 A;  1SGH A;  2OTX A;  2D9V A;  3HQC A;  2DYN A;  4C0A A;  1FB8 A;  2ZPY A;  3ODX A;  2YSZ A;  4F7G A;  1U27 A;  2DFK A;  1U5D A;  4F7U P;  2LOX A;  3TW1 A;  1X1G A;  3FEH A;  3WA0 A;  1QC6 A;  1ZM0 A;  3TVV A;  2L1C A;  4HB4 B;  4DX9 0;  2L2I A;  2W2W A;  2COC A;  4A6K A;  3ML4 A;  4GMV A;  4HDQ A;  1LW3 A;  2ELA A;  4DX8 A;  1EAZ A;  3AJ4 A;  5KQ1 A;  3A8P A;  3VOQ A;  1K5D B;  1TXD A;  3PSC A;  4A6F B;  2DTC A;  5JP4 A;  4KAX B;  5CLQ B;  2AL6 A;  2MDX A;  4PQ0 A;  2I5F A;  2EMS A;  2R09 A;  2AEH A;  3QWM A;  3QBV B;  3HK0 A;  5JLJ B;  3KRW A;  2Z0O A;  1LB1 A;  1X1F A;  2P0D A;  4HAZ B;  3O96 A;  4IAP A;  1XKE A;  4IOY X;  4ZRI A;  1FAO A;  2VKI A;  3T06 A;  4EKU A;  1UNQ A;  2H7D A;  3QIJ A;  1Y5O A;  2D10 A;  2D2Q A;  2N0Y A;  2NZ8 B;  3F0W A;  1EVH A;  3LJU X;  2EMT A;  1TQZ A;  4TYZ A;  1AWE A;  2LOZ A;  3FSS A;  2QKM A;  3PVU A;  2ROV A;  4EJN A;  4XWX A;  1DBH A;  3U8Z A;  2RVB B;  2J0K A;  2RSG A;  5D3X A;  3SO6 A;  1U5F A;  1XR0 B;  2FJL A;  2UZS A;  1NTY A;  3D8E A;  1DDV A;  1M7R A;  1W1D A;  2DLW A;  4K81 A;  4A6H A;  1U5G A;  2EC1 A;  2I1J A;  2LG1 A;  2P0H A;  1MAI A;  4HHV A;  1KZG A;  1QQG A;  4KHO A;  2K00 A;  2DKQ A;  1EGX A;  2Z0P A;  2W2X D;  2CY5 A;  1WGU A;  4BBK A;  1V5M A;  3CIK A;  1P6S A;  1PMS A;  4HAT B;  1OQN A;  2Y8G A;  4CHJ A;  2K2U A;  5J3T A;  2YS1 A;  2X18 A;  2CRF A;  4YON A;  4HAU B;  2RUK B;  5FI1 A;  2J0J A;  1BWN A;  1Q67 A;  3PG7 A;  5DH9 B;  2ELB A;  5D27 A;  2GCJ A;  5C6R A;  4HAV B;  1TJ6 A;  5HE2 A;  4Z2N A;  1XCG A;  4MT7 A;  4DXA B;  4GMX B;  2I1K A;  2NMB A;  1W1G A;  1BAK A;  1H4R A;  2M14 A;  2Q13 A;  2RLO A;  4P7I A;  1DDM A;  1NTV A;  1X11 A;  1X05 A;  2JP2 A;  1UEF A;  4F7H A;  1UNR A;  1WVH A;  2HTH B;  2W2X C;  3TO1 A;  2XQN M;  1ISN A;  3TCA A;  2DX5 A;  2GS0 A;  2KUP A;  3BJI A;  4HB3 B;  3DXE A;  3PVW A;  2YS3 A;  1BTK A;  4ZRK A;  3KZ1 A;  3CXB B;  1BTN A;  1DRO A;  4HAX B;  1J19 A;  5C5B B;  2VRW B;  1MKE A;  4NSW A;  2R0D A;  5J3Q A;  3KRX A;  2GJY A;  3ULB A;  1V5P A;  2LKO A;  3SYX A;  2ROZ B;  2RNR B;  4WJ7 A;  2MFQ A;  2KGX B;  1V89 A;  5LOP B;  4HB0 B;  2UVM A;  