5DIFB

Crystal structure of cpeb4 nes peptide in complex with crm1-ran-ranbp1
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
138
structure length
130
Chain Sequence
b'IHFEPVVTMEEDEEVLYKVRAKLFRFDADAKEWKERGTGDCKFLKNKKTNKVRILMRRDKTLKICANHIIAPEYTLKPNVGSDRSWVYACTADIAEGEAEAFTFAIRFGSKENADKFKEEFEKAQEINKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTP-binding nuclear protein Ran
publication title Structural determinants of nuclear export signal orientation in binding to exportin CRM1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 31
structure length 130
sequence length 138
ec nomenclature
pdb deposition date 2015-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00638 Ran_BP1 RanBP1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 5difB00
5C5BB 5JLJB 1BAKA 5D3XA 4NY0A 4KAXB 1MIZB 2D9XA 3TW1A 2J0MA 2D10A 2E2XA 1BWNA 5D3VA 2COCA 1ZC3B 2LULA 4HAXB 1K5DB 5HE2A 2VKIA 4KHOA 2EC1A 1DROA 1ISNA 2ROZB 3CIKA 1DYNA 1M7RA 2N23A 2IFSA 5J3TA 1BTNA 2CY5A 5DIFB 3TFMA 4WSFA 1P6SA 2D9ZA 1FGZA 4HHVA 5FI1A 2ADZA 3ODOA 1DDMA 1GG3A 3BJIA 1E5WA 4GMXB 3SUZA 4A6KA 3IVFA 1WVHA 1OY2A 3D8EA 4NSWA 3TO1A 1Z87A 2VSZA 1MIXA 3QBVB 5KQ4A 2D2QA 2HE7A 5LONB 1FOEA 1ZSQA 3HK0A 5JP4A 1W1DA 3SV1A 2CODA 3D8DA 1IRSA 2D4QA 2MWNB 1DBHA 4HATB 1V5PA 5KCVA 2DN6A 4KVGB 5CLQB 5JHGA 4DXAB 3A8PA 4Y94A 3P6AA 3T06A 5LOPB 2DYQA 4F7GA 2W2WA 2J0KA 5DH9B 3X23A 1EAZA 1MK7B 5DHFB 1U5FA 4HAWB 4CYEA 1QQGA 3PG7A 1EF1A 2DFKA 2GJYA 3PP2A 2GS0A 3ML4A 1I2HA 3ZDTA 2Y8GA 1XCGA 3ODWA 2I1KA 5HE3A 2PZ1A 3M1IB 1KZ7A 2NMBA 1XR0B 2ZPYA 4MK0A 5HE1A 3OANA 4HDOA 1W1HA 2Z0PA 4HDQA 1P5TA 2EMTA 3MDBC 2UZSA 4CHMA 5L81A 1FGYA 2BCJA 5GOWB 3KSYA 5DI9B 2LYDA 2MKRA 2D9WA 4PNKA 1V88A 2RUKB 2AL6A 1U27A 4GMVA 1XD4A 3TCAA 1P3RA 3DXEA 3ULCA 4IOYX 5CLLB 1W1GA 1NU2A 1U5DA 3VOQA 2OTXA 2LKOA 1Y19B 2K2JA 2UZRA 2DHKA 1WG7A 1UNRA 2DA0A 4A6HA 5FI0A 2IYBA 2MDXA 2EJ8A 2R09A 1Q67A 4GN1A 2NZ8B 3PZDA 4XWXA 4DX90 2P0FA 3DXDA 1PLSA 1U5EA 1NTVA 1V5MA 4DX8A 4KHBB 4Z2NA 1NI2A 1OQNA 1WGUA 2JP2A 4GZUA 1MPHA 2DKPA 1MKEA 3SO6A 4HAVB 3WYFB 2DYNA 2YVCA 2YT0A 4IAPA 2YF0A 2D9VA 2D9YA 4EMOA 2Q13A 3P7ZA 4DBBA 3HW2B 3N7CA 4EKUA 4TKNA 1TXDA 1X86A 4K2PA 4TYZA 4CHJA 3V5WA 1MAIA 1QC6A 3ULBA 2HTHB 2J0JA 2DHIA 5D3WA 1H4RA 3AJ4A 3LJUX 4MY6A 1DDWA 2YT1A 1PFJA 2YRYA 5EFXA 2YS5A 1WI1A 4WVFB 4B6HA 3BINA 1XODA 1U5GA 4ZRJA 4HB4B 1J19A 3FSSA 2R0DA 3PVUA 2Y7BA 4HB0B 2VRWB 1FHWA 4A5KA 2I1JA 3GYPA 3FM8C 2GCJA 4EJNA 4ZRIA 2M14A 2H7DA 2I5CA 2N0YA 4BBKA 1FHOA 1UEFA 2RGNB 2YS3A 3KRXA 1LB1A 1MK9B 1Y5OA 3F0WA 1NTYA 1RRPB 1X05A 3FEHA 2J59M 1B55A 2V76A 3AU4A 2DTCA 3RCPA 4A6FA 1EGXA 1WGQA 1AQCA 3PVWA 4HAYB 1PMSA 3WA0A 2XQNM 3AU5A 1UPRA 2Y8FA 1ZVRA 4ZRKA 2G35A 3PEGA 1WJMA 5J3YA 4GXBA 1K5GB 1FAOA 2RLOA 4MT7A 2DLWA 1XX0A 2KGXB 5C6RA 1H10A 1RJ2A 3QIJA 5DHAB 2KUPA 4GPTB 1BTKA 2H7EA 3ZVRA 5D3YA 1FHXA 3SNHA 2I5FA 4P7IA 1GC6A 2COFA 1OMWA 2CRFA 2M38A 1EVHA 2DKQA 2Z0QA 3ODXA 3HQCA 2ELAA 1TQZA 2OQBA 