5DIFB

Crystal structure of cpeb4 nes peptide in complex with crm1-ran-ranbp1
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
138
structure length
130
Chain Sequence
IHFEPVVTMEEDEEVLYKVRAKLFRFDADAKEWKERGTGDCKFLKNKKTNKVRILMRRDKTLKICANHIIAPEYTLKPNVGSDRSWVYACTADIAEGEAEAFTFAIRFGSKENADKFKEEFEKAQEINKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTP-binding nuclear protein Ran
publication title Structural determinants of nuclear export signal orientation in binding to exportin CRM1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 31
structure length 130
sequence length 138
ec nomenclature
pdb deposition date 2015-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00638 Ran_BP1 RanBP1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 5difB00
1TJ6A 1ZM0A 3SV1A 3TW1A 3WYFB 1RJ2A 1M7RA 5GOWB 1V88A 1FHWA 2DX5A 3QWMA 1XX0A 4GZUA 4EKUA 3PVWA 1J19A 2LULA 2Y7BA 1UPQA 2VRWB 1XKEA 1MIXA 2IYBA 2YS5A 4B6HA 1LB1A 3OANA 2RUKB 4HAXB 4ZRJA 4NSWA 1BTKA 2G35A 2DKQA 3MPXA 3DXDA 4HAVB 3SUZA 3KRWA 2COFA 2KCJA 2QKLA 2D9WA 3TO1A 5DH9B 3M1IB 1MKEA 1Z87A 3HK0A 2DFKA 3A8QA 3GYOA 4A5KA 3MDBC 4HB2B 4HB0B 3PP2A 3CIKA 4DXAB 5D3WA 1V5MA 3F0WA 2I1JA 2CRFA 1NI2A 3QIJA 4DX8A 1SGHA 2Y8FA 2RSGA 5DHAB 1QQGA 2MKRA 2VKIA 1WVHA 3AJ4A 5FI1A 3WA0A 2DN6A 4EMOA 3FM8C 3BJIA 2D9ZA 2MFQA 1GG3A 2UZRA 4IOYX 1FOEA 1KZ7A 2EJ8A 3D8DA 2VSZA 4HAWB 3QBVB 5JP4A 1EF1A 3DXEA 4D0NB 2CY4A 1K5GB 2YT1A 1FB8A 4KHAA 2X18A 2M38A 1U2BA 2M14A 1DDMA 1DDVA 1QC6A 3ML4A 5L81A 4KHBB 2ROVA 2D2QA 1U5EA 1X86A 2J0MA 2L1CA 4NY0A 2CAYA 2K2JA 5KCVA 1KI1B 2DHIA 3D8EA 1Y19B 1ZC3B 2W2XD 4WJ7A 4H8SA 2Q13A 5DIFB 4HDQA 1P5TA 5C5BA 2D9VA 2J59M 1PFJA 4ZRKA 1B55A 2DYNA 4K17A 3F5RA 1DYNA 2K00A 1PLSA 2CODA 2OTXA 2ZPYA 1MAIA 4TKNA 1WGQA 1M7EA 3X23A 1ZVRA 1UPRA 1U5FA 4K2PA 3SYXA 1U5GA 2CY5A 2Z0PA 5JHHA 1N3HA 1J0WA 2OQBA 1EAZA 2Z0QA 2Y8GA 4WVFB 4GXBA 2UVMA 2QKMA 1XD4A 2D10A 1OMWA 3LJUX 2FJLA 2PZ1A 2RVBB 4KAXB 2EMSA 4HAZB 1GC6A 2D4QA 4K81A 5C16A 5CLQB 4CHMA 1RRPB 2R0DA 5C5BB 3KY9A 1V5UA 4MY6A 2YVCA 1H4RA 2IFSA 3D8FA 2DX1A 1X11A 4A6FA 3G9WA 5JHGA 1UNQA 2I1KA 2YS1A 5D3VA 2DA0A 1ZSQA 2JP2A 3ODWA 1OY2A 4YL8A 3O96A 2NMBA 1XCGA 4Z2NA 3A8PA 2RGNB 1WJMA 2ELAA 3AU4A 3NSUA 2ADZA 5KQ4A 4GPTB 1OQNA 3IVFA 3FEHA 1IRSA 4XWXA 3ZDTA 1U29A 1EVHA 4CYEA 5FI0A 2LKOA 1FGYA 3PVLA 4MK0A 3SO6A 1X05A 5D27A 1MIZB 1FAOA 4DX90 5J3QA 1V61A 4A6FB 1UNRA 2N23A 3DXCA 4PQ0A 2KGXB 4HB3B 5C79A 3KSYA 3SNHA 2BCJA 1AQCA 1WI1A 1H10A 2YSZA 3ODXA 1BTNA 1MPHA 1W1GA 2YT0A 2D9XA 4KVGB 1X1FA 5HE1A 2K2UA 4K2OA 2ELBA 3PVUA 1UNPA 3UZTA 3T06A 1I2HA 1WJ1A 3ODOA 2DHJA 2GJYA 1Y5OA 1E5WA 2UZSA 4TYZA 2YF0A 4PNKA 1SHCA 3U8ZA 4A6KA 4EJNA 2XQNM 2NZ8B 2GCJA 1K5DB 2P0FA 2L2IA 4A6HA 1LW3A 1EGXA 1BWNA 5DI9B 3KZ1A 1X1GA 2I5CA 1DDWA 2COAA 3PSCA 1XODA 1NTYA 2RNRB 3TCAA 5HE0A 1TXDA 1WGUA 2R09A 2N0YA 3BINA 4HHVA 5KQ1A 2LYDA 3AU5A 2DLWA 4HAUB 2KUPA 4KHOA 2H7EA 1V5PA 4F7HA 1TQZA 3CXBB 3FSSA 1P3RA 4GMVA 3P7ZA 