2RSGA

Solution structure of the cert ph domain
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
94
structure length
94
Chain Sequence
VERCGVLSKWTNYIHGWQDRWVVLKNNALSYYKSEDETEYGCRGSICLSKAVITPHDFDECRFDISVNDSVWYLRAQDPDHRQQWIDAIEQHKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the Golgi association by the pleckstrin homology domain of the ceramide trafficking protein (CERT)
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lipid transport
molecule keywords Collagen type IV alpha-3-binding protein
total genus 15
structure length 94
sequence length 94
ec nomenclature
pdb deposition date 2012-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2rsgA00
1BTKA 4HB3B 2YS5A 4HAVB 4IFSA 2XQNM 2ZPYA 3P7ZA 1MAIA 1W1GA 3ODOA 1P3RA 5DHAB 4K17A 1IRSA 2W2WA 1FAOA 5J3YA 3TW1A 1FHXA 2DA0A 4KAXB 1DBHA 2DHIA 2D10A 4DXAB 2D9ZA 2I5CA 3PZDA 4K2PA 5HE3A 4F7GA 2D9WA 3FM8C 4A6KA 3ZVRA 3KSYA 1M7EA 3TFMA 4GN1A 2UVMA 2DX5A 2I5FA 2CY5A 4HB4B 4EKUA 1UPQA 3U7DA 1LB1A 1EGXA 5J3QA 2Z0QA 2COCA 5FI1A 1N3HA 3HW2B 5DHFB 2ROZB 4HHVA 4NY0A 4WSFA 2R09A 2DFKA 1U5EA 3MDBC 4KHBB 4K2OA 2VRWB 1U27A 2CY4A 1XKEA 2YS1A 1U5DA 4ZRJA 5DH9B 1WGUA 2RNRB 4B6HA 1U2BA 2HTHB 3SO6A 1V61A 4XWXA 4WVFB 4HATB 3GYPA 2AEHA 2M14A 3T06A 5D3VA 4F7HA 1Q67A 1PLSA 4A6FB 1OQNA 1TXDA 4Y94A 5HE0A 3P6AA 2RSGA 2YT0A 2DX1A 2W2XD 2NZ8B 2KCJA 4GZUA 3ZDTA 2PZ1A 1K5GB 4P7IA 2IYBA 1WGQA 3HQCA 3FEHA 2Y7BA 2RVBB 1UNQA 2GCJA 5EFXA 3WA0A 3UZTA 1DDVA 2W2XC 2X18A 1FOEA 3ULBA 1KZ7A 4HDOA 1H10A 1WJMA 1X11A 1NI2A 2VSZA 1GC6A 2Y8GA 2L1CA 2D2QA 1B55A 3AU4A 5C16A 3FSSA 1QC6A 5LONB 2NMBA 3AU5A 3SYXA 2P8VA 3MPXA 3KRXA 1DDMA 2CODA 2DN6A 2K2UA 2DKQA 3HK0A 3ODWA 3TVVA 1UNPA 2Z0PA 4HAYB 4PNKA 5KCVA 1UPRA 3SNHA 1GG3A 4CHMA 1ZM0A 2IFSA 1XCGA 3QIJA 1J0WA 3PP2A 5HE1A 1XD4A 3VOQA 2Z0OA 1W1HA 2FJLA 3A98B 5C6RA 1WI1A 4TKNA 2E2XA 2P0FA 4H8SA 1NTYA 2EMSA 4A6FA 3A8QA 2QKMA 4D0NB 1DYNA 4TYZA 5C79A 3OANA 2H7DA 2DHKA 5D3XA 3CXBB 2J0JA 2OQBA 3PVWA 4YL8A 