2FJLA 2YSZA 4C0AA 2ROVA 2L2IA 2LOXA 4K2OA 3GYOA 2YS1A 1J0WA 3KZ1A 3U8ZA 1U29A 3PVLA 2RSGA 4HAZB 3G9WA 5C16A 1M7EA 1SHCA 3PSCA 1V5UA 4A6FB 1UNPA 2CY4A 4F7UP 2LOZA 3SYXA 2EMSA 1X1FA 4HAUB 4KHAA 3F5RA 3A98B 2ELBA 2X18A 5C5BA 2LG1A 3MPXA 2KCJA 2UVMA 1LW3A 3TVVA 2W2XC 4D0NB 3NSUA 1U2BA 3D8FA 4Z2MB 1GC7A 1WJ1A 2P0DA 4IFSA 2L1CA 3KRWA 2K00A 1ZC4B 1X11A 2QKLA 4HB3B 4K81A 2GCLA 4PQ0A 4L6EA 4F7HA 3VIAA 1XKEA 5JHHA 1V89A 3U7DA 4YONA 3QWMA 5C79A 3O96A 2MFQA 5HE0A 2DX1A 2DX5A 3DXCA 3CXBB 1KZGA 2CAYA 2RVBB 1SGHA 1ZM0A 3KY9A 2AEHA 5KQ1A 2RNRB 2W2XD 2QKMA 5D27A 1N3HA 4WJ7A 3A8QA 1DDVA 1UPQA 2COAA 2K2UA 2D11A 4H8SA 1AWEA 1I7AA 1TJ6A 5J3QA 2P0HA 2Z0OA 4HB2B 1FB8A 2P8VA 1V61A 1UNQA 4K17A 1X1GA 1KI1B 4YL8A 3UZTA 2DHJA
chains in the Genus database with same CATH superfamily
5C5BB 5JLJB 4CSQA 1BAKA 5D3XA 4NY0A 4KAXB 1MIZB 4QJ4B 2D9XA 3TW1A 2J0MA 2D10A 2E2XA 1BWNA 5D3VA 2COCA 1ZC3B 2LULA 4HAXB 1K5DB 3HSAA 5HE2A 4D6WA 2VKIA 4KHOA 3NWDA 2EC1A 1DROA 1ISNA 2ROZB 3CIKA 1DYNA 1M7RA 2N23A 2IFSA 2ZKMX 1BTNA 2CY5A 3NW8A 5DIFB 3TFMA 5J3TA 4WSFA 1P6SA 2D9ZA 1FGZA 4HHVA 5FI1A 2ADZA 3ODOA 1DDMA 1GG3A 3BJIA 1E5WA 4GMXB 3SUZA 4A6KA 3IVFA 1WVHA 2NBVA 1OY2A 3D8EA 4NSWA 3TO1A 1Z87A 2VSZA 1MIXA 3QBVB 5KQ4A 2D2QA 2HE7A 5LONB 1FOEA 1ZSQA 3HK0A 5JP4A 1W1DA 3SV1A 2CODA 4OSNA 3D8DA 1IRSA 2D4QA 2MWNB 1DBHA 4HATB 3FVCA 1V5PA 5KCVA 2DN6A 4KVGB 5CLQB 5JHGA 4DXAB 3A8PA 4Y94A 3P6AA 3T06A 5LOPB 2DYQA 4F7GA 2W2WA 2K8EA 4GNKB 4KHBA 2J0KA 5DH9B 3X23A 1EAZA 1MK7B 5DHFB 1U5FA 4HAWB 4CYEA 1QQGA 3PG7A 1EF1A 2DFKA 2GJYA 3PP2A 2GS0A 3ML4A 1I2HA 3ZDTA 2Y8GA 1XCGA 3ODWA 2I1KA 5HE3A 5IRSA 2PZ1A 3M1IB 1KZ7A 2NMBA 1XR0B 2ZPYA 4MK0A 5HE1A 3OANA 4HDOA 4QJ5B 1W1HA 2Z0PA 4HDQA 1P5TA 2EMTA 3MDBC 2UZSA 2YT2A 4CHMA 5L81A 1FGYA 2BCJA 5GOWB 3KSYA 5DI9B 4QXAB 2LYDA 2MKRA 2D9WA 4PNKA 1V88A 2RUKB 2AL6A 1U27A 4GMVA 1XD4A 3TCAA 1P3RA 3DXEA 3ULCA 4IOYX 5CLLB 1W1GA 1NU2A 1U5DA 3VOQA 2OTXA 2LKOA 4DIXA 1Y19B 3B77A 2K2JA 2UZRA 2DHKA 1WG7A 1UNRA 2DA0A 5I2SA 4A6HA 5FI0A 2IYBA 2MDXA 4HSIA 2EJ8A 2R09A 1Q67A 2Z4DA 2NZ8B 3PZDA 4GN1A 4XWXA 2Z14A 4DX90 2P0FA 3DXDA 1PLSA 1U5EA 1NTVA 1V5MA 3DCXA 4DX8A 4KHBB 4Z2NA 1NI2A 1OQNA 1WGUA 2JP2A 2Z59A 4GZUA 1MPHA 2DKPA 1MKEA 3SO6A 4HAVB 3WYFB 2DYNA 2YVCA 2YT0A 4IAPA 1T77A 2YF0A 2D9VA 2D9YA 4EMOA 2Q13A 3P7ZA 4DBBA 3HW2B 3N7CA 4EKUA 4TKNA 1TXDA 1X86A 4K2PA 4TYZA 4CHJA 3V5WA 1MAIA 1QC6A 3ULBA 2HTHB 2J0JA 2DHIA 5D3WA 1H4RA 3AJ4A 3LJUX 4MY6A 1DDWA 2YT1A 1PFJA 2YRYA 5EFXA 2YS5A 1WI1A 4WVFB 4B6HA 3BINA 1XODA 1U5GA 1ZYIA 4ZRJA 4HB4B 1J19A 3FSSA 2R0DA 3PVUA 2Y7BA 4HB0B 2VRWB 1FHWA 4A5KA 2I1JA 3GYPA 3FM8C 2GCJA 4EJNA 4ZRIA 2M14A 2H7DA 2I5CA 2N0YA 4BBKA 1FHOA 1UEFA 2RGNB 3U12A 2YS3A 3KRXA 1LB1A 1MK9B 3NWAA 1Y5OA 3F0WA 2K49A 2Z13A 1NTYA 1RRPB 1X05A 3FEHA 2J59M 1B55A 2V76A 3AU4A 2DTCA 3RCPA 4A6FA 1EGXA 1WGQA 1AQCA 3PVWA 4HAYB 1PMSA 3WA0A 2XQNM 3AU5A 1UPRA 2Y8FA 1ZVRA 4L1RA 4ZRKA 2G35A 3PEGA 1WJMA 5J3YA 4GXBA 1K5GB 5M4YB 1FAOA 2RLOA 