1ZC4B 1PMSA 4CHJA 5J3YA 1UEFA 2GCLA 2Z0OA 3ULCA 2J0KA 3V5WA 2YS3A 4P7IA 2H7DA 5LONB 5D3XA 1FHXA 2DTCA 3HQCA 4GN1A 5LOPB 1W1DA 4HATB 3VIAA 3N7CA 3TFMA 1XR0B 5C6RA 1GC7A 1AWEA 1U5DA 5EFXA 2RLOA 2W2XC 1FHOA 2DYQA 5J3TA 2LG1A 1MK9B 1DROA 2V76A 4HAYB 1V89A 4WSFA 3VOQA 2AEHA 2E2XA 2GS0A 2P0DA 2P8VA 2I5FA 2DHKA 3PG7A 4C0AA 2J0JA 4F7GA 4HDOA 4GMXB 1DBHA 2P0HA 3PEGA 2YRYA 1U27A 1KZGA 4Y94A 2HTHB 3ULBA 2D11A 2AL6A 5DHFB 2EC1A 4IFSA 3KRXA 4IAPA 2D9YA 3HW2B 1WG7A 2LOZA 2EMTA 5HE2A 4Z2MB 2MDXA 4L6EA 1MK7B 1P6SA 2HE7A 4F7UP 1I7AA 2DKPA 1BAKA 2ROZB 1W1HA 3PZDA 4BBKA 1FGZA 5JLJB 4MT7A 3RCPA 1NTVA 2COCA 3P6AA 5D3YA 5HE3A 2W2WA 2MWNB 4YONA 5CLLB 3U7DA 4ZRIA 3A98B 3ZVRA 1Q67A 4HB4B 3TVVA 2LOXA 3GYPA 1ISNA 4DBBA 1NU2A
chains in the Genus database with same CATH superfamily
1TJ6A 1ZM0A 3SV1A 3TW1A 3WYFB 1RJ2A 1M7RA 5GOWB 1V88A 1FHWA 2DX5A 3QWMA 1XX0A 4GZUA 4D6WA 4EKUA 4OT1A 2Z4DA 3OHMB 3PVWA 4GOUA 1J19A 2LULA 2Y7BA 1UPQA 2VRWB 1XKEA 1MIXA 2IYBA 2YS5A 4B6HA 1LB1A 3OANA 2RUKB 4HAXB 4OSNA 4ZRJA 4NSWA 1BTKA 2G35A 2ZKMX 2GUMA 3A58A 2DKQA 3MPXA 3DXDA 4HAVB 3SUZA 3KRWA 2COFA 2KCJA 2QKLA 2D9WA 3TO1A 5DH9B 3M1IB 1MKEA 1Z87A 3HK0A 2DFKA 3A8QA 3GYOA 4A5KA 3MDBC 4HB2B 3U12A 4HB0B 3PP2A 3CIKA 4DXAB 3DCXA 5D3WA 1V5MA 3F0WA 2I1JA 2CRFA 1NI2A 3QIJA 4DX8A 4KHBA 1SGHA 2Y8FA 2RSGA 5DHAB 1QQGA 2MKRA 2VKIA 1WVHA 3AJ4A 5FI1A 3WA0A 2DN6A 4EMOA 3FM8C 3BJIA 2K8EA 2D9ZA 2MFQA 1GG3A 2UZRA 4IOYX 1FOEA 1KZ7A 2EJ8A 3D8DA 2VSZA 2K49A 4HAWB 3QBVB 5JP4A 1EF1A 3DXEA 4D0NB 2CY4A 1K5GB 2YT1A 1FB8A 4KHAA 2X18A 2M38A 1U2BA 2YT2A 2M14A 1DDMA 1DDVA 1QC6A 3ML4A 5L81A 4KHBB 2ROVA 2D2QA 1U5EA 1X86A 2J0MA 2L1CA 4NY0A 2CAYA 2K2JA 5KCVA 1KI1B 2DHIA 3NWDA 3D8EA 1Y19B 1ZC3B 2W2XD 4WJ7A 4H8SA 3NW8A 2Q13A 5DIFB 4HDQA 1P5TA 5C5BA 2D9VA 2J59M 1PFJA 4ZRKA 3HIEA 1B55A 2Z59A 2DYNA 4K17A 3F5RA 1DYNA 2K00A 1PLSA 2CODA 2OTXA 2ZPYA 1MAIA 4TKNA 2KIGA 1WGQA 1M7EA 3X23A 1ZVRA 1UPRA 1U5FA 4K2PA 3SYXA 1U5GA 2CY5A 2Z0PA 5JHHA 1N3HA 1J0WA 2OQBA 1EAZA 2Z0QA 4QJ4B 2Y8GA 4WVFB 4GXBA 2UVMA 2QKMA 1XD4A 2D10A 4GNKB 4QJ5B 1OMWA 3LJUX 2FJLA 2PZ1A 2KIEA 2RVBB 4KAXB 2EMSA 4HAZB 1GC6A 2D4QA 4K81A 5C16A 5CLQB 4CHMA 1RRPB 2R0DA 5C5BB 3KY9A 1V5UA 4MY6A 2YVCA 5I2SA 4DIXA 1H4RA 2IFSA 3D8FA 2DX1A 1X11A 4A6FA 3G9WA 5JHGA 1UNQA 2I1KA 2YS1A 5D3VA 2DA0A 1ZSQA 2JP2A 3ODWA 1OY2A 4YL8A 3O96A 2NMBA 1XCGA 4Z2NA 3A8PA 2RGNB 1WJMA 2ELAA 3AU4A 2ADZA 3NSUA 2KR0A 5KQ4A 4GPTB 1OQNA 3IVFA 3FEHA 1IRSA 4XWXA 2RRFA 3ZDTA 1U29A 1EVHA 2KUQA 4CYEA 3NWFA 5FI0A 2LKOA 1FGYA 3PVLA 4MK0A 3SO6A 1X05A 5D27A 2R2YA 1MIZB 1FAOA 4DX90 5J3QA 1V61A 4A6FB 1UNRA 2N23A 3DXCA 4PQ0A 2KGXB 4HB3B 5C79A 3KSYA 3SNHA 2BCJA 1AQCA 1WI1A 1H10A 2FJUB 2YSZA 3ODXA 1BTNA 1MPHA 1W1GA 2YT0A 2D9XA 4KVGB 1X1FA 5HE1A 2K2UA 4K2OA 2ELBA 3PVUA 1UNPA 3UZTA 3T06A 1I2HA 1WJ1A 3ODOA 2DHJA 2GJYA 1Y5OA 1E5WA 2UZSA 4TYZA 2YF0A 4PNKA 1SHCA 3U8ZA 4A6KA 4EJNA 3FVCA 2XQNM 2NZ8B 2GCJA 1K5DB 2P0FA 2L2IA 4A6HA 1LW3A 1EGXA 2Z13A 1BWNA 5DI9B 