2DTCA 1J19A 2N0YA 4HAWB 1V89A 3X23A 2I1KA 4DX8A 1FHOA 4Z2NA 1EVHA 3ODXA 4NSWA 2KUPA 2AL6A 2P0HA 2GS0A 2YT1A 2MWNB 5D27A 2DHJA 1ZVRA 2ELAA 3PEGA 1Y5OA 5HE2A 4KHOA 3CIKA 4BBKA 1PMSA 1XR0B 3KY9A 2K2JA 2VKIA 4Z2MB 2P0DA 3PG7A 3DXDA 5C5BA 3AJ4A 4A6HA 1OMWA 3SUZA 2LULA 1X1GA 1BWNA 2GCLA 4ZRKA 2MKRA 1UNRA 1GC7A 4IOYX 1MK7B 4WJ7A 4GPTB 2LOXA 1W1DA 1QQGA 1V88A 1TJ6A 3O96A 2ADZA 4CHJA 1Z87A 2V76A 3NSUA 4DX90 3F5RA 1EAZA 1U5FA 5JHHA 1FB8A 3GYOA 2RLOA 2UZRA 3WYFB 4HDQA 5CLLB 3F0WA 1WG7A 2EMTA 2YSZA 2YRYA 4IAPA 2D4QA 5J3TA 4ZRIA 1BTNA 2CRFA 1NU2A 3KZ1A 3ULCA 1I7AA 3M1IB 2DYQA 3V5WA 3D8FA 1EF1A 1ZC3B 1KI1B 1RJ2A 1E5WA 3DXEA 1OY2A 3SV1A 4GMXB 2KGXB 4CYEA 3LJUX 4GXBA 2M38A 1NTVA 1ZSQA 1TQZA 2I1JA 5D3WA 4F7UP 1BAKA 5FI0A 1DDWA 1SHCA 1P5TA 1AWEA 4KVGB 2LYDA 2UZSA 2QKLA 3TO1A 1DROA 4EJNA 2DKPA 1WVHA 4YONA 1K5DB 3BJIA 1U29A 3D8DA 2YVCA 4HB0B 1MIXA 5JHGA 2COFA 2EC1A 1MKEA 2K00A 2LG1A 4A5KA 1MK9B 2L2IA 2D11A 4HAZB 5CLQB 3PVLA 3PVUA 1MPHA 3TCAA 1ISNA 5DIFB 1M7RA 2LKOA 1SGHA 1UEFA 3A8PA 5KQ1A 2HE7A 5JLJB 1WJ1A 2RGNB 4HAUB 1X05A 1V5PA 2MFQA 4MK0A 3PSCA 4KHAA 2Q13A 4EMOA 5DI9B 3VIAA 2EJ8A 4PQ0A 3QBVB 4MT7A 1X1FA 2OTXA 4HB2B 2D9VA 4HAXB 1ZC4B 5D3YA 3RCPA 2DYNA 5L81A 1MIZB 2CAYA 1FGYA 5C5BB 1Y19B 2LOZA 3D8EA 1U5GA 4K81A 1LW3A 1XX0A 1KZGA 2COAA 4C0AA 3DXCA 2ELBA 1V5UA 2J59M 1RRPB 2Y8FA 2R0DA 3N7CA 3IVFA 2YS3A 2H7EA 2MDXA 1FHWA 2JP2A 1AQCA 4L6EA 2D9XA 2J0MA 1FGZA 2ROVA 5KQ4A 2N23A 2GJYA 5JP4A 2D9YA 2G35A 3G9WA 1X86A 2BCJA 3BINA 1V5MA 1H4RA 1I2HA 1P6SA 4MY6A 2YF0A 3QWMA 5GOWB 1XODA 4GMVA 2DLWA 5LOPB 1PFJA 2RUKB 3ML4A 3U8ZA 4DBBA 3KRWA 2J0KA
chains in the Genus database with same CATH superfamily
4QXAB 1BTKA 4HB3B 2YS5A 2Z14A 4HAVB 4IFSA 2XQNM 3P7ZA 2ZPYA 1MAIA 1W1GA 3ODOA 1P3RA 5DHAB 4K17A 1IRSA 2W2WA 1FAOA 5J3YA 3TW1A 1FHXA 2DA0A 4KAXB 1DBHA 2DHIA 2D10A 4DXAB 2D9ZA 2I5CA 3PZDA 4K2PA 5HE3A 4F7GA 2D9WA 3FM8C 4A6KA 3ZVRA 3KSYA 1M7EA 3TFMA 3OHMB 4GN1A 2UVMA 2DX5A 2I5FA 2CY5A 4HB4B 4CSQA 