4MT7A 2DLWA 1XX0A 2KIEA 2KGXB 5C6RA 1H10A 1RJ2A 3QIJA 5DHAB 3NWFA 2KUPA 4GPTB 1BTKA 2H7EA 3ZVRA 5D3YA 1FHXA 3SNHA 2I5FA 4P7IA 1MI1A 1GC6A 2COFA 1OMWA 2CRFA 2M38A 1EVHA 2DKQA 2Z0QA 3HIEA 3OHMB 3ODXA 3HQCA 2ELAA 1TQZA 2OQBA 2FJLA 2YSZA 4C0AA 2ROVA 2L2IA 3A58A 2LOXA 4K2OA 3GYOA 2YS1A 5LG4B 4OT1A 2KR0A 1J0WA 3KZ1A 3U8ZA 1U29A 4QJ3B 3PVLA 2RSGA 4HAZB 3G9WA 5C16A 1M7EA 1SHCA 3PSCA 1V5UA 4A6FB 1UNPA 2CY4A 2FJUB 4F7UP 2LOZA 3SYXA 2EMSA 1X1FA 4HAUB 4KHAA 3F5RA 3A98B 2ELBA 2X18A 5C5BA 2LG1A 3MPXA 2KCJA 2UVMA 4GOUA 1LW3A 3TVVA 2R2YA 2W2XC 4D0NB 3NSUA 1U2BA 3D8FA 4Z2MB 1GC7A 1WJ1A 2P0DA 4IFSA 2L1CA 3KRWA 2K00A 1ZC4B 1X11A 2QKLA 4HB3B 4K81A 2GCLA 4PQ0A 4L6EA 4F7HA 3VIAA 1XKEA 5JHHA 1V89A 3U7DA 4YONA 3QWMA 5C79A 3O96A 2MFQA 5HE0A 2GUMA 2DX1A 2DX5A 3DXCA 3CXBB 1KZGA 2CAYA 2RVBB 1SGHA 1ZM0A 3KY9A 2AEHA 5KQ1A 2RNRB 2W2XD 2QKMA 2RRFA 2KIGA 5D27A 1N3HA 4WJ7A 3A8QA 2KUQA 1DDVA 1UPQA 2COAA 2K2UA 2D11A 4H8SA 1AWEA 1I7AA 1TJ6A 5J3QA 2P0HA 2Z0OA 4HB2B 1FB8A 2P8VA 1V61A 1UNQA 4K17A 1X1GA 1KI1B 5I2MA 4YL8A 3UZTA 2DHJA
chains in the Genus database with same CATH topology
5C5BB 5JLJB 1BAKA 5D3XA 4NY0A 4KAXB 1MIZB 2D9XA 3TW1A 2J0MA 2D10A 2E2XA 1BWNA 5D3VA 2COCA 1ZC3B 2LULA 4HAXB 1K5DB 5HE2A 2VKIA 4KHOA 2EC1A 1DROA 1ISNA 2ROZB 3CIKA 1DYNA 1M7RA 2N23A 2IFSA 5J3TA 1BTNA 2CY5A 5DIFB 3TFMA 4WSFA 1P6SA 2D9ZA 1FGZA 4HHVA 5FI1A 2ADZA 3ODOA 1DDMA 1GG3A 3BJIA 1E5WA 4GMXB 3SUZA 4A6KA 3IVFA 1WVHA 1OY2A 3D8EA 4NSWA 3TO1A 1Z87A 2VSZA 1MIXA 3QBVB 5KQ4A 2D2QA 2HE7A 5LONB 1FOEA 1ZSQA 3HK0A 5JP4A 1W1DA 3SV1A 2CODA 3D8DA 1IRSA 2D4QA 2MWNB 1DBHA 4HATB 1V5PA 5KCVA 2DN6A 4KVGB 5CLQB 5JHGA 4DXAB 3A8PA 4Y94A 3P6AA 3T06A 5LOPB 2DYQA 4F7GA 2W2WA 2J0KA 5DH9B 3X23A 1EAZA 1MK7B 5DHFB 1U5FA 4HAWB 4CYEA 1QQGA 3PG7A 1EF1A 2DFKA 2GJYA 3PP2A 2GS0A 3ML4A 1I2HA 3ZDTA 2Y8GA 1XCGA 3ODWA 2I1KA 5HE3A 2PZ1A 3M1IB 1KZ7A 2NMBA 1XR0B 2ZPYA 4MK0A 5HE1A 3OANA 4HDOA 1W1HA 2Z0PA 4HDQA 1P5TA 2EMTA 3MDBC 2UZSA 4CHMA 5L81A 1FGYA 2BCJA 5GOWB 3KSYA 5DI9B 2LYDA 2MKRA 2D9WA 4PNKA 1V88A 2RUKB 2AL6A 1U27A 4GMVA 1XD4A 3TCAA 1P3RA 3DXEA 3ULCA 4IOYX 5CLLB 1W1GA 1NU2A 1U5DA 3VOQA 2OTXA 2LKOA 1Y19B 2K2JA 2UZRA 2DHKA 1WG7A 1UNRA 2DA0A 4A6HA 5FI0A 2IYBA 2MDXA 2EJ8A 2R09A 1Q67A 4GN1A 2NZ8B 3PZDA 4XWXA 4DX90 2P0FA 3DXDA 1PLSA 1U5EA 1NTVA 1V5MA 4DX8A 4KHBB 4Z2NA 1NI2A 1OQNA 1WGUA 2JP2A 4GZUA 1MPHA 2DKPA 1MKEA 3SO6A 4HAVB 3WYFB 2DYNA 2YVCA 2YT0A 4IAPA 2YF0A 2D9VA 2D9YA 4EMOA 2Q13A 3P7ZA 4DBBA 3HW2B 3N7CA 4EKUA 4TKNA 1TXDA 1X86A 4K2PA 4TYZA 4CHJA 3V5WA 1MAIA 1QC6A 3ULBA 2HTHB 2J0JA 2DHIA 5D3WA 1H4RA 3AJ4A 3LJUX 4MY6A 1DDWA 2YT1A 1PFJA 2YRYA 5EFXA 2YS5A 1WI1A 4WVFB 4B6HA 3BINA 1XODA 1U5GA 4ZRJA 4HB4B 1J19A 3FSSA 2R0DA 3PVUA 2Y7BA 4HB0B 2VRWB 1FHWA 4A5KA 2I1JA 3GYPA 3FM8C 2GCJA 4EJNA 4ZRIA 2M14A 2H7DA 2I5CA 2N0YA 4BBKA 1FHOA 1UEFA 2RGNB 2YS3A 3KRXA 1LB1A 1MK9B 1Y5OA 3F0WA 1NTYA 1RRPB 1X05A 3FEHA 2J59M 1B55A 2V76A 3AU4A 2DTCA 3RCPA 4A6FA 1EGXA 1WGQA 1AQCA 3PVWA 