3KZ1A 1X1GA 2I5CA 1DDWA 2COAA 3PSCA 1XODA 1NTYA 2RNRB 3TCAA 5HE0A 1TXDA 1WGUA 2R09A 2N0YA 3BINA 3B77A 4HHVA 5KQ1A 2LYDA 3AU5A 2DLWA 4HAUB 2KUPA 4KHOA 2H7EA 1V5PA 4F7HA 1TQZA 3CXBB 3FSSA 1P3RA 1ZYIA 4GMVA 3P7ZA 1ZC4B 1PMSA 2NBVA 4CHJA 4L1RA 5J3YA 1UEFA 2GCLA 2Z0OA 3ULCA 2J0KA 3V5WA 2YS3A 4P7IA 2H7DA 5LONB 5D3XA 1FHXA 2DTCA 3HQCA 4GN1A 5LOPB 1W1DA 4HATB 3VIAA 3N7CA 3TFMA 1XR0B 5C6RA 1GC7A 4QJ3B 1AWEA 4QXAB 1U5DA 5EFXA 2RLOA 2W2XC 1FHOA 2DYQA 5J3TA 2LG1A 1MK9B 4HSIA 1DROA 2V76A 4HAYB 1V89A 4WSFA 3VOQA 2AEHA 2E2XA 2GS0A 2P0DA 2P8VA 2I5FA 4CSQA 2DHKA 3PG7A 4C0AA 2J0JA 4F7GA 4HDOA 3NWAA 4GMXB 1DBHA 2P0HA 3PEGA 2YRYA 1U27A 1KZGA 4Y94A 2HTHB 3ULBA 2D11A 2AL6A 3HSAA 5DHFB 2EC1A 4IFSA 3KRXA 4IAPA 2D9YA 3HW2B 1WG7A 2LOZA 2EMTA 1T77A 5HE2A 4Z2MB 2MDXA 4L6EA 1MK7B 1P6SA 2HE7A 5I2MA 4F7UP 1I7AA 2DKPA 1BAKA 2ROZB 1W1HA 5IRSA 3PZDA 4BBKA 1FGZA 5JLJB 4MT7A 1MI1A 3RCPA 1NTVA 5LG4B 2COCA 3P6AA 5D3YA 5HE3A 5M4YB 2W2WA 2MWNB 4YONA 5CLLB 3U7DA 4ZRIA 3A98B 3ZVRA 1Q67A 4HB4B 3TVVA 2LOXA 3GYPA 1ISNA 4DBBA 2Z14A 1NU2A
chains in the Genus database with same CATH topology
1TJ6A 1ZM0A 3SV1A 3TW1A 3WYFB 1RJ2A 1M7RA 5GOWB 1V88A 1FHWA 2DX5A 3QWMA 1XX0A 4GZUA 4EKUA 3PVWA 1J19A 2LULA 2Y7BA 1UPQA 2VRWB 1XKEA 1MIXA 2IYBA 2YS5A 4B6HA 1LB1A 3OANA 2RUKB 4HAXB 4ZRJA 4NSWA 1BTKA 2G35A 2DKQA 3MPXA 3DXDA 4HAVB 3SUZA 3KRWA 2COFA 2KCJA 2QKLA 2D9WA 3TO1A 5DH9B 3M1IB 1MKEA 1Z87A 3HK0A 2DFKA 3A8QA 3GYOA 4A5KA 3MDBC 4HB2B 4HB0B 3PP2A 3CIKA 4DXAB 5D3WA 1V5MA 3F0WA 2I1JA 2CRFA 1NI2A 3QIJA 4DX8A 1SGHA 2Y8FA 2RSGA 5DHAB 1QQGA 2MKRA 2VKIA 1WVHA 3AJ4A 5FI1A 3WA0A 2DN6A 4EMOA 3FM8C 3BJIA 2D9ZA 2MFQA 1GG3A 2UZRA 4IOYX 1FOEA 1KZ7A 2EJ8A 3D8DA 2VSZA 4HAWB 3QBVB 5JP4A 1EF1A 3DXEA 4D0NB 2CY4A 1K5GB 2YT1A 1FB8A 4KHAA 2X18A 2M38A 1U2BA 2M14A 1DDMA 1DDVA 1QC6A 3ML4A 5L81A 4KHBB 2ROVA 2D2QA 1U5EA 1X86A 2J0MA 2L1CA 4NY0A 2CAYA 2K2JA 5KCVA 1KI1B 2DHIA 3D8EA 1Y19B 1ZC3B 2W2XD 4WJ7A 4H8SA 2Q13A 5DIFB 4HDQA 1P5TA 5C5BA 2D9VA 2J59M 1PFJA 4ZRKA 1B55A 2DYNA 4K17A 3F5RA 1DYNA 2K00A 1PLSA 2CODA 2OTXA 2ZPYA 1MAIA 4TKNA 1WGQA 1M7EA 3X23A 1ZVRA 1UPRA 1U5FA 4K2PA 3SYXA 1U5GA 2CY5A 2Z0PA 5JHHA 1N3HA 1J0WA 2OQBA 1EAZA 2Z0QA 2Y8GA 4WVFB 4GXBA 2UVMA 2QKMA 1XD4A 2D10A 1OMWA 3LJUX 2FJLA 2PZ1A 2RVBB 4KAXB 2EMSA 4HAZB 1GC6A 2D4QA 4K81A 5C16A 5CLQB 4CHMA 1RRPB 2R0DA 5C5BB 3KY9A 1V5UA 4MY6A 2YVCA 1H4RA 2IFSA 3D8FA 2DX1A 1X11A 4A6FA 3G9WA 5JHGA 1UNQA 2I1KA 2YS1A 5D3VA 2DA0A 1ZSQA 2JP2A 3ODWA 1OY2A 4YL8A 3O96A 2NMBA 1XCGA 4Z2NA 3A8PA 2RGNB 1WJMA 2ELAA 3AU4A 3NSUA 2ADZA 5KQ4A 4GPTB 1OQNA 3IVFA 3FEHA 1IRSA 4XWXA 3ZDTA 1U29A 1EVHA 4CYEA 5FI0A 2LKOA 1FGYA 3PVLA 4MK0A 3SO6A 1X05A 5D27A 1MIZB 1FAOA 4DX90 5J3QA 1V61A 4A6FB 1UNRA 2N23A 3DXCA 4PQ0A 2KGXB 4HB3B 5C79A 3KSYA 3SNHA 2BCJA 1AQCA 1WI1A 1H10A 2YSZA 3ODXA 1BTNA 1MPHA 1W1GA 2YT0A 2D9XA 4KVGB 1X1FA 5HE1A 2K2UA 4K2OA 2ELBA 3PVUA 1UNPA 3UZTA 3T06A 1I2HA 1WJ1A 3ODOA 2DHJA 2GJYA 1Y5OA 1E5WA 2UZSA 4TYZA 2YF0A 