4EKUA 1UPQA 3U7DA 1LB1A 1EGXA 5J3QA 2Z0QA 2COCA 5FI1A 1N3HA 3HW2B 5DHFB 2ROZB 4HHVA 4NY0A 4WSFA 2R09A 2DFKA 1U5EA 3MDBC 4KHBB 4K2OA 2VRWB 1U27A 2CY4A 1XKEA 2YS1A 1U5DA 4ZRJA 5DH9B 4HSIA 1WGUA 4GNKB 2RNRB 4B6HA 1U2BA 2HTHB 3SO6A 1V61A 4XWXA 4WVFB 4HATB 3GYPA 2AEHA 2M14A 3T06A 5D3VA 4F7HA 5I2SA 1Q67A 1PLSA 2KR0A 5I2MA 4A6FB 1OQNA 1TXDA 4Y94A 5HE0A 3P6AA 2RSGA 2YT0A 2DX1A 2W2XD 2NZ8B 2KCJA 4GZUA 3ZDTA 2PZ1A 1K5GB 4P7IA 2IYBA 1WGQA 3HQCA 3B77A 3U12A 3FEHA 2KIGA 2FJUB 2R2YA 2Y7BA 2RVBB 1UNQA 2GCJA 5EFXA 3WA0A 3UZTA 1DDVA 2W2XC 2X18A 1FOEA 3ULBA 1KZ7A 4HDOA 1H10A 1WJMA 1X11A 1NI2A 2VSZA 1GC6A 2Y8GA 2L1CA 2D2QA 1B55A 3AU4A 5C16A 3FSSA 2YT2A 1QC6A 5LONB 2NMBA 2KUQA 3AU5A 3SYXA 2P8VA 3MPXA 3KRXA 1DDMA 2CODA 2DN6A 2K2UA 2DKQA 3HK0A 3DCXA 3ODWA 3TVVA 1UNPA 2Z0PA 4HAYB 4PNKA 5KCVA 1UPRA 3SNHA 1GG3A 4CHMA 1ZM0A 2IFSA 1XCGA 3QIJA 1J0WA 3PP2A 5HE1A 1XD4A 3VOQA 2Z0OA 1W1HA 2FJLA 1MI1A 3A98B 5C6RA 1WI1A 4TKNA 5M4YB 2E2XA 2P0FA 4H8SA 1NTYA 2EMSA 4A6FA 3A8QA 2QKMA 4D0NB 1DYNA 4TYZA 5C79A 3NWAA 3OANA 2H7DA 2DHKA 5D3XA 3CXBB 4QJ5B 2J0JA 2OQBA 3PVWA 4YL8A 2DTCA 1J19A 2N0YA 4HAWB 1V89A 3X23A 4QJ3B 2KIEA 2I1KA 4DX8A 1FHOA 4Z2NA 1EVHA 3ODXA 4NSWA 3HSAA 2KUPA 2AL6A 2P0HA 2GS0A 2YT1A 2MWNB 5D27A 2DHJA 1ZVRA 2ELAA 3PEGA 1Y5OA 5HE2A 4KHOA 3CIKA 4BBKA 1PMSA 1XR0B 3KY9A 2K2JA 2VKIA 4Z2MB 2P0DA 3PG7A 2K8EA 3DXDA 5C5BA 3AJ4A 4A6HA 1OMWA 3SUZA 2LULA 1X1GA 3NW8A 1BWNA 2GCLA 4ZRKA 2MKRA 1UNRA 1GC7A 4IOYX 1MK7B 4WJ7A 4GPTB 2LOXA 1W1DA 1QQGA 1V88A 1TJ6A 3O96A 2ADZA 4CHJA 1Z87A 2V76A 3NSUA 4DX90 3F5RA 1EAZA 1U5FA 5JHHA 1FB8A 3GYOA 2NBVA 2RLOA 2UZRA 3WYFB 5LG4B 4HDQA 5CLLB 3F0WA 1WG7A 2EMTA 2YSZA 2YRYA 4IAPA 2D4QA 5J3TA 1T77A 4ZRIA 4OT1A 1BTNA 2CRFA 1NU2A 3KZ1A 3ULCA 4D6WA 1I7AA 3M1IB 2DYQA 3V5WA 3D8FA 1EF1A 1ZC3B 1KI1B 1RJ2A 1E5WA 2Z13A 4KHBA 3DXEA 1OY2A 3SV1A 4GMXB 2KGXB 4CYEA 5IRSA 3LJUX 4GXBA 2M38A 1NTVA 1ZSQA 1TQZA 2I1JA 5D3WA 3HIEA 3FVCA 4F7UP 1BAKA 5FI0A 1DDWA 1SHCA 1P5TA 1AWEA 4KVGB 