4HAYB 1PMSA 3WA0A 2XQNM 3AU5A 1UPRA 2Y8FA 1ZVRA 4ZRKA 2G35A 3PEGA 1WJMA 5J3YA 4GXBA 1K5GB 1FAOA 2RLOA 4MT7A 2DLWA 1XX0A 2KGXB 5C6RA 1H10A 1RJ2A 3QIJA 5DHAB 2KUPA 4GPTB 1BTKA 2H7EA 3ZVRA 5D3YA 1FHXA 3SNHA 2I5FA 4P7IA 1GC6A 2COFA 1OMWA 2CRFA 2M38A 1EVHA 2DKQA 2Z0QA 3ODXA 3HQCA 2ELAA 1TQZA 2OQBA 2FJLA 2YSZA 4C0AA 2ROVA 2L2IA 2LOXA 4K2OA 3GYOA 2YS1A 1J0WA 3KZ1A 3U8ZA 1U29A 3PVLA 2RSGA 4HAZB 3G9WA 5C16A 1M7EA 1SHCA 3PSCA 1V5UA 4A6FB 1UNPA 2CY4A 4F7UP 2LOZA 3SYXA 2EMSA 1X1FA 4HAUB 4KHAA 3F5RA 3A98B 2ELBA 2X18A 5C5BA 2LG1A 3MPXA 2KCJA 2UVMA 1LW3A 3TVVA 2W2XC 4D0NB 3NSUA 1U2BA 3D8FA 4Z2MB 1GC7A 1WJ1A 2P0DA 4IFSA 2L1CA 3KRWA 2K00A 1ZC4B 1X11A 2QKLA 4HB3B 4K81A 2GCLA 4PQ0A 4L6EA 4F7HA 3VIAA 1XKEA 5JHHA 1V89A 3U7DA 4YONA 3QWMA 5C79A 3O96A 2MFQA 5HE0A 2DX1A 2DX5A 3DXCA 3CXBB 1KZGA 2CAYA 2RVBB 1SGHA 1ZM0A 3KY9A 2AEHA 5KQ1A 2RNRB 2W2XD 2QKMA 5D27A 1N3HA 4WJ7A 3A8QA 1DDVA 1UPQA 2COAA 2K2UA 2D11A 4H8SA 1AWEA 1I7AA 1TJ6A 5J3QA 2P0HA 2Z0OA 4HB2B 1FB8A 2P8VA 1V61A 1UNQA 4K17A 1X1GA 1KI1B 4YL8A 3UZTA 2DHJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C5B B;  5JLJ B;  1BAK A;  5D3X A;  4NY0 A;  4KAX B;  1MIZ B;  2D9X A;  3TW1 A;  2J0M A;  2D10 A;  2E2X A;  1BWN A;  5D3V A;  2COC A;  1ZC3 B;  2LUL A;  4HAX B;  1K5D B;  5HE2 A;  2VKI A;  4KHO A;  2EC1 A;  1DRO A;  1ISN A;  2ROZ B;  3CIK A;  1DYN A;  1M7R A;  2N23 A;  2IFS A;  5J3T A;  1BTN A;  2CY5 A;  5DIF B;  3TFM A;  4WSF A;  1P6S A;  2D9Z A;  1FGZ A;  4HHV A;  5FI1 A;  2ADZ A;  3ODO A;  1DDM A;  1GG3 A;  3BJI A;  1E5W A;  4GMX B;  3SUZ A;  4A6K A;  3IVF A;  1WVH A;  1OY2 A;  3D8E A;  4NSW A;  3TO1 A;  1Z87 A;  2VSZ A;  1MIX A;  3QBV B;  5KQ4 A;  2D2Q A;  2HE7 A;  5LON B;  1FOE A;  1ZSQ A;  3HK0 A;  5JP4 A;  1W1D A;  3SV1 A;  2COD A;  3D8D A;  1IRS A;  2D4Q A;  2MWN B;  1DBH A;  4HAT B;  1V5P A;  5KCV A;  2DN6 A;  4KVG B;  5CLQ B;  5JHG A;  4DXA B;  3A8P A;  4Y94 A;  3P6A A;  3T06 A;  5LOP B;  2DYQ A;  4F7G A;  2W2W A;  2J0K A;  5DH9 B;  3X23 A;  1EAZ A;  1MK7 B;  5DHF B;  1U5F A;  4HAW B;  4CYE A;  1QQG A;  3PG7 A;  1EF1 A;  2DFK A;  2GJY A;  3PP2 A;  2GS0 A;  3ML4 A;  1I2H A;  3ZDT A;  2Y8G A;  1XCG A;  3ODW A;  2I1K A;  5HE3 A;  2PZ1 A;  3M1I B;  1KZ7 A;  2NMB A;  1XR0 B;  2ZPY A;  4MK0 A;  5HE1 A;  3OAN A;  4HDO A;  1W1H A;  2Z0P A;  4HDQ A;  1P5T A;  2EMT A;  3MDB C;  2UZS A;  4CHM A;  5L81 A;  1FGY A;  2BCJ A;  5GOW B;  3KSY A;  5DI9 B;  2LYD A;  2MKR A;  2D9W A;  4PNK A;  1V88 A;  2RUK B;  2AL6 A;  1U27 A;  4GMV A;  1XD4 A;  3TCA A;  1P3R A;  3DXE A;  3ULC A;  4IOY X;  5CLL B;  1W1G A;  1NU2 A;  1U5D A;  3VOQ A;  2OTX A;  2LKO A;  1Y19 B;  2K2J A;  2UZR A;  2DHK A;  1WG7 A;  1UNR A;  2DA0 A;  4A6H A;  5FI0 A;  2IYB A;  2MDX A;  2EJ8 A;  2R09 A;  1Q67 A;  4GN1 A;  2NZ8 B;  3PZD A;  4XWX A;  4DX9 0;  2P0F A;  3DXD A;  1PLS A;  1U5E A;  1NTV A;  1V5M A;  4DX8 A;  4KHB B;  4Z2N A;  1NI2 A;  1OQN A;  1WGU A;  2JP2 A;  4GZU