5DIFB

Crystal structure of cpeb4 nes peptide in complex with crm1-ran-ranbp1
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
138
structure length
130
Chain Sequence
IHFEPVVTMEEDEEVLYKVRAKLFRFDADAKEWKERGTGDCKFLKNKKTNKVRILMRRDKTLKICANHIIAPEYTLKPNVGSDRSWVYACTADIAEGEAEAFTFAIRFGSKENADKFKEEFEKAQEINKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTP-binding nuclear protein Ran
publication title Structural determinants of nuclear export signal orientation in binding to exportin CRM1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 31
structure length 130
sequence length 138
ec nomenclature
pdb deposition date 2015-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00638 Ran_BP1 RanBP1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 5difB00
3OANA 2VKIA 1BTNA 4K81A 3O96A 5CLLB 4HAVB 3D8FA 4KHOA 3GYPA 1KI1B 2I5CA 1W1HA 3FM8C 3PP2A 4Y94A 1FHOA 4H8SA 4KAXB 1AWEA 2HE7A 3SV1A 4ZRIA 2I5FA 2DN6A 5C16A 1MK7B 2UVMA 2GCJA 1I2HA 4HB3B 4PNKA 1K5DB 1WGUA 2M38A 4HB4B 4GZUA 2K00A 1GC6A 1WJMA 1NU2A 3P7ZA 5DHFB 4EJNA 1Y5OA 2DYNA 2D9VA 2YS5A 1DDVA 2AEHA 4A6KA 1V89A 2HTHB 2ADZA 2NMBA 2W2XD 4HDOA 3KSYA 4DX8A 5GOWB 1BWNA 2YT0A 2ZPYA 1OMWA 2RSGA 4A6HA 1WGQA 3TFMA 2W2WA 1SGHA 1BAKA 2W2XC 2Q13A 2M14A 5D3VA 3PVUA 3KY9A 2NZ8B 1U5DA 5D27A 4MY6A 1U29A 2AL6A 2IFSA 5FI1A 2P0DA 5L81A 3AU5A 5DH9B 3DXDA 2DHKA 2CY4A 2LYDA 1LB1A 3SO6A 1Z87A 2JP2A 5LOPB 1X11A 4GXBA 5JP4A 2IYBA 2LOZA 5HE0A 2DFKA 4MK0A 1I7AA 5HE2A 2Y8FA 4GMVA 4EKUA 3M1IB 1MIXA 5JLJB 5C5BB 3V5WA 2YRYA 1WJ1A 1FOEA 2YS3A 1ZC4B 1MAIA 2ROVA 3QBVB 1MK9B 1XD4A 3AU4A 1TXDA 3MPXA 1J19A 5KQ1A 1U2BA 2LG1A 1FB8A 1B55A 5KCVA 4DX90 2COCA 2Z0OA 2YT1A 3KRXA 1W1DA 1XX0A 4HB0B 2H7DA 1EGXA 1N3HA 2N0YA 5D3YA 4HAUB 2VRWB 3IVFA 2DHJA 2D4QA 4TKNA 1X05A 1W1GA 1Q67A 5FI0A 2RVBB 1TQZA 4D0NB 3SYXA 3ULCA 2DX5A 1FGZA 4F7GA 1X1GA 1U5GA 4P7IA 1WI1A 1AQCA 1H4RA 3TO1A 2J0MA 1OY2A 3T06A 5HE3A 1GG3A 1J0WA 2YF0A 3DXEA 1EVHA 2Y8GA 5DIFB 1KZ7A 3RCPA 4GN1A 1XKEA 4HB2B 1WG7A 5KQ4A 2PZ1A 2G35A 1P5TA 3DXCA 5C5BA 1ZM0A 1DDMA 5HE1A 2DKPA 2D9XA 2MFQA 3KZ1A 3TW1A 1DDWA 3FEHA 4IFSA 3WA0A 1IRSA 1Y19B 4A6FA 1WVHA 1U5EA 2DA0A 2J0KA 4NSWA 3ZDTA 1X86A 1EF1A 1XR0B 2R09A 3P6AA 4IOYX 3TVVA 3ODOA 4CYEA 4WVFB 2YSZA 2E2XA 3PSCA 3VIAA 1UNQA 3ODWA 5D3XA 4DBBA 2EMSA 2OQBA 2X18A 2KGXB 1ZC3B 1P3RA 2ELAA 1QC6A 4ZRKA 1X1FA 1DROA 2QKMA 2MWNB 1MKEA 1PLSA 1U5FA 2XQNM 2D9WA 2P0HA 3F0WA 2H7EA 3D8EA 3NSUA 2BCJA 3CIKA 1SHCA 5DHAB 1KZGA 4XWXA 4HAWB 1K5GB 2MKRA 3PVWA 1V61A 2D10A 2K2UA 3N7CA 4A6FB 3QIJA 4L6EA 1NTYA 2N23A 4DXAB 1RJ2A 2GCLA 2R0DA 3AJ4A 4NY0A 2RUKB 2LULA 3ML4A 1M7EA 1MPHA 1QQGA 2FJLA 4HAZB 5C6RA 4GMXB 1EAZA 1FHWA 3G9WA 1V5UA 2J59M 2D9YA 3WYFB 2D9ZA 3QWMA 1ZSQA 1V5MA 2I1KA 3LJUX 2ROZB 4Z2NA 1TJ6A 4PQ0A 2ELBA 3SUZA 3VOQA 3KRWA 1MIZB 1GC7A 3X23A 2QKLA 1UPRA 2KCJA 4KHBB 3ZVRA 3BINA 2L1CA 1OQNA 5J3TA 2Z0QA 4YL8A 1DBHA 3F5RA 2GJYA 4HAXB 1FGYA 1FHXA 4WSFA 5CLQB 2MDXA 4K2PA 3PZDA 4K2OA 