2LYDA 2UZSA 2QKLA 3TO1A 1DROA 4EJNA 4OSNA 2DKPA 1WVHA 4YONA 1K5DB 3BJIA 2GUMA 1U29A 3D8DA 2YVCA 4HB0B 1MIXA 5JHGA 2COFA 2EC1A 1MKEA 2K00A 2LG1A 4A5KA 1MK9B 2L2IA 2D11A 4HAZB 5CLQB 3PVLA 3PVUA 1MPHA 3TCAA 1ISNA 3NWFA 5DIFB 1M7RA 2LKOA 1SGHA 1UEFA 3A8PA 5KQ1A 2HE7A 5JLJB 1WJ1A 2RGNB 4HAUB 1X05A 1V5PA 2MFQA 4MK0A 3PSCA 4KHAA 2Q13A 4EMOA 5DI9B 3VIAA 2EJ8A 2RRFA 3QBVB 4PQ0A 4MT7A 4GOUA 1X1FA 2OTXA 4HB2B 2D9VA 4HAXB 1ZC4B 5D3YA 3RCPA 2DYNA 5L81A 4L1RA 1MIZB 2CAYA 1FGYA 4QJ4B 5C5BB 1Y19B 2LOZA 1ZYIA 3D8EA 1U5GA 4K81A 1LW3A 1XX0A 1KZGA 2COAA 4C0AA 3DXCA 2ELBA 1V5UA 2J59M 1RRPB 2Y8FA 2R0DA 3A58A 3N7CA 3IVFA 2YS3A 2H7EA 2MDXA 1FHWA 2JP2A 1AQCA 4L6EA 2Z4DA 2D9XA 3NWDA 2J0MA 1FGZA 2ROVA 5KQ4A 2N23A 2ZKMX 2GJYA 5JP4A 2D9YA 2K49A 2G35A 3G9WA 1X86A 2BCJA 3BINA 1V5MA 1H4RA 1I2HA 1P6SA 4MY6A 2YF0A 3QWMA 5GOWB 1XODA 4GMVA 2DLWA 4DIXA 5LOPB 1PFJA 2RUKB 3ML4A 3U8ZA 4DBBA 2Z59A 3KRWA 2J0KA
chains in the Genus database with same CATH topology
1BTKA 4HB3B 2YS5A 4HAVB 4IFSA 2XQNM 2ZPYA 3P7ZA 1MAIA 1W1GA 3ODOA 1P3RA 5DHAB 4K17A 1IRSA 2W2WA 1FAOA 5J3YA 3TW1A 1FHXA 2DA0A 4KAXB 1DBHA 2DHIA 2D10A 4DXAB 2D9ZA 2I5CA 3PZDA 4K2PA 5HE3A 4F7GA 2D9WA 3FM8C 4A6KA 3ZVRA 3KSYA 1M7EA 3TFMA 4GN1A 2UVMA 2DX5A 2I5FA 2CY5A 4HB4B 4EKUA 1UPQA 3U7DA 1LB1A 1EGXA 5J3QA 2Z0QA 2COCA 5FI1A 1N3HA 3HW2B 5DHFB 2ROZB 4HHVA 4NY0A 4WSFA 2R09A 2DFKA 1U5EA 3MDBC 4KHBB 4K2OA 2VRWB 1U27A 2CY4A 1XKEA 2YS1A 1U5DA 4ZRJA 5DH9B 1WGUA 2RNRB 4B6HA 1U2BA 2HTHB 3SO6A 1V61A 4XWXA 4WVFB 4HATB 3GYPA 2AEHA 2M14A 3T06A 5D3VA 4F7HA 1Q67A 1PLSA 4A6FB 1OQNA 1TXDA 4Y94A 5HE0A 3P6AA 2RSGA 2YT0A 2DX1A 2W2XD 2NZ8B 2KCJA 4GZUA 3ZDTA 2PZ1A 1K5GB 4P7IA 2IYBA 1WGQA 3HQCA 3FEHA 2Y7BA 2RVBB 1UNQA 2GCJA 5EFXA 3WA0A 3UZTA 1DDVA 2W2XC 2X18A 1FOEA 3ULBA 1KZ7A 4HDOA 1H10A 1WJMA 1X11A 1NI2A 2VSZA 1GC6A 2Y8GA 2L1CA 2D2QA 1B55A 3AU4A 5C16A 3FSSA 1QC6A 5LONB 2NMBA 3AU5A 3SYXA 2P8VA 3MPXA 3KRXA 1DDMA 2CODA 2DN6A 2K2UA 2DKQA 3HK0A 3ODWA 3TVVA 1UNPA 