1J0W A;  3N7C A;  1IRS A;  4GZU A;  3M1I B;  1WGQ A;  3P7Z A;  4K2P A;  2DHI A;  3ODW A;  1E5W A;  2DHJ A;  1U29 A;  5DHA B;  3WYF B;  2KCJ A;  2YT0 A;  2COD A;  3G9W A;  1FHX A;  5D3V A;  1WJ1 A;  1DYN A;  4MY6 A;  3A98 B;  1V88 A;  1XX0 A;  2OQB A;  2DN6 A;  1RJ2 A;  3GYP A;  2YS5 A;  1WG7 A;  3PZD A;  5GOW B;  2P8V A;  3SNH A;  1SHC A;  3OAN A;  1ZC3 B;  3A8Q A;  1UNP A;  2VSZ A;  1KI1 B;  3GYO A;  3PP2 A;  3BIN A;  2RGN B;  2LYD A;  1MIX A;  5EFX A;  1Z87 A;  5JHG A;  2H7E A;  3ZVR A;  3MPX A;  1U5E A;  2YF0 A;  4A6F A;  4ZRJ A;  1U2B A;  2D4Q A;  3V5W A;  2J59 M;  1P3R A;  1KZ7 A;  1RRP B;  4TKN A;  4GN1 A;  3PVL A;  1V61 A;  2PZ1 A;  2D9X A;  3D8F A;  4K17 A;  1P5T A;  4HAY B;  5KCV A;  1DDW A;  1I7A A;  1MPH A;  2G35 A;  1WI1 A;  1NI2 A;  1GG3 A;  2N23 A;  1ZVR A;  1GC7 A;  1FOE A;  3HW2 B;  2IYB A;  5L81 A;  3D8D A;  3DXD A;  1M7E A;  4IFS A;  2Y8F A;  4HDO A;  2HE7 A;  1X86 A;  3PEG A;  5DHF B;  2DHK A;  4K2O A;  3RCP A;  5HE3 A;  2P0F A;  1XD4 A;  2CY4 A;  3KSY A;  2D11 A;  1AQC A;  3KY9 A;  4B6H A;  1EF1 A;  1PLS A;  4MK0 A;  5KQ4 A;  3F5R A;  2CAY A;  2E2X A;  4DBB A;  1GC6 A;  3SUZ A;  4A5K A;  4D0N B;  5DIF B;  2MKR A;  2I5C A;  3DXC A;  2DA0 A;  2DKP A;  2UZR A;  1FGZ A;  1W1H A;  2YVC A;  5HE0 A;  1NU2 A;  3TFM A;  5C79 A;  1I2H A;  2ADZ A;  2COF A;  4WSF A;  4KHB B;  2MWN B;  3NSU A;  4KHA A;  2Z0Q A;  3X23 A;  3MDB C;  3IVF A;  5CLL B;  4WVF B;  3ZDT A;  5LON B;  2D9Y A;  5J3Y A;  3SV1 A;  4CYE A;  1FHW A;  2BCJ A;  1UPR A;  5HE1 A;  4Z2M B;  4GPT B;  2IFS A;  3FM8 C;  1K5G B;  4HB2 B;  1ZC4 B;  1B55 A;  2D9Z A;  2J0M A;  2YRY A;  1OMW A;  2DYQ A;  4L6E A;  1MK9 B;  2V76 A;  4CHM A;  2YT1 A;  1N3H A;  4EMO A;  4YL8 A;  4Y94 A;  1FGY A;  2COA A;  3VIA A;  5C16 A;  4NY0 A;  3ODO A;  4HAW B;  5D3W A;  1MIZ B;  1UPQ A;  3P6A A;  2K2J A;  3ULC A;  1WJM A;  4PNK A;  1ZSQ A;  2DX1 A;  2Y7B A;  5DI9 B;  3AU4 A;  4KVG B;  5D3Y A;  4GXB A;  1XOD A;  5JHH A;  2GCL A;  1V5U A;  1FHO A;  1MK7 B;  2D9W A;  3AU5 A;  2EJ8 A;  1Y19 B;  5FI0 A;  1OY2 A;  4H8S A;  1H10 A;  2LUL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...