2RLOA 4ZRJA 3A98B 2P8VA 2I1JA 3UZTA 1PFJA 3PVLA 3GYOA 4KHAA 1V88A 4C0AA 2DHIA 5JHGA 2LKOA 2UZSA 2P0FA 5DI9B 1PMSA 5LONB 5J3YA 2L2IA 2YS1A 2CODA 2CY5A 4HATB 2EMTA 3HW2B 2LOXA 5D3WA 3TCAA 4B6HA 1FAOA 2YVCA 2RGNB 3A8QA 1NTVA 2V76A 2COFA 4CHMA 1ZVRA 4YONA 1RRPB 2KUPA 4HHVA 4KVGB 2J0JA 4BBKA 2K2JA 1UEFA 1U27A 4GPTB 2EJ8A 1H10A 2Y7BA 3FSSA 1UNRA 3BJIA 2UZRA 4K17A 1XODA 1M7RA 1P6SA 4MT7A 3SNHA 2D2QA 2EC1A 1UPQA 1E5WA 5EFXA 4Z2MB 3ULBA 1NI2A 3U8ZA 2COAA 4HDQA 4TYZA 4F7UP 3D8DA 4IAPA 2RNRB 2VSZA 1V5PA 3PEGA 2CRFA 1XCGA 3MDBC 4A5KA 5J3QA 2DTCA 3PG7A 3HK0A 1UNPA 4F7HA 4HAYB 3A8PA 4WJ7A 2DLWA 2OTXA 2Z0PA 1ISNA 3U7DA 4EMOA 3ODXA 5JHHA 5C79A 3CXBB 2CAYA 3HQCA 1LW3A 1BTKA 4CHJA 2DX1A 2DKQA 2D11A 2GS0A 1DYNA 2DYQA
chains in the Genus database with same CATH superfamily
3OANA 2VKIA 1BTNA 4K81A 3O96A 5CLLB 4HAVB 3D8FA 4L1RA 4KHOA 3GYPA 3U12A 1KI1B 2I5CA 4D6WA 1W1HA 3FM8C 3PP2A 4Y94A 1FHOA 4H8SA 4KAXB 1AWEA 2HE7A 3SV1A 4ZRIA 2I5FA 2DN6A 2YT2A 5C16A 2RRFA 1MK7B 2UVMA 2GCJA 1I2HA 4HB3B 4DIXA 4PNKA 1K5DB 1WGUA 2M38A 4HB4B 4GZUA 2K00A 1GC6A 1WJMA 1NU2A 2KUQA 3P7ZA 5DHFB 4EJNA 1MI1A 1Y5OA 4OSNA 2DYNA 2D9VA 2YS5A 1DDVA 2AEHA 4A6KA 1V89A 2HTHB 2ADZA 2NMBA 2W2XD 4HDOA 3KSYA 4DX8A 2ZKMX 5GOWB 1BWNA 2YT0A 2ZPYA 1OMWA 2RSGA 4A6HA 1WGQA 4OT1A 3TFMA 2W2WA 1SGHA 2Z14A 1BAKA 2W2XC 3HIEA 2Q13A 2M14A 5D3VA 3PVUA 3KY9A 2NZ8B 1U5DA 5D27A 4MY6A 1U29A 2AL6A 2IFSA 5FI1A 2P0DA 5L81A 3AU5A 5DH9B 3DXDA 2DHKA 2CY4A 2LYDA 1LB1A 3NWAA 3SO6A 3DCXA 1Z87A 2JP2A 5LOPB 4GNKB 1X11A 4GXBA 5JP4A 2IYBA 2LOZA 5HE0A 2DFKA 4MK0A 1I7AA 3B77A 5HE2A 2Y8FA 4GMVA 4EKUA 3M1IB 1MIXA 5JLJB 5C5BB 3V5WA 2YRYA 1WJ1A 1FOEA 2YS3A 1ZC4B 1MAIA 2ROVA 3QBVB 1MK9B 1XD4A 3AU4A 1TXDA 3MPXA 1J19A 5KQ1A 1U2BA 2LG1A 2NBVA 1FB8A 1B55A 5KCVA 4DX90 2COCA 2Z0OA 2YT1A 3KRXA 4CSQA 1W1DA 1XX0A 4HB0B 2H7DA 1EGXA 4QJ5B 1N3HA 2N0YA 5D3YA 4HAUB 2K49A 2VRWB 4QJ3B 3IVFA 2DHJA 2D4QA 4TKNA 1X05A 1W1GA 1Q67A 5FI0A 2RVBB 1TQZA 4D0NB 3SYXA 3ULCA 2DX5A 1FGZA 4F7GA 1X1GA 1U5GA 4P7IA 1WI1A 1AQCA 1H4RA 3TO1A 5LG4B 2J0MA 1OY2A 2KIGA 3T06A 5HE3A 1GG3A 1J0WA 2YF0A 3DXEA 1EVHA 2Y8GA 5DIFB 1KZ7A 3RCPA 4GN1A 2Z4DA 1XKEA 4HB2B 1WG7A 5KQ4A 2PZ1A 3NW8A 2G35A 1P5TA 3DXCA 5C5BA 1ZM0A 1DDMA 5HE1A 1T77A 2DKPA 2D9XA 2MFQA 3HSAA 3KZ1A 3TW1A 1DDWA 3FEHA 4IFSA 3WA0A 1IRSA 1Y19B 3FVCA 4A6FA 5I2MA 1WVHA 1U5EA 2DA0A 2J0KA 4NSWA 3ZDTA 1X86A 2FJUB 1EF1A 1XR0B 2R09A 3P6AA 4IOYX 2K8EA 3ODOA 3TVVA 4CYEA 4WVFB 2YSZA 2KIEA 4GOUA 2E2XA 3PSCA 3VIAA 1UNQA 3ODWA 5D3XA 4DBBA 2EMSA 2OQBA 2X18A 4QJ4B 2KGXB 1ZC3B 1P3RA 2ELAA 1QC6A 4ZRKA 1X1FA 2GUMA 1DROA 2QKMA 2MWNB 1MKEA 1PLSA 1U5FA 2XQNM 3NWFA 2D9WA 2P0HA 3F0WA 2H7EA 3D8EA 3NSUA 2BCJA 3CIKA 1SHCA 5DHAB 1KZGA 4XWXA 4HAWB 1K5GB 2MKRA 3PVWA 1V61A 2D10A 2K2UA 3N7CA 4A6FB 3QIJA 4L6EA 1NTYA 2N23A 4DXAB 1RJ2A 2GCLA 2R0DA 3AJ4A 4NY0A 2RUKB 2LULA 3ML4A 1M7EA 1MPHA 1QQGA 2FJLA 4HAZB 5C6RA 4GMXB 1EAZA 1FHWA 3G9WA 1V5UA 2J59M 2D9YA 3WYFB 2D9ZA 3QWMA 1ZSQA 1V5MA 