2Z0PA 4HAYB 4PNKA 5KCVA 1UPRA 3SNHA 1GG3A 4CHMA 1ZM0A 2IFSA 1XCGA 3QIJA 1J0WA 3PP2A 5HE1A 1XD4A 3VOQA 2Z0OA 1W1HA 2FJLA 3A98B 5C6RA 1WI1A 4TKNA 2E2XA 2P0FA 4H8SA 1NTYA 2EMSA 4A6FA 3A8QA 2QKMA 4D0NB 1DYNA 4TYZA 5C79A 3OANA 2H7DA 2DHKA 5D3XA 3CXBB 2J0JA 2OQBA 3PVWA 4YL8A 2DTCA 1J19A 2N0YA 4HAWB 1V89A 3X23A 2I1KA 4DX8A 1FHOA 4Z2NA 1EVHA 3ODXA 4NSWA 2KUPA 2AL6A 2P0HA 2GS0A 2YT1A 2MWNB 5D27A 2DHJA 1ZVRA 2ELAA 3PEGA 1Y5OA 5HE2A 4KHOA 3CIKA 4BBKA 1PMSA 1XR0B 3KY9A 2K2JA 2VKIA 4Z2MB 2P0DA 3PG7A 3DXDA 5C5BA 3AJ4A 4A6HA 1OMWA 3SUZA 2LULA 1X1GA 1BWNA 2GCLA 4ZRKA 2MKRA 1UNRA 1GC7A 4IOYX 1MK7B 4WJ7A 4GPTB 2LOXA 1W1DA 1QQGA 1V88A 1TJ6A 3O96A 2ADZA 4CHJA 1Z87A 2V76A 3NSUA 4DX90 3F5RA 1EAZA 1U5FA 5JHHA 1FB8A 3GYOA 2RLOA 2UZRA 3WYFB 4HDQA 5CLLB 3F0WA 1WG7A 2EMTA 2YSZA 2YRYA 4IAPA 2D4QA 5J3TA 4ZRIA 1BTNA 2CRFA 1NU2A 3KZ1A 3ULCA 1I7AA 3M1IB 2DYQA 3V5WA 3D8FA 1EF1A 1ZC3B 1KI1B 1RJ2A 1E5WA 3DXEA 1OY2A 3SV1A 4GMXB 2KGXB 4CYEA 3LJUX 4GXBA 2M38A 1NTVA 1ZSQA 1TQZA 2I1JA 5D3WA 4F7UP 1BAKA 5FI0A 1DDWA 1SHCA 1P5TA 1AWEA 4KVGB 2LYDA 2UZSA 2QKLA 3TO1A 1DROA 4EJNA 2DKPA 1WVHA 4YONA 1K5DB 3BJIA 1U29A 3D8DA 2YVCA 4HB0B 1MIXA 5JHGA 2COFA 2EC1A 1MKEA 2K00A 2LG1A 4A5KA 1MK9B 2L2IA 2D11A 4HAZB 5CLQB 3PVLA 3PVUA 1MPHA 3TCAA 1ISNA 5DIFB 1M7RA 2LKOA 1SGHA 1UEFA 3A8PA 5KQ1A 2HE7A 5JLJB 1WJ1A 2RGNB 4HAUB 1X05A 1V5PA 2MFQA 4MK0A 3PSCA 4KHAA 2Q13A 4EMOA 5DI9B 3VIAA 2EJ8A 4PQ0A 3QBVB 4MT7A 1X1FA 2OTXA 4HB2B 2D9VA 4HAXB 1ZC4B 5D3YA 3RCPA 2DYNA 5L81A 1MIZB 2CAYA 1FGYA 5C5BB 1Y19B 2LOZA 3D8EA 1U5GA 4K81A 1LW3A 1XX0A 1KZGA 2COAA 4C0AA 3DXCA 2ELBA 1V5UA 2J59M 1RRPB 2Y8FA 2R0DA 3N7CA 3IVFA 2YS3A 2H7EA 2MDXA 1FHWA 2JP2A 1AQCA 4L6EA 2D9XA 2J0MA 1FGZA 2ROVA 5KQ4A 2N23A 2GJYA 5JP4A 2D9YA 2G35A 3G9WA 1X86A 2BCJA 3BINA 1V5MA 1H4RA 1I2HA 1P6SA 4MY6A 2YF0A 3QWMA 5GOWB 1XODA 4GMVA 2DLWA 5LOPB 1PFJA 2RUKB 3ML4A 3U8ZA 4DBBA 3KRWA 2J0KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BTK A;  4HB3 B;  2YS5 A;  4HAV