4PNKA 1SHCA 3U8ZA 4A6KA 4EJNA 2XQNM 2NZ8B 2GCJA 1K5DB 2P0FA 2L2IA 4A6HA 1LW3A 1EGXA 1BWNA 5DI9B 3KZ1A 1X1GA 2I5CA 1DDWA 2COAA 3PSCA 1XODA 1NTYA 2RNRB 3TCAA 5HE0A 1TXDA 1WGUA 2R09A 2N0YA 3BINA 4HHVA 5KQ1A 2LYDA 3AU5A 2DLWA 4HAUB 2KUPA 4KHOA 2H7EA 1V5PA 4F7HA 1TQZA 3CXBB 3FSSA 1P3RA 4GMVA 3P7ZA 1ZC4B 1PMSA 4CHJA 5J3YA 1UEFA 2GCLA 2Z0OA 3ULCA 2J0KA 3V5WA 2YS3A 4P7IA 2H7DA 5LONB 5D3XA 1FHXA 2DTCA 3HQCA 4GN1A 5LOPB 1W1DA 4HATB 3VIAA 3N7CA 3TFMA 1XR0B 5C6RA 1GC7A 1AWEA 1U5DA 5EFXA 2RLOA 2W2XC 1FHOA 2DYQA 5J3TA 2LG1A 1MK9B 1DROA 2V76A 4HAYB 1V89A 4WSFA 3VOQA 2AEHA 2E2XA 2GS0A 2P0DA 2P8VA 2I5FA 2DHKA 3PG7A 4C0AA 2J0JA 4F7GA 4HDOA 4GMXB 1DBHA 2P0HA 3PEGA 2YRYA 1U27A 1KZGA 4Y94A 2HTHB 3ULBA 2D11A 2AL6A 5DHFB 2EC1A 4IFSA 3KRXA 4IAPA 2D9YA 3HW2B 1WG7A 2LOZA 2EMTA 5HE2A 4Z2MB 2MDXA 4L6EA 1MK7B 1P6SA 2HE7A 4F7UP 1I7AA 2DKPA 1BAKA 2ROZB 1W1HA 3PZDA 4BBKA 1FGZA 5JLJB 4MT7A 3RCPA 1NTVA 2COCA 3P6AA 5D3YA 5HE3A 2W2WA 2MWNB 4YONA 5CLLB 3U7DA 4ZRIA 3A98B 3ZVRA 1Q67A 4HB4B 3TVVA 2LOXA 3GYPA 1ISNA 4DBBA 1NU2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TJ6 A;  1ZM0 A;  3SV1 A;  3TW1 A;  3WYF B;  1RJ2 A;  1M7R A;  5GOW B;  1V88 A;  1FHW A;  2DX5 A;  3QWM A;  1XX0 A;  4GZU A;  4EKU A;  3PVW A;  1J19 A;  2LUL A;  2Y7B A;  1UPQ A;  2VRW B;  1XKE A;  1MIX A;  2IYB A;  2YS5 A;  4B6H A;  1LB1 A;  3OAN A;  2RUK B;  4HAX B;  4ZRJ A;  4NSW A;  1BTK A;  2G35 A;  2DKQ A;  3MPX A;  3DXD A;  4HAV B;  3SUZ A;  3KRW A;  2COF A;  2KCJ A;  2QKL A;  2D9W A;  3TO1 A;  5DH9 B;  3M1I B;  1MKE A;  1Z87 A;  3HK0 A;  2DFK A;  3A8Q A;  3GYO A;  4A5K A;  3MDB C;  4HB2 B;  4HB0 B;  3PP2 A;  3CIK A;  4DXA B;  5D3W A;  1V5M A;  3F0W A;  2I1J A;  2CRF A;  1NI2 A;  3QIJ A;  4DX8 A;  1SGH A;  2Y8F A;  2RSG A;  5DHA B;  1QQG A;  2MKR A;  2VKI A;  1WVH A;  3AJ4 A;  5FI1 A;  3WA0 A;  2DN6 A;  4EMO A;  3FM8 C;  3BJI A;  2D9Z A;  2MFQ A;  1GG3 A;  2UZR A;  4IOY X;  1FOE A;  1KZ7 A;  2EJ8 A;  3D8D A;  2VSZ A;  4HAW B;  3QBV B;  5JP4 A;  1EF1 A;  3DXE A;  4D0N B;  2CY4 A;  1K5G B;  2YT1 A;  1FB8 A;  4KHA A;  2X18 A;  2M38 A;  1U2B A;  2M14 A;  1DDM A;  1DDV A;  1QC6 A;  3ML4 A;  5L81 A;  4KHB B;  2ROV A;  2D2Q A;  1U5E A;  1X86 A;  2J0M A;  2L1C A;  4NY0 A;  2CAY A;  2K2J A;  5KCV A;  1KI1 B;  2DHI A;  3D8E A;  1Y19 B;  1ZC3 B;  2W2X D;  4WJ7 A;  4H8S A;  2Q13 A;  5DIF B;  4HDQ A;  1P5T A;  5C5B A;  2D9V A;  2J59 M;  1PFJ A;  4ZRK A;  1B55 A;  2DYN A;  4K17 A;  3F5R A;  1DYN A;  2K00 A;  1PLS A;  2COD A;  2OTX A;  2ZPY A;  1MAI A;  4TKN A;  1WGQ A;  1M7E A;  3X23 A;  1ZVR A;  1UPR A;  1U5F A;  4K2P A;  3SYX A;  1U5G A;  2CY5 A;  2Z0P A;  5JHH A;  1N3H A;  1J0W A;  2OQB A;  1EAZ A;  2Z0Q A;  2Y8G A;  4WVF B;  4GXB A;  2UVM A;  2QKM A;  1XD4 A;  2D10 A;  1OMW A;  3LJU X;  2FJL A;  2PZ1 A;  2RVB B;  4KAX B;  2EMS A;  4HAZ B;  1GC6 A;  2D4Q A;  4K81 A;  5C16 A;  5CLQ B;  4CHM A;  1RRP B;  2R0D A;  5C5B B;  3KY9 A;  1V5U