2I1KA 3LJUX 2ROZB 4Z2NA 1TJ6A 4PQ0A 2ELBA 3SUZA 3VOQA 3KRWA 1MIZB 1GC7A 3X23A 2QKLA 1UPRA 2KCJA 4KHBB 3ZVRA 3BINA 2L1CA 5M4YB 1OQNA 5J3TA 2Z0QA 4YL8A 1DBHA 3F5RA 2GJYA 4HAXB 1FGYA 1FHXA 4WSFA 2Z59A 5CLQB 2MDXA 2R2YA 1ZYIA 4K2PA 3PZDA 4K2OA 2RLOA 4ZRJA 3A98B 2P8VA 2I1JA 3UZTA 1PFJA 3PVLA 3GYOA 4KHAA 1V88A 2Z13A 3NWDA 2DHIA 4C0AA 5JHGA 2LKOA 2UZSA 2P0FA 5DI9B 1PMSA 5LONB 5J3YA 2L2IA 2YS1A 2CODA 2CY5A 4QXAB 4HATB 2EMTA 3HW2B 2LOXA 5D3WA 3TCAA 4B6HA 1FAOA 2YVCA 2RGNB 3A8QA 1NTVA 2KR0A 2V76A 2COFA 4CHMA 1ZVRA 4YONA 1RRPB 2KUPA 4HHVA 4KVGB 2J0JA 4BBKA 2K2JA 1UEFA 1U27A 4GPTB 2EJ8A 1H10A 2Y7BA 4KHBA 3FSSA 1UNRA 3BJIA 2UZRA 4K17A 1XODA 1M7RA 1P6SA 4MT7A 3SNHA 2D2QA 2EC1A 1UPQA 1E5WA 3A58A 5I2SA 5EFXA 4Z2MB 3ULBA 1NI2A 3U8ZA 2COAA 4HDQA 4TYZA 4F7UP 3D8DA 4IAPA 2RNRB 2VSZA 1V5PA 3PEGA 2CRFA 1XCGA 3MDBC 4A5KA 5J3QA 2DTCA 3PG7A 3HK0A 1UNPA 4F7HA 4HAYB 3A8PA 4WJ7A 2DLWA 3OHMB 2OTXA 2Z0PA 1ISNA 3U7DA 4EMOA 3ODXA 5IRSA 5JHHA 4HSIA 5C79A 3CXBB 2CAYA 3HQCA 1LW3A 1BTKA 4CHJA 2DX1A 2DKQA 2D11A 2GS0A 1DYNA 2DYQA
chains in the Genus database with same CATH topology
3OANA 2VKIA 1BTNA 4K81A 3O96A 5CLLB 4HAVB 3D8FA 4KHOA 3GYPA 1KI1B 2I5CA 1W1HA 3FM8C 3PP2A 4Y94A 1FHOA 4H8SA 4KAXB 1AWEA 2HE7A 3SV1A 4ZRIA 2I5FA 2DN6A 5C16A 1MK7B 2UVMA 2GCJA 1I2HA 4HB3B 4PNKA 1K5DB 1WGUA 2M38A 4HB4B 4GZUA 2K00A 1GC6A 1WJMA 1NU2A 3P7ZA 5DHFB 4EJNA 1Y5OA 2DYNA 2D9VA 2YS5A 1DDVA 2AEHA 4A6KA 1V89A 2HTHB 2ADZA 2NMBA 2W2XD 4HDOA 3KSYA 4DX8A 5GOWB 1BWNA 2YT0A 2ZPYA 1OMWA 2RSGA 4A6HA 1WGQA 3TFMA 2W2WA 1SGHA 1BAKA 2W2XC 2Q13A 2M14A 5D3VA 3PVUA 3KY9A 2NZ8B 1U5DA 5D27A 4MY6A 1U29A 2AL6A 2IFSA 5FI1A 2P0DA 5L81A 3AU5A 5DH9B 3DXDA 2DHKA 2CY4A 2LYDA 1LB1A 3SO6A 1Z87A 2JP2A 5LOPB 1X11A 4GXBA 5JP4A 2IYBA 2LOZA 5HE0A 2DFKA 4MK0A 1I7AA 5HE2A 2Y8FA 4GMVA 4EKUA 3M1IB 1MIXA 5JLJB 5C5BB 3V5WA 2YRYA 1WJ1A 1FOEA 2YS3A 1ZC4B 1MAIA 2ROVA 3QBVB 1MK9B 1XD4A 3AU4A 1TXDA 3MPXA 1J19A 5KQ1A 1U2BA 2LG1A 1FB8A 1B55A 5KCVA 4DX90 2COCA 2Z0OA 2YT1A 3KRXA 1W1DA 1XX0A 4HB0B 2H7DA 1EGXA 1N3HA 2N0YA 5D3YA 4HAUB 2VRWB 3IVFA 2DHJA 2D4QA 4TKNA 1X05A 1W1GA 1Q67A 5FI0A 2RVBB 1TQZA 4D0NB 3SYXA 3ULCA 2DX5A 1FGZA 4F7GA 1X1GA 1U5GA 4P7IA 1WI1A 1AQCA 1H4RA 3TO1A 2J0MA 1OY2A 3T06A 5HE3A 1GG3A 1J0WA 2YF0A 3DXEA 1EVHA 2Y8GA 5DIFB 1KZ7A 3RCPA 4GN1A 1XKEA 4HB2B 1WG7A 5KQ4A 2PZ1A 2G35A 1P5TA 3DXCA 5C5BA 1ZM0A 1DDMA 5HE1A 2DKPA 2D9XA 2MFQA 3KZ1A 3TW1A 1DDWA 3FEHA 4IFSA 3WA0A 1IRSA 1Y19B 4A6FA 1WVHA 1U5EA 2DA0A 2J0KA 4NSWA 3ZDTA 1X86A 1EF1A 1XR0B 2R09A 3P6AA 4IOYX 3TVVA 3ODOA 4CYEA 4WVFB 2YSZA 2E2XA 3PSCA 3VIAA 1UNQA 3ODWA 5D3XA 4DBBA 2EMSA 2OQBA 2X18A 2KGXB 1ZC3B 1P3RA 2ELAA 1QC6A 4ZRKA 1X1FA 1DROA 2QKMA 2MWNB 1MKEA 1PLSA 1U5FA 2XQNM 2D9WA 2P0HA 3F0WA 2H7EA 3D8EA 3NSUA 2BCJA 3CIKA 1SHCA 5DHAB 1KZGA 4XWXA 4HAWB 1K5GB 2MKRA 3PVWA 1V61A 2D10A 2K2UA 3N7CA 4A6FB 3QIJA 4L6EA 1NTYA 2N23A 4DXAB 1RJ2A 2GCLA 2R0DA 3AJ4A 4NY0A 2RUKB 2LULA 3ML4A 1M7EA 1MPHA 1QQGA 2FJLA 4HAZB 