B;  4IFS A;  2XQN M;  2ZPY A;  3P7Z A;  1MAI A;  1W1G A;  3ODO A;  1P3R A;  5DHA B;  4K17 A;  1IRS A;  2W2W A;  1FAO A;  5J3Y A;  3TW1 A;  1FHX A;  2DA0 A;  4KAX B;  1DBH A;  2DHI A;  2D10 A;  4DXA B;  2D9Z A;  2I5C A;  3PZD A;  4K2P A;  5HE3 A;  4F7G A;  2D9W A;  3FM8 C;  4A6K A;  3ZVR A;  3KSY A;  1M7E A;  3TFM A;  4GN1 A;  2UVM A;  2DX5 A;  2I5F A;  2CY5 A;  4HB4 B;  4EKU A;  1UPQ A;  3U7D A;  1LB1 A;  1EGX A;  5J3Q A;  2Z0Q A;  2COC A;  5FI1 A;  1N3H A;  3HW2 B;  5DHF B;  2ROZ B;  4HHV A;  4NY0 A;  4WSF A;  2R09 A;  2DFK A;  1U5E A;  3MDB C;  4KHB B;  4K2O A;  2VRW B;  1U27 A;  2CY4 A;  1XKE A;  2YS1 A;  1U5D A;  4ZRJ A;  5DH9 B;  1WGU A;  2RNR B;  4B6H A;  1U2B A;  2HTH B;  3SO6 A;  1V61 A;  4XWX A;  4WVF B;  4HAT B;  3GYP A;  2AEH A;  2M14 A;  3T06 A;  5D3V A;  4F7H A;  1Q67 A;  1PLS A;  4A6F B;  1OQN A;  1TXD A;  4Y94 A;  5HE0 A;  3P6A A;  2RSG A;  2YT0 A;  2DX1 A;  2W2X D;  2NZ8 B;  2KCJ A;  4GZU A;  3ZDT A;  2PZ1 A;  1K5G B;  4P7I A;  2IYB A;  1WGQ A;  3HQC A;  3FEH A;  2Y7B A;  2RVB B;  1UNQ A;  2GCJ A;  5EFX A;  3WA0 A;  3UZT A;  1DDV A;  2W2X C;  2X18 A;  1FOE A;  3ULB A;  1KZ7 A;  4HDO A;  1H10 A;  1WJM A;  1X11 A;  1NI2 A;  2VSZ A;  1GC6 A;  2Y8G A;  2L1C A;  2D2Q A;  1B55 A;  3AU4 A;  5C16 A;  3FSS A;  1QC6 A;  5LON B;  2NMB A;  3AU5 A;  3SYX A;  2P8V A;  3MPX A;  3KRX A;  1DDM A;  2COD A;  2DN6 A;  2K2U A;  2DKQ A;  3HK0 A;  3ODW A;  3TVV A;  1UNP A;  2Z0P A;  4HAY B;  4PNK A;  5KCV A;  1UPR A;  3SNH A;  1GG3 A;  4CHM A;  1ZM0 A;  2IFS A;  1XCG A;  3QIJ A;  1J0W A;  3PP2 A;  5HE1 A;  1XD4 A;  3VOQ A;  2Z0O A;  1W1H A;  2FJL A;  3A98 B;  5C6R A;  1WI1 A;  4TKN A;  2E2X A;  2P0F A;  4H8S A;  1NTY A;  2EMS A;  4A6F A;  3A8Q A;  2QKM A;  4D0N B;  1DYN A;  4TYZ A;  5C79 A;  3OAN A;  2H7D A;  2DHK A;  5D3X A;  3CXB B;  2J0J A;  2OQB A;  3PVW A;  4YL8 A;  2DTC A;  1J19 A;  2N0Y A;  4HAW B;  1V89 A;  3X23 A;  2I1K A;  4DX8 A;  1FHO A;  4Z2N A;  