A;  1MPH A;  2DKP A;  1MKE A;  3SO6 A;  4HAV B;  3WYF B;  2DYN A;  2YVC A;  2YT0 A;  4IAP A;  2YF0 A;  2D9V A;  2D9Y A;  4EMO A;  2Q13 A;  3P7Z A;  4DBB A;  3HW2 B;  3N7C A;  4EKU A;  4TKN A;  1TXD A;  1X86 A;  4K2P A;  4TYZ A;  4CHJ A;  3V5W A;  1MAI A;  1QC6 A;  3ULB A;  2HTH B;  2J0J A;  2DHI A;  5D3W A;  1H4R A;  3AJ4 A;  3LJU X;  4MY6 A;  1DDW A;  2YT1 A;  1PFJ A;  2YRY A;  5EFX A;  2YS5 A;  1WI1 A;  4WVF B;  4B6H A;  3BIN A;  1XOD A;  1U5G A;  4ZRJ A;  4HB4 B;  1J19 A;  3FSS A;  2R0D A;  3PVU A;  2Y7B A;  4HB0 B;  2VRW B;  1FHW A;  4A5K A;  2I1J A;  3GYP A;  3FM8 C;  2GCJ A;  4EJN A;  4ZRI A;  2M14 A;  2H7D A;  2I5C A;  2N0Y A;  4BBK A;  1FHO A;  1UEF A;  2RGN B;  2YS3 A;  3KRX A;  1LB1 A;  1MK9 B;  1Y5O A;  3F0W A;  1NTY A;  1RRP B;  1X05 A;  3FEH A;  2J59 M;  1B55 A;  2V76 A;  3AU4 A;  2DTC A;  3RCP A;  4A6F A;  1EGX A;  1WGQ A;  1AQC A;  3PVW A;  4HAY B;  1PMS A;  3WA0 A;  2XQN M;  3AU5 A;  1UPR A;  2Y8F A;  1ZVR A;  4ZRK A;  2G35 A;  3PEG A;  1WJM A;  5J3Y A;  4GXB A;  1K5G B;  1FAO A;  2RLO A;  4MT7 A;  2DLW A;  1XX0 A;  2KGX B;  5C6R A;  1H10 A;  1RJ2 A;  3QIJ A;  5DHA B;  2KUP A;  4GPT B;  1BTK A;  2H7E A;  3ZVR A;  5D3Y A;  1FHX A;  3SNH A;  2I5F A;  4P7I A;  1GC6 A;  2COF A;  1OMW A;  2CRF A;  2M38 A;  1EVH A;  2DKQ A;  2Z0Q A;  3ODX A;  3HQC A;  2ELA A;  1TQZ A;  2OQB A;  2FJL A;  2YSZ A;  4C0A A;  2ROV A;  2L2I A;  2LOX A;  4K2O A;  3GYO A;  2YS1 A;  1J0W A;  3KZ1 A;  3U8Z A;  1U29 A;  3PVL A;  2RSG A;  4HAZ B;  3G9W A;  5C16 A;  1M7E A;  1SHC A;  3PSC A;  1V5U A;  4A6F B;  1UNP A;  2CY4 A;  4F7U P;  2LOZ A;  3SYX A;  2EMS A;  1X1F A;  4HAU B;  4KHA A;  3F5R A;  3A98 B;  2ELB A;  2X18 A;  5C5B A;  2LG1 A;  3MPX A;  2KCJ A;  2UVM A;  1LW3 A;  3TVV A;  2W2X C;  4D0N B;  3NSU A;  1U2B A;  3D8F A;  4Z2M B;  1GC7 A;  1WJ1 A;  2P0D A;  4IFS A;  2L1C A;  3KRW A;  2K00 A;  1ZC4 B;  1X11 A;  2QKL A;  4HB3 B;  4K81 A;  2GCL A;  4PQ0 A;  4L6E A;  4F7H A;  3VIA A;  1XKE A;  5JHH A;  1V89 A;  3U7D A;  4YON A;  3QWM A;  5C79 A;  3O96 A;  2MFQ A;  5HE0 A;  2DX1 A;  2DX5 A;  3DXC A;  3CXB B;  1KZG A;  2CAY A;  2RVB B;  1SGH A;  1ZM0 A;  3KY9 A;  2AEH A;  5KQ1 A;  2RNR B;  2W2X D;  2QKM A;  5D27 A;  1N3H A;  4WJ7 A;  3A8Q A;  1DDV A;  1UPQ A;  2COA A;  2K2U A;  2D11 A;  4H8S A;  1AWE A;  1I7A A;  1TJ6 A;  5J3Q A;  2P0H A;  2Z0O A;  4HB2 B;  1FB8 A;  2P8V A;  1V61 A;  1UNQ A;  4K17 A;  1X1G A;  1KI1 B;  4YL8 A;  3UZT A;  2DHJ A; 
#chains in the Genus database with same CATH topology