5C6RA 4GMXB 1EAZA 1FHWA 3G9WA 1V5UA 2J59M 2D9YA 3WYFB 2D9ZA 3QWMA 1ZSQA 1V5MA 2I1KA 3LJUX 2ROZB 4Z2NA 1TJ6A 4PQ0A 2ELBA 3SUZA 3VOQA 3KRWA 1MIZB 1GC7A 3X23A 2QKLA 1UPRA 2KCJA 4KHBB 3ZVRA 3BINA 2L1CA 1OQNA 5J3TA 2Z0QA 4YL8A 1DBHA 3F5RA 2GJYA 4HAXB 1FGYA 1FHXA 4WSFA 5CLQB 2MDXA 4K2PA 3PZDA 4K2OA 2RLOA 4ZRJA 3A98B 2P8VA 2I1JA 3UZTA 1PFJA 3PVLA 3GYOA 4KHAA 1V88A 4C0AA 2DHIA 5JHGA 2LKOA 2UZSA 2P0FA 5DI9B 1PMSA 5LONB 5J3YA 2L2IA 2YS1A 2CODA 2CY5A 4HATB 2EMTA 3HW2B 2LOXA 5D3WA 3TCAA 4B6HA 1FAOA 2YVCA 2RGNB 3A8QA 1NTVA 2V76A 2COFA 4CHMA 1ZVRA 4YONA 1RRPB 2KUPA 4HHVA 4KVGB 2J0JA 4BBKA 2K2JA 1UEFA 1U27A 4GPTB 2EJ8A 1H10A 2Y7BA 3FSSA 1UNRA 3BJIA 2UZRA 4K17A 1XODA 1M7RA 1P6SA 4MT7A 3SNHA 2D2QA 2EC1A 1UPQA 1E5WA 5EFXA 4Z2MB 3ULBA 1NI2A 3U8ZA 2COAA 4HDQA 4TYZA 4F7UP 3D8DA 4IAPA 2RNRB 2VSZA 1V5PA 3PEGA 2CRFA 1XCGA 3MDBC 4A5KA 5J3QA 2DTCA 3PG7A 3HK0A 1UNPA 4F7HA 4HAYB 3A8PA 4WJ7A 2DLWA 2OTXA 2Z0PA 1ISNA 3U7DA 4EMOA 3ODXA 5JHHA 5C79A 3CXBB 2CAYA 3HQCA 1LW3A 1BTKA 4CHJA 2DX1A 2DKQA 2D11A 2GS0A 1DYNA 2DYQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OAN A;  2VKI A;  1BTN A;  4K81 A;  3O96 A;  5CLL B;  4HAV B;  3D8F A;  4KHO A;  3GYP A;  1KI1 B;  2I5C A;  1W1H A;  3FM8 C;  3PP2 A;  4Y94 A;  1FHO A;  4H8S A;  4KAX B;  1AWE A;  2HE7 A;  3SV1 A;  4ZRI A;  2I5F A;  2DN6 A;  5C16 A;  1MK7 B;  2UVM A;  2GCJ A;  1I2H A;  4HB3 B;  4PNK A;  1K5D B;  1WGU A;  2M38 A;  4HB4 B;  4GZU A;  2K00 A;  1GC6 A;  1WJM A;  1NU2 A;  3P7Z A;  5DHF B;  4EJN A;  1Y5O A;  2DYN A;  2D9V A;  2YS5 A;  1DDV A;  2AEH A;  4A6K A;  1V89 A;  2HTH B;  2ADZ A;  2NMB A;  2W2X D;  4HDO A;  3KSY A;  4DX8 A;  5GOW B;  1BWN A;  2YT0 A;  2ZPY A;  1OMW A;  2RSG A;  4A6H A;  1WGQ A;  3TFM A;  2W2W A;  1SGH A;  1BAK A;  2W2X C;  2Q13 A;  2M14 A;  5D3V A;  3PVU A;  3KY9 A;  2NZ8 B;  1U5D A;  5D27 A;  4MY6 A;  1U29 A;  2AL6 A;  2IFS A;  5FI1 A;  2P0D A;  5L81 A;  3AU5 A;  5DH9 B;  3DXD A;  2DHK A;  2CY4 A;  2LYD A;  1LB1 A;  3SO6 A;  1Z87 A;  2JP2 A;  5LOP B;  1X11 A;  4GXB A;  5JP4 A;  2IYB A;  2LOZ A;  5HE0 A;  2DFK A;  4MK0 A;  1I7A A;  5HE2 A;  2Y8F A;  4GMV A;  4EKU A;  3M1I B;  1MIX A;  5JLJ B;  5C5B B;  3V5W A;  2YRY A;  1WJ1 A;  1FOE A;  2YS3 A;  1ZC4 B;  1MAI A;  2ROV A;  3QBV B;  1MK9 B;  1XD4 A;  3AU4 A;  1TXD A;  3MPX A;  1J19 A;  5KQ1 A;  1U2B A;  2LG1 A;  1FB8 A;  1B55 A;  5KCV A;  4DX9 0;  2COC A;  2Z0O A;  2YT1 A;  3KRX A;  1W1D A;  1XX0 A;  4HB0 B;  2H7D A;  1EGX A;  1N3H A;  2N0Y A;  5D3Y A;  4HAU B;  2VRW B;  3IVF A;  2DHJ A;  2D4Q A;  4TKN A;  1X05 A;  1W1G A;  1Q67 A;  5FI0 A;  2RVB B;  1TQZ A;  4D0N B;  3SYX A;  3ULC A;  2DX5 A;  1FGZ A;  4F7G A;  1X1G A;  1U5G A;  4P7I A;  1WI1 A;  1AQC A;  1H4R A;  3TO1 A;  2J0M A;  1OY2 A;  3T06 A;  5HE3 A;  1GG3 A;  1J0W A;  2YF0 A;  3DXE A;  1EVH A;  2Y8G A;  5DIF B;  1KZ7 A;  3RCP A;  4GN1 A;  1XKE A;  4HB2 B;  1WG7 A;  5KQ4 A;  2PZ1 A;  2G35 A;  1P5T A;  3DXC