1EVH A;  3ODX A;  4NSW A;  2KUP A;  2AL6 A;  2P0H A;  2GS0 A;  2YT1 A;  2MWN B;  5D27 A;  2DHJ A;  1ZVR A;  2ELA A;  3PEG A;  1Y5O A;  5HE2 A;  4KHO A;  3CIK A;  4BBK A;  1PMS A;  1XR0 B;  3KY9 A;  2K2J A;  2VKI A;  4Z2M B;  2P0D A;  3PG7 A;  3DXD A;  5C5B A;  3AJ4 A;  4A6H A;  1OMW A;  3SUZ A;  2LUL A;  1X1G A;  1BWN A;  2GCL A;  4ZRK A;  2MKR A;  1UNR A;  1GC7 A;  4IOY X;  1MK7 B;  4WJ7 A;  4GPT B;  2LOX A;  1W1D A;  1QQG A;  1V88 A;  1TJ6 A;  3O96 A;  2ADZ A;  4CHJ A;  1Z87 A;  2V76 A;  3NSU A;  4DX9 0;  3F5R A;  1EAZ A;  1U5F A;  5JHH A;  1FB8 A;  3GYO A;  2RLO A;  2UZR A;  3WYF B;  4HDQ A;  5CLL B;  3F0W A;  1WG7 A;  2EMT A;  2YSZ A;  2YRY A;  4IAP A;  2D4Q A;  5J3T A;  4ZRI A;  1BTN A;  2CRF A;  1NU2 A;  3KZ1 A;  3ULC A;  1I7A A;  3M1I B;  2DYQ A;  3V5W A;  3D8F A;  1EF1 A;  1ZC3 B;  1KI1 B;  1RJ2 A;  1E5W A;  3DXE A;  1OY2 A;  3SV1 A;  4GMX B;  2KGX B;  4CYE A;  3LJU X;  4GXB A;  2M38 A;  1NTV A;  1ZSQ A;  1TQZ A;  2I1J A;  5D3W A;  4F7U P;  1BAK A;  5FI0 A;  1DDW A;  1SHC A;  1P5T A;  1AWE A;  4KVG B;  2LYD A;  2UZS A;  2QKL A;  3TO1 A;  1DRO A;  4EJN A;  2DKP A;  1WVH A;  4YON A;  1K5D B;  3BJI A;  1U29 A;  3D8D A;  2YVC A;  4HB0 B;  1MIX A;  5JHG A;  2COF A;  2EC1 A;  1MKE A;  2K00 A;  2LG1 A;  4A5K A;  1MK9 B;  2L2I A;  2D11 A;  4HAZ B;  5CLQ B;  3PVL A;  3PVU A;  1MPH A;  3TCA A;  1ISN A;  5DIF B;  1M7R A;  2LKO A;  1SGH A;  1UEF A;  3A8P A;  5KQ1 A;  2HE7 A;  5JLJ B;  1WJ1 A;  2RGN B;  4HAU B;  1X05 A;  1V5P A;  2MFQ A;  4MK0 A;  3PSC A;  4KHA A;  2Q13 A;  4EMO A;  5DI9 B;  3VIA A;  2EJ8 A;  4PQ0 A;  3QBV B;  4MT7 A;  1X1F A;  2OTX A;  4HB2 B;  2D9V A;  4HAX B;  1ZC4 B;  5D3Y A;  3RCP A;  2DYN A;  5L81 A;  1MIZ B;  2CAY A;  1FGY A;  5C5B B;  1Y19 B;  2LOZ A;  3D8E A;  1U5G A;  4K81 A;  1LW3 A;  1XX0 A;  1KZG A;  2COA A;  4C0A A;  3DXC A;  2ELB A;  1V5U A;  2J59 M;  1RRP B;  2Y8F A;  2R0D A;  3N7C A;  3IVF A;  2YS3 A;  2H7E A;  2MDX A;  1FHW