 5C5B B;  5JLJ B;  4CSQ A;  1BAK A;  5D3X A;  4NY0 A;  4KAX B;  1MIZ B;  4QJ4 B;  2D9X A;  3TW1 A;  2J0M A;  2D10 A;  2E2X A;  1BWN A;  5D3V A;  2COC A;  1ZC3 B;  2LUL A;  4HAX B;  1K5D B;  3HSA A;  5HE2 A;  4D6W A;  2VKI A;  4KHO A;  3NWD A;  2EC1 A;  1DRO A;  1ISN A;  2ROZ B;  3CIK A;  1DYN A;  1M7R A;  2N23 A;  2IFS A;  2ZKM X;  1BTN A;  2CY5 A;  3NW8 A;  5DIF B;  3TFM A;  5J3T A;  4WSF A;  1P6S A;  2D9Z A;  1FGZ A;  4HHV A;  5FI1 A;  2ADZ A;  3ODO A;  1DDM A;  1GG3 A;  3BJI A;  1E5W A;  4GMX B;  3SUZ A;  4A6K A;  3IVF A;  1WVH A;  2NBV A;  1OY2 A;  3D8E A;  4NSW A;  3TO1 A;  1Z87 A;  2VSZ A;  1MIX A;  3QBV B;  5KQ4 A;  2D2Q A;  2HE7 A;  5LON B;  1FOE A;  1ZSQ A;  3HK0 A;  5JP4 A;  1W1D A;  3SV1 A;  2COD A;  4OSN A;  3D8D A;  1IRS A;  2D4Q A;  2MWN B;  1DBH A;  4HAT B;  3FVC A;  1V5P A;  5KCV A;  2DN6 A;  4KVG B;  5CLQ B;  5JHG A;  4DXA B;  3A8P A;  4Y94 A;  3P6A A;  3T06 A;  5LOP B;  2DYQ A;  4F7G A;  2W2W A;  2K8E A;  4GNK B;  4KHB A;  2J0K A;  5DH9 B;  3X23 A;  1EAZ A;  1MK7 B;  5DHF B;  1U5F A;  4HAW B;  4CYE A;  1QQG A;  3PG7 A;  1EF1 A;  2DFK A;  2GJY A;  3PP2 A;  2GS0 A;  3ML4 A;  1I2H A;  3ZDT A;  2Y8G A;  1XCG A;  3ODW A;  2I1K A;  5HE3 A;  5IRS A;  2PZ1 A;  3M1I B;  1KZ7 A;  2NMB A;  1XR0 B;  2ZPY A;  4MK0 A;  5HE1 A;  3OAN A;  4HDO A;  4QJ5 B;  1W1H A;  2Z0P A;  4HDQ A;  1P5T A;  2EMT A;  3MDB C;  2UZS A;  2YT2 A;  4CHM A;  5L81 A;  1FGY A;  2BCJ A;  5GOW B;  3KSY A;  5DI9 B;  4QXA B;  2LYD A;  2MKR A;  2D9W A;  4PNK A;  1V88 A;  2RUK B;  2AL6 A;  1U27 A;  4GMV A;  1XD4 A;  3TCA A;  1P3R A;  3DXE A;  3ULC A;  4IOY X;  5CLL B;  1W1G A;  1NU2 A;  1U5D A;  3VOQ A;  2OTX A;  2LKO A;  4DIX A;  1Y19 B;  3B77 A;  2K2J A;  2UZR A;  2DHK A;  1WG7 A;  1UNR A;  2DA0 A;  5I2S A;  4A6H A;  5FI0 A;  2IYB A;  2MDX A;  4HSI A;  2EJ8 A;  2R09 A;  1Q67 A;  2Z4D A;  2NZ8 B;  3PZD A;  4GN1 A;  4XWX A;  2Z14 A;  4DX9 0;  2P0F A;  3DXD A;  1PLS A;  1U5E A;  1NTV A;  1V5M A;  3DCX A;  4DX8 A;  4KHB B;  4Z2N A;  1NI2 A;  1OQN A;  1WGU A;  2JP2 A;  2Z59 A;  4GZU A;  1MPH A;  2DKP A;  1MKE A;  3SO6 A;  4HAV B;  3WYF B;  2DYN A;  2YVC A;  2YT0 A;  4IAP A;  1T77 A;  2YF0 A;  2D9V A;  2D9Y A;  4EMO A;  2Q13 A;  3P7Z A;  4DBB A;  3HW2 B;  3N7C A;  4EKU A;  4TKN A;  1TXD A;  1X86 A;  4K2P A;  4TYZ A;  4CHJ A;  3V5W A;  1MAI A;  1QC6 A;  3ULB A;  2HTH B;  2J0J A;  2DHI A;  5D3W A;  1H4R A;  3AJ4 A;  3LJU X;  4MY6 A;  1DDW A;  2YT1 A;  1PFJ A;  2YRY A;  5EFX A;  2YS5 A;  1WI1 A;  4WVF B;  4B6H A;  3BIN A;  1XOD A;  1U5G A;  1ZYI A;  4ZRJ A;  4HB4 B;  1J19 A;  3FSS A;  2R0D A;  3PVU A;  2Y7B A;  4HB0 B;  2VRW B;  1FHW A;  4A5K A;  2I1J A;  3GYP A;  3FM8 C;  2GCJ A;  4EJN A;  4ZRI A;  2M14 A;  2H7D A;  2I5C A;  2N0Y A;  4BBK A;  1FHO A;  1UEF A;  2RGN B;  3U12 A;  2YS3 A;  3KRX A;  1LB1 A;  1MK9 B;  3NWA A;  1Y5O A;  3F0W A;  2K49 A;  2Z13 A;  1NTY A;  1RRP B;  1X05 A;  3FEH A;  2J59 M;  1B55 A;  2V76 A;  3AU4 A;  2DTC A;  3RCP A;  4A6F A;  1EGX A;  1WGQ A;  1AQC A;  3PVW A;  4HAY B;  1PMS A;  3WA0 A;  2XQN M;  3AU5 A;  1UPR A;  2Y8F A;  1ZVR A;  4L1R A;  4ZRK A;  2G35 A;  3PEG A;  1WJM A;  5J3Y A;  4GXB A;  1K5G B;  5M4Y B;  1FAO A;  2RLO A;  4MT7 A;  2DLW A;  1XX0 A;  2KIE A;  2KGX B;  5C6R A;  1H10 A;  1RJ2 A;  3QIJ A;  5DHA B;  3NWF A;  2KUP A;  4GPT B;  1BTK