A;  5C5B A;  1ZM0 A;  1DDM A;  5HE1 A;  2DKP A;  2D9X A;  2MFQ A;  3KZ1 A;  3TW1 A;  1DDW A;  3FEH A;  4IFS A;  3WA0 A;  1IRS A;  1Y19 B;  4A6F A;  1WVH A;  1U5E A;  2DA0 A;  2J0K A;  4NSW A;  3ZDT A;  1X86 A;  1EF1 A;  1XR0 B;  2R09 A;  3P6A A;  4IOY X;  3TVV A;  3ODO A;  4CYE A;  4WVF B;  2YSZ A;  2E2X A;  3PSC A;  3VIA A;  1UNQ A;  3ODW A;  5D3X A;  4DBB A;  2EMS A;  2OQB A;  2X18 A;  2KGX B;  1ZC3 B;  1P3R A;  2ELA A;  1QC6 A;  4ZRK A;  1X1F A;  1DRO A;  2QKM A;  2MWN B;  1MKE A;  1PLS A;  1U5F A;  2XQN M;  2D9W A;  2P0H A;  3F0W A;  2H7E A;  3D8E A;  3NSU A;  2BCJ A;  3CIK A;  1SHC A;  5DHA B;  1KZG A;  4XWX A;  4HAW B;  1K5G B;  2MKR A;  3PVW A;  1V61 A;  2D10 A;  2K2U A;  3N7C A;  4A6F B;  3QIJ A;  4L6E A;  1NTY A;  2N23 A;  4DXA B;  1RJ2 A;  2GCL A;  2R0D A;  3AJ4 A;  4NY0 A;  2RUK B;  2LUL A;  3ML4 A;  1M7E A;  1MPH A;  1QQG A;  2FJL A;  4HAZ B;  5C6R A;  4GMX B;  1EAZ A;  1FHW A;  3G9W A;  1V5U A;  2J59 M;  2D9Y A;  3WYF B;  2D9Z A;  3QWM A;  1ZSQ A;  1V5M A;  2I1K A;  3LJU X;  2ROZ B;  4Z2N A;  1TJ6 A;  4PQ0 A;  2ELB A;  3SUZ A;  3VOQ A;  3KRW A;  1MIZ B;  1GC7 A;  3X23 A;  2QKL A;  1UPR A;  2KCJ A;  4KHB B;  3ZVR A;  3BIN A;  2L1C A;  1OQN A;  5J3T A;  2Z0Q A;  4YL8 A;  1DBH A;  3F5R A;  2GJY A;  4HAX B;  1FGY A;  1FHX A;  4WSF A;  5CLQ B;  2MDX A;  4K2P A;  3PZD A;  4K2O A;  2RLO A;  4ZRJ A;  3A98 B;  2P8V A;  2I1J A;  3UZT A;  1PFJ A;  3PVL A;  3GYO A;  4KHA A;  1V88 A;  4C0A A;  2DHI A;  5JHG A;  2LKO A;  2UZS A;  2P0F A;  5DI9 B;  1PMS A;  5LON B;  5J3Y A;  2L2I A;  2YS1 A;  2COD A;  2CY5 A;  4HAT B;  2EMT A;  3HW2 B;  2LOX A;  5D3W A;  3TCA A;  4B6H A;  1FAO A;  2YVC A;  2RGN B;  3A8Q A;  1NTV A;  2V76 A;  2COF A;  4CHM A;  1ZVR A;  4YON A;  1RRP B;  2KUP A;  4HHV A;  4KVG B;  2J0J A;  4BBK A;  2K2J A;  1UEF A;  1U27 A;  4GPT B;  2EJ8 A;  1H10 A;  2Y7B A;  3FSS A;  1UNR A;  3BJI A;  2UZR A;  4K17 A;  1XOD A;  1M7R A;  1P6S A;  4MT7 A;  3SNH A;  2D2Q A;  2EC1 A;  1UPQ A;  1E5W A;  5EFX A;  4Z2M B;  3ULB A;  1NI2 A;  3U8Z A;  2COA A;  4HDQ A;  4TYZ A;  4F7U P;  3D8D A;  4IAP A;  2RNR B;  2VSZ A;  1V5P A;  3PEG A;  2CRF A;  1XCG A;  3MDB C;  4A5K A;  5J3Q A;  2DTC A;  3PG7 A;  3HK0 A;  1UNP A;  4F7H A;  4HAY B;  3A8P A;  4WJ7 A;  2DLW A;  2OTX A;  2Z0P A;  1ISN A;  3U7D A;  4EMO A;  3ODX A;  5JHH A;  5C79 A;  3CXB B;  2CAY A;  3HQC A;  1LW3 A;  1BTK A;  4CHJ A;  2DX1 A;  2DKQ A;  2D11 A;  2GS0 A;  1DYN A;  2DYQ A; 
#chains in the Genus database with same CATH topology