A;  4MY6 A;  2YVC A;  1H4R A;  2IFS A;  3D8F A;  2DX1 A;  1X11 A;  4A6F A;  3G9W A;  5JHG A;  1UNQ A;  2I1K A;  2YS1 A;  5D3V A;  2DA0 A;  1ZSQ A;  2JP2 A;  3ODW A;  1OY2 A;  4YL8 A;  3O96 A;  2NMB A;  1XCG A;  4Z2N A;  3A8P A;  2RGN B;  1WJM A;  2ELA A;  3AU4 A;  3NSU A;  2ADZ A;  5KQ4 A;  4GPT B;  1OQN A;  3IVF A;  3FEH A;  1IRS A;  4XWX A;  3ZDT A;  1U29 A;  1EVH A;  4CYE A;  5FI0 A;  2LKO A;  1FGY A;  3PVL A;  4MK0 A;  3SO6 A;  1X05 A;  5D27 A;  1MIZ B;  1FAO A;  4DX9 0;  5J3Q A;  1V61 A;  4A6F B;  1UNR A;  2N23 A;  3DXC A;  4PQ0 A;  2KGX B;  4HB3 B;  5C79 A;  3KSY A;  3SNH A;  2BCJ A;  1AQC A;  1WI1 A;  1H10 A;  2YSZ A;  3ODX A;  1BTN A;  1MPH A;  1W1G A;  2YT0 A;  2D9X A;  4KVG B;  1X1F A;  5HE1 A;  2K2U A;  4K2O A;  2ELB A;  3PVU A;  1UNP A;  3UZT A;  3T06 A;  1I2H A;  1WJ1 A;  3ODO A;  2DHJ A;  2GJY A;  1Y5O A;  1E5W A;  2UZS A;  4TYZ A;  2YF0 A;  4PNK A;  1SHC A;  3U8Z A;  4A6K A;  4EJN A;  2XQN M;  2NZ8 B;  2GCJ A;  1K5D B;  2P0F A;  2L2I A;  4A6H A;  1LW3 A;  1EGX A;  1BWN A;  5DI9 B;  3KZ1 A;  1X1G A;  2I5C A;  1DDW A;  2COA A;  3PSC A;  1XOD A;  1NTY A;  2RNR B;  3TCA A;  5HE0 A;  1TXD A;  1WGU A;  2R09 A;  2N0Y A;  3BIN A;  4HHV A;  5KQ1 A;  2LYD A;  3AU5 A;  2DLW A;  4HAU B;  2KUP A;  4KHO A;  2H7E A;  1V5P A;  4F7H A;  1TQZ A;  3CXB B;  3FSS A;  1P3R A;  4GMV A;  3P7Z A;  1ZC4 B;  1PMS A;  4CHJ A;  5J3Y A;  1UEF A;  2GCL A;  2Z0O A;  3ULC A;  2J0K A;  3V5W A;  2YS3 A;  4P7I A;  2H7D A;  5LON B;  5D3X A;  1FHX A;  2DTC A;  3HQC A;  4GN1 A;  5LOP B;  1W1D A;  4HAT B;  3VIA A;  3N7C A;  3TFM A;  1XR0 B;  5C6R A;  1GC7 A;  1AWE A;  1U5D A;  5EFX A;  2RLO A;  2W2X C;  1FHO A;  2DYQ A;  5J3T A;  2LG1 A;  1MK9 B;  1DRO A;  2V76 A;  4HAY B;  1V89 A;  4WSF A;  3VOQ A;  2AEH A;  2E2X A;  2GS0 A;  2P0D A;  2P8V A;  2I5F A;  2DHK A;  3PG7 A;  4C0A A;  2J0J A;  4F7G A;  4HDO A;  4GMX B;  1DBH A;  2P0H A;  3PEG A;  2YRY A;  1U27 A;  1KZG A;  4Y94 A;  2HTH B;  3ULB A;  2D11 A;  2AL6 A;  5DHF B;  2EC1 A;  4IFS A;  3KRX A;  4IAP A;  2D9Y A;  3HW2 B;  1WG7 A;  2LOZ A;  2EMT A;  5HE2 A;  4Z2M B;  2MDX A;  4L6E A;  1MK7 B;  1P6S A;  2HE7 A;  4F7U P;  1I7A A;  2DKP A;  1BAK A;  2ROZ B;  1W1H A;  3PZD A;  4BBK A;  1FGZ A;  5JLJ B;  4MT7 A;  3RCP A;  1NTV A;  2COC A;  3P6A A;  5D3Y A;  5HE3 A;  2W2W A;  2MWN B;  4YON A;  5CLL B;  3U7D A;  4ZRI A;  3A98 B;  3ZVR A;  1Q67 A;  4HB4 B;  3TVV A;  2LOX A;  3GYP A;  1ISN A;  4DBB A;  1NU2 A; 
#chains in the Genus database with same CATH topology