A;  2H7E A;  3ZVR A;  5D3Y A;  1FHX A;  3SNH A;  2I5F A;  4P7I A;  1MI1 A;  1GC6 A;  2COF A;  1OMW A;  2CRF A;  2M38 A;  1EVH A;  2DKQ A;  2Z0Q A;  3HIE A;  3OHM B;  3ODX A;  3HQC A;  2ELA A;  1TQZ A;  2OQB A;  2FJL A;  2YSZ A;  4C0A A;  2ROV A;  2L2I A;  3A58 A;  2LOX A;  4K2O A;  3GYO A;  2YS1 A;  5LG4 B;  4OT1 A;  2KR0 A;  1J0W A;  3KZ1 A;  3U8Z A;  1U29 A;  4QJ3 B;  3PVL A;  2RSG A;  4HAZ B;  3G9W A;  5C16 A;  1M7E A;  1SHC A;  3PSC A;  1V5U A;  4A6F B;  1UNP A;  2CY4 A;  2FJU B;  4F7U P;  2LOZ A;  3SYX A;  2EMS A;  1X1F A;  4HAU B;  4KHA A;  3F5R A;  3A98 B;  2ELB A;  2X18 A;  5C5B A;  2LG1 A;  3MPX A;  2KCJ A;  2UVM A;  4GOU A;  1LW3 A;  3TVV A;  2R2Y A;  2W2X C;  4D0N B;  3NSU A;  1U2B A;  3D8F A;  4Z2M B;  1GC7 A;  1WJ1 A;  2P0D A;  4IFS A;  2L1C A;  3KRW A;  2K00 A;  1ZC4 B;  1X11 A;  2QKL A;  4HB3 B;  4K81 A;  2GCL A;  4PQ0 A;  4L6E A;  4F7H A;  3VIA A;  1XKE A;  5JHH A;  1V89 A;  3U7D A;  4YON A;  3QWM A;  5C79 A;  3O96 A;  2MFQ A;  5HE0 A;  2GUM A;  2DX1 A;  2DX5 A;  3DXC A;  3CXB B;  1KZG A;  2CAY A;  2RVB B;  1SGH A;  1ZM0 A;  3KY9 A;  2AEH A;  5KQ1 A;  2RNR B;  2W2X D;  2QKM A;  2RRF A;  2KIG A;  5D27 A;  1N3H A;  4WJ7 A;  3A8Q A;  2KUQ A;  1DDV A;  1UPQ A;  2COA A;  2K2U A;  2D11 A;  4H8S A;  1AWE A;  1I7A A;  1TJ6 A;  5J3Q A;  2P0H A;  2Z0O A;  4HB2 B;  1FB8 A;  2P8V A;  1V61 A;  1UNQ A;  4K17 A;  1X1G A;  1KI1 B;  5I2M A;  4YL8 A;  3UZT A;  2DHJ A; 
#chains in the Genus database with same CATH homology
 5C5B B;  5JLJ B;  1BAK A;  5D3X A;  4NY0 A;  4KAX B;  1MIZ B;  2D9X A;  3TW1 A;  2J0M A;  2D10 A;  2E2X A;  1BWN A;  5D3V A;  2COC A;  1ZC3 B;  2LUL A;  4HAX B;  1K5D B;  5HE2 A;  2VKI A;  4KHO A;  2EC1 A;  1DRO A;  1ISN A;  2ROZ B;  3CIK A;  1DYN A;  1M7R A;  2N23 A;  2IFS A;  5J3T A;  1BTN A;  2CY5 A;  5DIF B;  3TFM A;  4WSF A;  1P6S A;  2D9Z A;  1FGZ A;  4HHV A;  5FI1 A;  2ADZ A;  3ODO A;  1DDM A;  1GG3 A;  3BJI A;  1E5W A;  4GMX B;  3SUZ A;  4A6K A;  3IVF A;  1WVH A;  1OY2 A;  3D8E A;  4NSW A;  3TO1 A;  1Z87 A;  2VSZ A;  1MIX A;  3QBV B;  5KQ4 A;  2D2Q A;  2HE7 A;  5LON B;  1FOE A;  1ZSQ A;  3HK0 A;  5JP4 A;  1W1D A;  3SV1 A;  2COD A;  3D8D A;  1IRS A;  2D4Q A;  2MWN B;  1DBH A;  4HAT B;  1V5P A;  5KCV A;  2DN6 A;  4KVG B;  5CLQ B;  5JHG A;  4DXA B;  3A8P A;  4Y94 A;  3P6A A;  3T06 A;  5LOP B;  2DYQ A;  4F7G A;  2W2W A;  2J0K A;  5DH9 B;  3X23 A;  1EAZ A;  1MK7 B;  5DHF B;  1U5F A;  4HAW B;  4CYE A;  1QQG A;  3PG7 A;  1EF1 A;  2DFK A;  2GJY A;  3PP2 A;  2GS0 A;  3ML4 A;  1I2H A;  3ZDT A;  2Y8G A;  1XCG A;  3ODW A;  2I1K A;  5HE3 A;  2PZ1 A;  3M1I B;  1KZ7 A;  2NMB A;  1XR0 B;  2ZPY A;  4MK0 A;  5HE1 A;  3OAN A;  4HDO A;  1W1H A;  2Z0P A;  4HDQ A;  1P5T A;  2EMT A;  3MDB C;  2UZS A;  4CHM A;  5L81 A;  1FGY A;  2BCJ A;  5GOW B;  3KSY A;  5DI9 B;  2LYD A;  2MKR A;  2D9W A;  4PNK A;  1V88 A;  2RUK B;  2AL6 A;  1U27 A;  4GMV A;  1XD4 A;  3TCA A;  