 3OAN A;  2VKI A;  1BTN A;  4K81 A;  3O96 A;  5CLL B;  4HAV B;  3D8F A;  4L1R A;  4KHO A;  3GYP A;  3U12 A;  1KI1 B;  2I5C A;  4D6W A;  1W1H A;  3FM8 C;  3PP2 A;  4Y94 A;  1FHO A;  4H8S A;  4KAX B;  1AWE A;  2HE7 A;  3SV1 A;  4ZRI A;  2I5F A;  2DN6 A;  2YT2 A;  5C16 A;  2RRF A;  1MK7 B;  2UVM A;  2GCJ A;  1I2H A;  4HB3 B;  4DIX A;  4PNK A;  1K5D B;  1WGU A;  2M38 A;  4HB4 B;  4GZU A;  2K00 A;  1GC6 A;  1WJM A;  1NU2 A;  2KUQ A;  3P7Z A;  5DHF B;  4EJN A;  1MI1 A;  1Y5O A;  4OSN A;  2DYN A;  2D9V A;  2YS5 A;  1DDV A;  2AEH A;  4A6K A;  1V89 A;  2HTH B;  2ADZ A;  2NMB A;  2W2X D;  4HDO A;  3KSY A;  4DX8 A;  2ZKM X;  5GOW B;  1BWN A;  2YT0 A;  2ZPY A;  1OMW A;  2RSG A;  4A6H A;  1WGQ A;  4OT1 A;  3TFM A;  2W2W A;  1SGH A;  2Z14 A;  1BAK A;  2W2X C;  3HIE A;  2Q13 A;  2M14 A;  5D3V A;  3PVU A;  3KY9 A;  2NZ8 B;  1U5D A;  5D27 A;  4MY6 A;  1U29 A;  2AL6 A;  2IFS A;  5FI1 A;  2P0D A;  5L81 A;  3AU5 A;  5DH9 B;  3DXD A;  2DHK A;  2CY4 A;  2LYD A;  1LB1 A;  3NWA A;  3SO6 A;  3DCX A;  1Z87 A;  2JP2 A;  5LOP B;  4GNK B;  1X11 A;  4GXB A;  5JP4 A;  2IYB A;  2LOZ A;  5HE0 A;  2DFK A;  4MK0 A;  1I7A A;  3B77 A;  5HE2 A;  2Y8F A;  4GMV A;  4EKU A;  3M1I B;  1MIX A;  5JLJ B;  5C5B B;  3V5W A;  2YRY A;  1WJ1 A;  1FOE A;  2YS3 A;  1ZC4 B;  1MAI A;  2ROV A;  3QBV B;  1MK9 B;  1XD4 A;  3AU4 A;  1TXD A;  3MPX A;  1J19 A;  5KQ1 A;  1U2B A;  2LG1 A;  2NBV A;  1FB8 A;  1B55 A;  5KCV A;  4DX9 0;  2COC A;  2Z0O A;  2YT1 A;  3KRX A;  4CSQ A;  1W1D A;  1XX0 A;  4HB0 B;  2H7D A;  1EGX A;  4QJ5 B;  1N3H A;  2N0Y A;  5D3Y A;  4HAU B;  2K49 A;  2VRW B;  4QJ3 B;  3IVF A;  2DHJ A;  2D4Q A;  4TKN A;  1X05 A;  1W1G A;  1Q67 A;  5FI0 A;  2RVB B;  1TQZ A;  4D0N B;  3SYX A;  3ULC A;  2DX5 A;  1FGZ A;  4F7G A;  1X1G A;  1U5G A;  4P7I A;  1WI1 A;  1AQC A;  1H4R A;  3TO1 A;  5LG4 B;  2J0M A;  1OY2 A;  2KIG A;  3T06 A;  5HE3 A;  1GG3 A;  1J0W A;  2YF0 A;  3DXE A;  1EVH A;  2Y8G A;  5DIF B;  1KZ7 A;  3RCP A;  4GN1 A;  2Z4D A;  1XKE A;  4HB2 B;  1WG7 A;  5KQ4 A;  2PZ1 A;  3NW8 A;  2G35 A;  1P5T A;  3DXC A;  5C5B A;  1ZM0 A;  1DDM A;  5HE1 A;  1T77 A;  2DKP A;  2D9X A;  2MFQ A;  3HSA A;  3KZ1 A;  3TW1 A;  1DDW A;  3FEH A;  4IFS A;  3WA0 A;  1IRS A;  1Y19 B;  3FVC A;  4A6F A;  5I2M A;  1WVH A;  1U5E A;  2DA0 A;  2J0K A;  4NSW A;  3ZDT A;  1X86 A;  2FJU B;  1EF1 A;  1XR0 B;  2R09 A;  3P6A A;  4IOY X;  2K8E A;  3ODO A;  3TVV A;  4CYE A;  4WVF B;  2YSZ A;  2KIE A;  4GOU A;  2E2X A;  3PSC A;  3VIA A;  1UNQ A;  3ODW A;  5D3X A;  4DBB A;  2EMS A;  2OQB A;  2X18 A;  4QJ4 B;  2KGX B;  1ZC3 B;  1P3R A;  2ELA A;  1QC6 A;  4ZRK A;  1X1F A;  2GUM A;  1DRO A;  2QKM A;  2MWN B;  1MKE A;  1PLS A;  1U5F A;  2XQN M;  3NWF A;  2D9W A;  2P0H A;  3F0W A;  2H7E A;  3D8E A;  3NSU A;  2BCJ A;  3CIK A;  1SHC A;  5DHA B;  1KZG A;  4XWX A;  4HAW B;  1K5G B;  2MKR A;  3PVW A;  1V61 A;  2D10 A;  2K2U A;  3N7C A;  4A6F B;  3QIJ A;  4L6E A;  1NTY A;  2N23 A;  4DXA B;  1RJ2 A;  2GCL A;  2R0D A;  3AJ4 A;  4NY0 A;  2RUK B;  2LUL A;  3ML4 A;  1M7E A;  1MPH A;  1QQG A;  2FJL A;  4HAZ B;  5C6R A;  4GMX B;  1EAZ A;  1FHW A;  3G9W A;  1V5U A;  2J59 M;  2D9Y A;  3WYF B;  2D9Z A;  3QWM A;  1ZSQ A;  1V5M A;  2I1K A;  3LJU X;  2ROZ B;  4Z2N A;  1TJ6 A;  4PQ0 A;  2ELB A;  3SUZ A;  3VOQ A;  3KRW A;  1MIZ B;  1GC7 A;  3X23 A;  2QKL