 1TJ6 A;  1ZM0 A;  3SV1 A;  3TW1 A;  3WYF B;  1RJ2 A;  1M7R A;  5GOW B;  1V88 A;  1FHW A;  2DX5 A;  3QWM A;  1XX0 A;  4GZU A;  4D6W A;  4EKU A;  4OT1 A;  2Z4D A;  3OHM B;  3PVW A;  4GOU A;  1J19 A;  2LUL A;  2Y7B A;  1UPQ A;  2VRW B;  1XKE A;  1MIX A;  2IYB A;  2YS5 A;  4B6H A;  1LB1 A;  3OAN A;  2RUK B;  4HAX B;  4OSN A;  4ZRJ A;  4NSW A;  1BTK A;  2G35 A;  2ZKM X;  2GUM A;  3A58 A;  2DKQ A;  3MPX A;  3DXD A;  4HAV B;  3SUZ A;  3KRW A;  2COF A;  2KCJ A;  2QKL A;  2D9W A;  3TO1 A;  5DH9 B;  3M1I B;  1MKE A;  1Z87 A;  3HK0 A;  2DFK A;  3A8Q A;  3GYO A;  4A5K A;  3MDB C;  4HB2 B;  3U12 A;  4HB0 B;  3PP2 A;  3CIK A;  4DXA B;  3DCX A;  5D3W A;  1V5M A;  3F0W A;  2I1J A;  2CRF A;  1NI2 A;  3QIJ A;  4DX8 A;  4KHB A;  1SGH A;  2Y8F A;  2RSG A;  5DHA B;  1QQG A;  2MKR A;  2VKI A;  1WVH A;  3AJ4 A;  5FI1 A;  3WA0 A;  2DN6 A;  4EMO A;  3FM8 C;  3BJI A;  2K8E A;  2D9Z A;  2MFQ A;  1GG3 A;  2UZR A;  4IOY X;  1FOE A;  1KZ7 A;  2EJ8 A;  3D8D A;  2VSZ A;  2K49 A;  4HAW B;  3QBV B;  5JP4 A;  1EF1 A;  3DXE A;  4D0N B;  2CY4 A;  1K5G B;  2YT1 A;  1FB8 A;  4KHA A;  2X18 A;  2M38 A;  1U2B A;  2YT2 A;  2M14 A;  1DDM A;  1DDV A;  1QC6 A;  3ML4 A;  5L81 A;  4KHB B;  2ROV A;  2D2Q A;  1U5E A;  1X86 A;  2J0M A;  2L1C A;  4NY0 A;  2CAY A;  2K2J A;  5KCV A;  1KI1 B;  2DHI A;  3NWD A;  3D8E A;  1Y19 B;  1ZC3 B;  2W2X D;  4WJ7 A;  4H8S A;  3NW8 A;  2Q13 A;  5DIF B;  4HDQ A;  1P5T A;  5C5B A;  2D9V A;  2J59 M;  1PFJ A;  4ZRK A;  3HIE A;  1B55 A;  2Z59 A;  2DYN A;  4K17 A;  3F5R A;  1DYN A;  2K00 A;  1PLS A;  2COD A;  2OTX A;  2ZPY A;  1MAI A;  4TKN A;  2KIG A;  1WGQ A;  1M7E A;  3X23 A;  1ZVR A;  1UPR A;  1U5F A;  4K2P A;  3SYX A;  1U5G A;  2CY5 A;  2Z0P A;  5JHH A;  1N3H A;  1J0W A;  2OQB A;  1EAZ A;  2Z0Q A;  4QJ4 B;  2Y8G A;  4WVF B;  4GXB A;  2UVM A;  2QKM A;  1XD4 A;  2D10 A;  4GNK B;  4QJ5 B;  1OMW A;  3LJU X;  2FJL A;  2PZ1 A;  2KIE A;  2RVB B;  4KAX B;  2EMS A;  4HAZ B;  1GC6 A;  2D4Q A;  4K81 A;  5C16 A;  5CLQ B;  4CHM A;  1RRP B;  2R0D A;  5C5B B;  3KY9 A;  1V5U A;  4MY6 A;  2YVC A;  5I2S A;  4DIX A;  1H4R A;  2IFS A;  3D8F A;  2DX1 A;  1X11 A;  4A6F A;  3G9W A;  5JHG A;  1UNQ A;  2I1K A;  2YS1 A;  5D3V A;  2DA0 A;  1ZSQ A;  2JP2 A;  3ODW A;  1OY2 A;  4YL8 A;  3O96 A;  2NMB A;  1XCG A;  4Z2N A;  3A8P A;  2RGN B;  1WJM A;  2ELA A;  3AU4 A;  2ADZ A;  3NSU A;  2KR0 A;  5KQ4 A;  4GPT B;  1OQN A;  3IVF A;  3FEH A;  1IRS A;  4XWX A;  2RRF A;  3ZDT A;  1U29 A;  1EVH A;  2KUQ A;  4CYE A;  3NWF A;  5FI0 A;  2LKO A;  1FGY A;  3PVL A;  4MK0 A;  3SO6 A;  1X05 A;  5D27 A;  2R2Y A;  1MIZ B;  1FAO A;  4DX9 0;  5J3Q A;  1V61 A;  4A6F B;  1UNR A;  2N23 A;  3DXC A;  4PQ0 A;  2KGX B;  4HB3 B;  5C79 A;  3KSY A;  3SNH A;  2BCJ A;  1AQC A;  1WI1 A;  1H10 A;  2FJU B;  2YSZ A;  3ODX A;  1BTN A;  1MPH A;  1W1G A;  2YT0 A;  2D9X A;  4KVG B;  1X1F A;  5HE1 A;  2K2U A;  4K2O A;  2ELB A;  3PVU A;  1UNP A;  3UZT A;  3T06 A;  1I2H A;  1WJ1 A;  3ODO A;  2DHJ A;  2GJY A;  1Y5O A;  1E5W A;  2UZS A;  4TYZ A;  2YF0 A;  4PNK A;  1SHC A;  3U8Z A;  4A6K A;  4EJN A;  3FVC A;  2XQN M;  2NZ8 B;  2GCJ A;  1K5D B;  2P0F A;  2L2I A;  4A6H A;  1LW3 A;  1EGX A;  2Z13 A;  1BWN A;  5DI9 B;  3KZ1 A;  1X1G A;  2I5C A;  1DDW A;  2COA A;  3PSC A;  1XOD A;  1NTY A;  2RNR B;  3TCA A;  5HE0 A;  1TXD A;  1WGU A;  2R09 