1P3R A;  3DXE A;  3ULC A;  4IOY X;  5CLL B;  1W1G A;  1NU2 A;  1U5D A;  3VOQ A;  2OTX A;  2LKO A;  1Y19 B;  2K2J A;  2UZR A;  2DHK A;  1WG7 A;  1UNR A;  2DA0 A;  4A6H A;  5FI0 A;  2IYB A;  2MDX A;  2EJ8 A;  2R09 A;  1Q67 A;  4GN1 A;  2NZ8 B;  3PZD A;  4XWX A;  4DX9 0;  2P0F A;  3DXD A;  1PLS A;  1U5E A;  1NTV A;  1V5M A;  4DX8 A;  4KHB B;  4Z2N A;  1NI2 A;  1OQN A;  1WGU A;  2JP2 A;  4GZU A;  1MPH A;  2DKP A;  1MKE A;  3SO6 A;  4HAV B;  3WYF B;  2DYN A;  2YVC A;  2YT0 A;  4IAP A;  2YF0 A;  2D9V A;  2D9Y A;  4EMO A;  2Q13 A;  3P7Z A;  4DBB A;  3HW2 B;  3N7C A;  4EKU A;  4TKN A;  1TXD A;  1X86 A;  4K2P A;  4TYZ A;  4CHJ A;  3V5W A;  1MAI A;  1QC6 A;  3ULB A;  2HTH B;  2J0J A;  2DHI A;  5D3W A;  1H4R A;  3AJ4 A;  3LJU X;  4MY6 A;  1DDW A;  2YT1 A;  1PFJ A;  2YRY A;  5EFX A;  2YS5 A;  1WI1 A;  4WVF B;  4B6H A;  3BIN A;  1XOD A;  1U5G A;  4ZRJ A;  4HB4 B;  1J19 A;  3FSS A;  2R0D A;  3PVU A;  2Y7B A;  4HB0 B;  2VRW B;  1FHW A;  4A5K A;  2I1J A;  3GYP A;  3FM8 C;  2GCJ A;  4EJN A;  4ZRI A;  2M14 A;  2H7D A;  2I5C A;  2N0Y A;  4BBK A;  1FHO A;  1UEF A;  2RGN B;  2YS3 A;  3KRX A;  1LB1 A;  1MK9 B;  1Y5O A;  3F0W A;  1NTY A;  1RRP B;  1X05 A;  3FEH A;  2J59 M;  1B55 A;  2V76 A;  3AU4 A;  2DTC A;  3RCP A;  4A6F A;  1EGX A;  1WGQ A;  1AQC A;  3PVW A;  4HAY B;  1PMS A;  3WA0 A;  2XQN M;  3AU5 A;  1UPR A;  2Y8F A;  1ZVR A;  4ZRK A;  2G35 A;  3PEG A;  1WJM A;  5J3Y A;  4GXB A;  1K5G B;  1FAO A;  2RLO A;  4MT7 A;  2DLW A;  1XX0 A;  2KGX B;  5C6R A;  1H10 A;  1RJ2 A;  3QIJ A;  5DHA B;  2KUP A;  4GPT B;  1BTK A;  2H7E A;  3ZVR A;  5D3Y A;  1FHX A;  3SNH A;  2I5F A;  4P7I A;  1GC6 A;  2COF A;  1OMW A;  2CRF A;  2M38 A;  1EVH A;  2DKQ A;  2Z0Q A;  3ODX A;  3HQC A;  2ELA A;  1TQZ A;  2OQB A;  2FJL A;  2YSZ A;  4C0A A;  2ROV A;  2L2I A;  2LOX A;  4K2O A;  3GYO A;  2YS1 A;  1J0W A;  3KZ1 A;  3U8Z A;  1U29 A;  3PVL A;  2RSG A;  4HAZ B;  3G9W A;  5C16 A;  1M7E A;  1SHC A;  3PSC A;  1V5U A;  4A6F B;  1UNP A;  2CY4 A;  4F7U P;  2LOZ A;  3SYX A;  2EMS A;  1X1F A;  4HAU B;  4KHA A;  3F5R A;  3A98 B;  2ELB A;  2X18 A;  5C5B A;  2LG1 A;  3MPX A;  2KCJ A;  2UVM A;  1LW3 A;  3TVV A;  2W2X C;  4D0N B;  3NSU A;  1U2B A;  3D8F A;  4Z2M B;  1GC7 A;  1WJ1 A;  2P0D A;  4IFS A;  2L1C A;  3KRW A;  2K00 A;  1ZC4 B;  1X11 A;  2QKL A;  4HB3 B;  4K81 A;  2GCL A;  4PQ0 A;  4L6E A;  4F7H A;  3VIA A;  1XKE A;  5JHH A;  1V89 A;  3U7D A;  4YON A;  3QWM A;  5C79 A;  3O96 A;  2MFQ A;  5HE0 A;  2DX1 A;  2DX5 A;  3DXC A;  3CXB B;  1KZG A;  2CAY A;  2RVB B;  1SGH A;  1ZM0 A;  3KY9 A;  2AEH A;  5KQ1 A;  2RNR B;  2W2X D;  2QKM A;  5D27 A;  1N3H A;  4WJ7 A;  3A8Q A;  1DDV A;  1UPQ A;  2COA A;  2K2U A;  2D11 A;  4H8S A;  1AWE A;  1I7A A;  1TJ6 A;  5J3Q A;  2P0H A;  2Z0O A;  4HB2 B;  1FB8 A;  2P8V A;  1V61 A;  1UNQ A;  4K17 A;  1X1G A;  1KI1 B;  4YL8 A;  3UZT A;  2DHJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...