A;  1UPR A;  2KCJ A;  4KHB B;  3ZVR A;  3BIN A;  2L1C A;  5M4Y B;  1OQN A;  5J3T A;  2Z0Q A;  4YL8 A;  1DBH A;  3F5R A;  2GJY A;  4HAX B;  1FGY A;  1FHX A;  4WSF A;  2Z59 A;  5CLQ B;  2MDX A;  2R2Y A;  1ZYI A;  4K2P A;  3PZD A;  4K2O A;  2RLO A;  4ZRJ A;  3A98 B;  2P8V A;  2I1J A;  3UZT A;  1PFJ A;  3PVL A;  3GYO A;  4KHA A;  1V88 A;  2Z13 A;  3NWD A;  2DHI A;  4C0A A;  5JHG A;  2LKO A;  2UZS A;  2P0F A;  5DI9 B;  1PMS A;  5LON B;  5J3Y A;  2L2I A;  2YS1 A;  2COD A;  2CY5 A;  4QXA B;  4HAT B;  2EMT A;  3HW2 B;  2LOX A;  5D3W A;  3TCA A;  4B6H A;  1FAO A;  2YVC A;  2RGN B;  3A8Q A;  1NTV A;  2KR0 A;  2V76 A;  2COF A;  4CHM A;  1ZVR A;  4YON A;  1RRP B;  2KUP A;  4HHV A;  4KVG B;  2J0J A;  4BBK A;  2K2J A;  1UEF A;  1U27 A;  4GPT B;  2EJ8 A;  1H10 A;  2Y7B A;  4KHB A;  3FSS A;  1UNR A;  3BJI A;  2UZR A;  4K17 A;  1XOD A;  1M7R A;  1P6S A;  4MT7 A;  3SNH A;  2D2Q A;  2EC1 A;  1UPQ A;  1E5W A;  3A58 A;  5I2S A;  5EFX A;  4Z2M B;  3ULB A;  1NI2 A;  3U8Z A;  2COA A;  4HDQ A;  4TYZ A;  4F7U P;  3D8D A;  4IAP A;  2RNR B;  2VSZ A;  1V5P A;  3PEG A;  2CRF A;  1XCG A;  3MDB C;  4A5K A;  5J3Q A;  2DTC A;  3PG7 A;  3HK0 A;  1UNP A;  4F7H A;  4HAY B;  3A8P A;  4WJ7 A;  2DLW A;  3OHM B;  2OTX A;  2Z0P A;  1ISN A;  3U7D A;  4EMO A;  3ODX A;  5IRS A;  5JHH A;  4HSI A;  5C79 A;  3CXB B;  2CAY A;  3HQC A;  1LW3 A;  1BTK A;  4CHJ A;  2DX1 A;  2DKQ A;  2D11 A;  2GS0 A;  1DYN A;  2DYQ A; 
#chains in the Genus database with same CATH homology
 3OAN A;  2VKI A;  1BTN A;  4K81 A;  3O96 A;  5CLL B;  4HAV B;  3D8F A;  4KHO A;  3GYP A;  1KI1 B;  2I5C A;  1W1H A;  3FM8 C;  3PP2 A;  4Y94 A;  1FHO A;  4H8S A;  4KAX B;  1AWE A;  2HE7 A;  3SV1 A;  4ZRI A;  2I5F A;  2DN6 A;  5C16 A;  1MK7 B;  2UVM A;  2GCJ A;  1I2H A;  4HB3 B;  4PNK A;  1K5D B;  1WGU A;  2M38 A;  4HB4 B;  4GZU A;  2K00 A;  1GC6 A;  1WJM A;  1NU2 A;  3P7Z A;  5DHF B;  4EJN A;  1Y5O A;  2DYN A;  2D9V A;  2YS5 A;  1DDV A;  2AEH A;  4A6K A;  1V89 A;  2HTH B;  2ADZ A;  2NMB A;  2W2X D;  4HDO A;  3KSY A;  4DX8 A;  5GOW B;  1BWN A;  2YT0 A;  2ZPY A;  1OMW A;  2RSG A;  4A6H A;  1WGQ A;  3TFM A;  2W2W A;  1SGH A;  1BAK A;  2W2X C;  2Q13 A;  2M14 A;  5D3V A;  3PVU A;  3KY9 A;  2NZ8 B;  1U5D A;  5D27 A;  4MY6 A;  1U29 A;  2AL6 A;  2IFS A;  5FI1 A;  2P0D A;  5L81 A;  3AU5 A;  5DH9 B;  3DXD A;  2DHK A;  2CY4 A;  2LYD A;  1LB1 A;  3SO6 A;  1Z87 A;  2JP2 A;  5LOP B;  1X11 A;  4GXB A;  5JP4 A;  2IYB A;  2LOZ A;  5HE0 A;  2DFK A;  4MK0 A;  1I7A A;  5HE2 A;  2Y8F A;  4GMV A;  4EKU A;  3M1I B;  1MIX A;  5JLJ B;  5C5B B;  3V5W A;  2YRY A;  1WJ1 A;  1FOE A;  2YS3 A;  1ZC4 B;  1MAI A;  2ROV A;  3QBV B;  1MK9 B;  1XD4 A;  3AU4 A;  1TXD A;  3MPX A;  1J19 A;  5KQ1 A;  1U2B A;  2LG1 A;  1FB8 A;  1B55 A;  5KCV A;  4DX9 0;  2COC A;  2Z0O A;  2YT1 A;  3KRX A;  1W1D A;  1XX0 A;  4HB0 B;  2H7D A;  1EGX A;  1N3H A;  2N0Y A;  5D3Y A;  4HAU B;  2VRW B;  3IVF A;  