A;  2N0Y A;  3BIN A;  3B77 A;  4HHV A;  5KQ1 A;  2LYD A;  3AU5 A;  2DLW A;  4HAU B;  2KUP A;  4KHO A;  2H7E A;  1V5P A;  4F7H A;  1TQZ A;  3CXB B;  3FSS A;  1P3R A;  1ZYI A;  4GMV A;  3P7Z A;  1ZC4 B;  1PMS A;  2NBV A;  4CHJ A;  4L1R A;  5J3Y A;  1UEF A;  2GCL A;  2Z0O A;  3ULC A;  2J0K A;  3V5W A;  2YS3 A;  4P7I A;  2H7D A;  5LON B;  5D3X A;  1FHX A;  2DTC A;  3HQC A;  4GN1 A;  5LOP B;  1W1D A;  4HAT B;  3VIA A;  3N7C A;  3TFM A;  1XR0 B;  5C6R A;  1GC7 A;  4QJ3 B;  1AWE A;  4QXA B;  1U5D A;  5EFX A;  2RLO A;  2W2X C;  1FHO A;  2DYQ A;  5J3T A;  2LG1 A;  1MK9 B;  4HSI A;  1DRO A;  2V76 A;  4HAY B;  1V89 A;  4WSF A;  3VOQ A;  2AEH A;  2E2X A;  2GS0 A;  2P0D A;  2P8V A;  2I5F A;  4CSQ A;  2DHK A;  3PG7 A;  4C0A A;  2J0J A;  4F7G A;  4HDO A;  3NWA A;  4GMX B;  1DBH A;  2P0H A;  3PEG A;  2YRY A;  1U27 A;  1KZG A;  4Y94 A;  2HTH B;  3ULB A;  2D11 A;  2AL6 A;  3HSA A;  5DHF B;  2EC1 A;  4IFS A;  3KRX A;  4IAP A;  2D9Y A;  3HW2 B;  1WG7 A;  2LOZ A;  2EMT A;  1T77 A;  5HE2 A;  4Z2M B;  2MDX A;  4L6E A;  1MK7 B;  1P6S A;  2HE7 A;  5I2M A;  4F7U P;  1I7A A;  2DKP A;  1BAK A;  2ROZ B;  1W1H A;  5IRS A;  3PZD A;  4BBK A;  1FGZ A;  5JLJ B;  4MT7 A;  1MI1 A;  3RCP A;  1NTV A;  5LG4 B;  2COC A;  3P6A A;  5D3Y A;  5HE3 A;  5M4Y B;  2W2W A;  2MWN B;  4YON A;  5CLL B;  3U7D A;  4ZRI A;  3A98 B;  3ZVR A;  1Q67 A;  4HB4 B;  3TVV A;  2LOX A;  3GYP A;  1ISN A;  4DBB A;  2Z14 A;  1NU2 A; 
#chains in the Genus database with same CATH homology
 1TJ6 A;  1ZM0 A;  3SV1 A;  3TW1 A;  3WYF B;  1RJ2 A;  1M7R A;  5GOW B;  1V88 A;  1FHW A;  2DX5 A;  3QWM A;  1XX0 A;  4GZU A;  4EKU A;  3PVW A;  1J19 A;  2LUL A;  2Y7B A;  1UPQ A;  2VRW B;  1XKE A;  1MIX A;  2IYB A;  2YS5 A;  4B6H A;  1LB1 A;  3OAN A;  2RUK B;  4HAX B;  4ZRJ A;  4NSW A;  1BTK A;  2G35 A;  2DKQ A;  3MPX A;  3DXD A;  4HAV B;  3SUZ A;  3KRW A;  2COF A;  2KCJ A;  2QKL A;  2D9W A;  3TO1 A;  5DH9 B;  3M1I B;  1MKE A;  1Z87 A;  3HK0 A;  2DFK A;  3A8Q A;  3GYO A;  4A5K A;  3MDB C;  4HB2 B;  4HB0 B;  3PP2 A;  3CIK A;  4DXA B;  5D3W A;  1V5M A;  3F0W A;  2I1J A;  2CRF A;  1NI2 A;  3QIJ A;  4DX8 A;  1SGH A;  2Y8F A;  2RSG A;  5DHA B;  1QQG A;  2MKR A;  2VKI A;  1WVH A;  3AJ4 A;  5FI1 A;  3WA0 A;  2DN6 A;  4EMO A;  3FM8 C;  3BJI A;  2D9Z A;  2MFQ A;  1GG3 A;  2UZR A;  4IOY X;  1FOE A;  1KZ7 A;  2EJ8 A;  3D8D A;  2VSZ A;  4HAW B;  3QBV B;  5JP4 A;  1EF1 A;  3DXE A;  4D0N B;  2CY4 A;  1K5G B;  2YT1 A;  1FB8 A;  4KHA A;  2X18 A;  2M38 A;  1U2B A;  2M14 A;  1DDM A;  1DDV A;  1QC6 A;  3ML4 A;  5L81 A;  4KHB B;  2ROV A;  2D2Q A;  1U5E A;  1X86 A;  2J0M A;  2L1C A;  4NY0 A;  2CAY A;  2K2J A;  5KCV A;  1KI1 B;  2DHI A;  3D8E A;  1Y19 B;  1ZC3 B;  2W2X D;  4WJ7 A;  4H8S A;  2Q13 A;  5DIF B;  4HDQ A;  1P5T A;  5C5B A;  2D9V A;  2J59 M;  1PFJ A;  4ZRK A;  1B55 A;  2DYN A;  4K17 A;  3F5R A;  1DYN A;  2K00 A;  1PLS A;  2COD A;  2OTX A;  2ZPY A;  1MAI A;  4TKN A;  1WGQ A;  1M7E A;  3X23 A;  1ZVR A;  1UPR A;  1U5F A;  4K2P A;  3SYX A;  1U5G A;  2CY5 A;  2Z0P A;  5JHH A;  1N3H A;  1J0W A;  2OQB A;  1EAZ A;  2Z0Q A;  2Y8G A;  4WVF B;  4GXB A;  2UVM A;  2QKM A;  1XD4 A;  2D10 A;  1OMW A;  3LJU X;  2FJL A;  2PZ1 A;  2RVB B;  4KAX B;  2EMS A;  4HAZ B;  1GC6 A;  2D4Q A;  4K81 A;  5C16 A;  5CLQ B;  4CHM A;  1RRP B;  2R0D A;  5C5B B;  3KY9 A;  1V5U A;  4MY6 A;  2YVC A;  1H4R A;  2IFS A;  3D8F A;  2DX1 A;  1X11 A;  4A6F A;  3G9W A;  5JHG A;  1UNQ A;  2I1K A;  2YS1 A;  5D3V A;  2DA0 A;  1ZSQ A;  2JP2 A;  3ODW A;  1OY2 A;  4YL8 A;  3O96 A;  2NMB A;  1XCG A;  4Z2N A;  3A8P A;  2RGN B;  1WJM A;  2ELA A;  3AU4 A;  3NSU A;  2ADZ A;  5KQ4 A;  4GPT B;  1OQN A;  3IVF A;  3FEH A;  1IRS A;  4XWX A;  3ZDT A;  1U29 A;  1EVH A;  4CYE A;  5FI0 A;  2LKO A;  1FGY A;  3PVL A;  4MK0 A;  3SO6 A;  1X05 A;  5D27 A;  1MIZ B;  1FAO A;  4DX9 0;  5J3Q A;  1V61 A;  4A6F B;  1UNR A;  2N23 A;  3DXC A;  4PQ0 A;  2KGX B;  4HB3 B;  5C79 A;  3KSY A;  3SNH A;  2BCJ A;  1AQC A;  1WI1 A;  1H10 A;  2YSZ A;  3ODX A;  1BTN A;  1MPH A;  1W1G A;  2YT0 A;  2D9X A;  4KVG B;  1X1F A;  5HE1 A;  2K2U A;  4K2O A;  2ELB A;  3PVU A;  1UNP A;  3UZT A;  3T06 A;  1I2H A;  1WJ1 A;  3ODO A;  2DHJ A;  2GJY A;  1Y5O A;  1E5W A;  2UZS A;  4TYZ A;  2YF0 A;  4PNK A;  1SHC A;  3U8Z A;  4A6K A;  4EJN A;  2XQN M;  2NZ8 B;  2GCJ A;  1K5D B;  2P0F A;  2L2I A;  4A6H A;  1LW3 A;  1EGX A;  1BWN A;  5DI9 B;  3KZ1 A;  1X1G A;  2I5C A;  1DDW A;  2COA A;  3PSC A;  1XOD A;  1NTY A;  2RNR B;  3TCA A;  5HE0 A;  1TXD A;  1WGU A;  2R09 A;  2N0Y A;  3BIN A;  4HHV A;  5KQ1 A;  2LYD A;  3AU5 A;  2DLW A;  4HAU B;  2KUP A;  4KHO A;  2H7E A;  1V5P A;  4F7H A;  1TQZ A;  3CXB B;  3FSS A;  1P3R A;  4GMV A;  3P7Z A;  1ZC4 B;  1PMS A;  4CHJ A;  5J3Y A;  1UEF A;  2GCL A;  2Z0O A;  3ULC A;  2J0K A;  3V5W A;  2YS3 A;  4P7I A;  2H7D A;  5LON B;  5D3X A;  1FHX A;  2DTC A;  3HQC A;  4GN1 A;  5LOP B;  1W1D A;  4HAT B;  3VIA A;  3N7C A;  3TFM A;  1XR0 B;  5C6R A;  1GC7 A;  1AWE A;  1U5D A;  5EFX A;  2RLO A;  2W2X C;  1FHO A;  2DYQ A;  5J3T A;  2LG1 A;  1MK9 B;  1DRO A;  2V76 A;  4HAY B;  1V89 A;  4WSF A;  3VOQ A;  2AEH A;  2E2X A;  2GS0 A;  2P0D A;  2P8V A;  2I5F A;  2DHK A;  3PG7 A;  4C0A A;  2J0J A;  4F7G A;  4HDO A;  4GMX B;  1DBH A;  2P0H A;  3PEG A;  2YRY A;  1U27 A;  1KZG A;  4Y94 A;  2HTH B;  3ULB A;  2D11 A;  2AL6 A;  5DHF B;  2EC1 A;  4IFS A;  3KRX A;  4IAP A;  2D9Y A;  3HW2 B;  1WG7 A;  2LOZ A;  2EMT A;  5HE2 A;  4Z2M B;  2MDX A;  4L6E A;  1MK7 B;  1P6S A;  2HE7 A;  4F7U P;  1I7A A;  2DKP A;  1BAK A;  2ROZ B;  1W1H A;  3PZD A;  4BBK A;  1FGZ A;  5JLJ B;  4MT7 A;  3RCP A;  1NTV A;  2COC A;  3P6A A;  5D3Y A;  5HE3 A;  2W2W A;  2MWN B;  4YON A;  5CLL B;  3U7D A;  4ZRI A;  3A98 B;  3ZVR A;  1Q67 A;  4HB4 B;  3TVV A;  2LOX A;  3GYP A;  1ISN A;  4DBB A;  1NU2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...