2DHJ A;  2D4Q A;  4TKN A;  1X05 A;  1W1G A;  1Q67 A;  5FI0 A;  2RVB B;  1TQZ A;  4D0N B;  3SYX A;  3ULC A;  2DX5 A;  1FGZ A;  4F7G A;  1X1G A;  1U5G A;  4P7I A;  1WI1 A;  1AQC A;  1H4R A;  3TO1 A;  2J0M A;  1OY2 A;  3T06 A;  5HE3 A;  1GG3 A;  1J0W A;  2YF0 A;  3DXE A;  1EVH A;  2Y8G A;  5DIF B;  1KZ7 A;  3RCP A;  4GN1 A;  1XKE A;  4HB2 B;  1WG7 A;  5KQ4 A;  2PZ1 A;  2G35 A;  1P5T A;  3DXC A;  5C5B A;  1ZM0 A;  1DDM A;  5HE1 A;  2DKP A;  2D9X A;  2MFQ A;  3KZ1 A;  3TW1 A;  1DDW A;  3FEH A;  4IFS A;  3WA0 A;  1IRS A;  1Y19 B;  4A6F A;  1WVH A;  1U5E A;  2DA0 A;  2J0K A;  4NSW A;  3ZDT A;  1X86 A;  1EF1 A;  1XR0 B;  2R09 A;  3P6A A;  4IOY X;  3TVV A;  3ODO A;  4CYE A;  4WVF B;  2YSZ A;  2E2X A;  3PSC A;  3VIA A;  1UNQ A;  3ODW A;  5D3X A;  4DBB A;  2EMS A;  2OQB A;  2X18 A;  2KGX B;  1ZC3 B;  1P3R A;  2ELA A;  1QC6 A;  4ZRK A;  1X1F A;  1DRO A;  2QKM A;  2MWN B;  1MKE A;  1PLS A;  1U5F A;  2XQN M;  2D9W A;  2P0H A;  3F0W A;  2H7E A;  3D8E A;  3NSU A;  2BCJ A;  3CIK A;  1SHC A;  5DHA B;  1KZG A;  4XWX A;  4HAW B;  1K5G B;  2MKR A;  3PVW A;  1V61 A;  2D10 A;  2K2U A;  3N7C A;  4A6F B;  3QIJ A;  4L6E A;  1NTY A;  2N23 A;  4DXA B;  1RJ2 A;  2GCL A;  2R0D A;  3AJ4 A;  4NY0 A;  2RUK B;  2LUL A;  3ML4 A;  1M7E A;  1MPH A;  1QQG A;  2FJL A;  4HAZ B;  5C6R A;  4GMX B;  1EAZ A;  1FHW A;  3G9W A;  1V5U A;  2J59 M;  2D9Y A;  3WYF B;  2D9Z A;  3QWM A;  1ZSQ A;  1V5M A;  2I1K A;  3LJU X;  2ROZ B;  4Z2N A;  1TJ6 A;  4PQ0 A;  2ELB A;  3SUZ A;  3VOQ A;  3KRW A;  1MIZ B;  1GC7 A;  3X23 A;  2QKL A;  1UPR A;  2KCJ A;  4KHB B;  3ZVR A;  3BIN A;  2L1C A;  1OQN A;  5J3T A;  2Z0Q A;  4YL8 A;  1DBH A;  3F5R A;  2GJY A;  4HAX B;  1FGY A;  1FHX A;  4WSF A;  5CLQ B;  2MDX A;  4K2P A;  3PZD A;  4K2O A;  2RLO A;  4ZRJ A;  3A98 B;  2P8V A;  2I1J A;  3UZT A;  1PFJ A;  3PVL A;  3GYO A;  4KHA A;  1V88 A;  4C0A A;  2DHI A;  5JHG A;  2LKO A;  2UZS A;  2P0F A;  5DI9 B;  1PMS A;  5LON B;  5J3Y A;  2L2I A;  2YS1 A;  2COD A;  2CY5 A;  4HAT B;  2EMT A;  3HW2 B;  2LOX A;  5D3W A;  3TCA A;  4B6H A;  1FAO A;  2YVC A;  2RGN B;  3A8Q A;  1NTV A;  2V76 A;  2COF A;  4CHM A;  1ZVR A;  4YON A;  1RRP B;  2KUP A;  4HHV A;  4KVG B;  2J0J A;  4BBK A;  2K2J A;  1UEF A;  1U27 A;  4GPT B;  2EJ8 A;  1H10 A;  2Y7B A;  3FSS A;  1UNR A;  3BJI A;  2UZR A;  4K17 A;  1XOD A;  1M7R A;  1P6S A;  4MT7 A;  3SNH A;  2D2Q A;  2EC1 A;  1UPQ A;  1E5W A;  5EFX A;  4Z2M B;  3ULB A;  1NI2 A;  3U8Z A;  2COA A;  4HDQ A;  4TYZ A;  4F7U P;  3D8D A;  4IAP A;  2RNR B;  2VSZ A;  1V5P A;  3PEG A;  2CRF A;  1XCG A;  3MDB C;  4A5K A;  5J3Q A;  2DTC A;  3PG7 A;  3HK0 A;  1UNP A;  4F7H A;  4HAY B;  3A8P A;  4WJ7 A;  2DLW A;  2OTX A;  2Z0P A;  1ISN A;  3U7D A;  4EMO A;  3ODX A;  5JHH A;  5C79 A;  3CXB B;  2CAY A;  3HQC A;  1LW3 A;  1BTK A;  4CHJ A;  2DX1 A;  2DKQ A;  2D11 A;  2GS0 A;  1DYN A;  2DYQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...