A;  2JP2 A;  1AQC A;  4L6E A;  2D9X A;  2J0M A;  1FGZ A;  2ROV A;  5KQ4 A;  2N23 A;  2GJY A;  5JP4 A;  2D9Y A;  2G35 A;  3G9W A;  1X86 A;  2BCJ A;  3BIN A;  1V5M A;  1H4R A;  1I2H A;  1P6S A;  4MY6 A;  2YF0 A;  3QWM A;  5GOW B;  1XOD A;  4GMV A;  2DLW A;  5LOP B;  1PFJ A;  2RUK B;  3ML4 A;  3U8Z A;  4DBB A;  3KRW A;  2J0K A; 
#chains in the Genus database with same CATH topology
 4QXA B;  1BTK A;  4HB3 B;  2YS5 A;  2Z14 A;  4HAV B;  4IFS A;  2XQN M;  3P7Z A;  2ZPY A;  1MAI A;  1W1G A;  3ODO A;  1P3R A;  5DHA B;  4K17 A;  1IRS A;  2W2W A;  1FAO A;  5J3Y A;  3TW1 A;  1FHX A;  2DA0 A;  4KAX B;  1DBH A;  2DHI A;  2D10 A;  4DXA B;  2D9Z A;  2I5C A;  3PZD A;  4K2P A;  5HE3 A;  4F7G A;  2D9W A;  3FM8 C;  4A6K A;  3ZVR A;  3KSY A;  1M7E A;  3TFM A;  3OHM B;  4GN1 A;  2UVM A;  2DX5 A;  2I5F A;  2CY5 A;  4HB4 B;  4CSQ A;  4EKU A;  1UPQ A;  3U7D A;  1LB1 A;  1EGX A;  5J3Q A;  2Z0Q A;  2COC A;  5FI1 A;  1N3H A;  3HW2 B;  5DHF B;  2ROZ B;  4HHV A;  4NY0 A;  4WSF A;  2R09 A;  2DFK A;  1U5E A;  3MDB C;  4KHB B;  4K2O A;  2VRW B;  1U27 A;  2CY4 A;  1XKE A;  2YS1 A;  1U5D A;  4ZRJ A;  5DH9 B;  4HSI A;  1WGU A;  4GNK B;  2RNR B;  4B6H A;  1U2B A;  2HTH B;  3SO6 A;  1V61 A;  4XWX A;  4WVF B;  4HAT B;  3GYP A;  2AEH A;  2M14 A;  3T06 A;  5D3V A;  4F7H A;  5I2S A;  1Q67 A;  1PLS A;  2KR0 A;  5I2M A;  4A6F B;  1OQN A;  1TXD A;  4Y94 A;  5HE0 A;  3P6A A;  2RSG A;  2YT0 A;  2DX1 A;  2W2X D;  2NZ8 B;  2KCJ A;  4GZU A;  3ZDT A;  2PZ1 A;  1K5G B;  4P7I A;  2IYB A;  1WGQ A;  3HQC A;  3B77 A;  3U12 A;  3FEH A;  2KIG A;  2FJU B;  2R2Y A;  2Y7B A;  2RVB B;  1UNQ A;  2GCJ A;  5EFX A;  3WA0 A;  3UZT A;  1DDV A;  2W2X C;  2X18 A;  1FOE A;  3ULB A;  1KZ7 A;  4HDO A;  1H10 A;  1WJM A;  1X11 A;  1NI2 A;  2VSZ A;  1GC6 A;  2Y8G A;  2L1C A;  2D2Q A;  1B55 A;  3AU4 A;  5C16 A;  3FSS A;  2YT2 A;  1QC6 A;  5LON B;  2NMB A;  2KUQ A;  3AU5 A;  3SYX A;  2P8V A;  3MPX A;  3KRX A;  1DDM A;  2COD A;  2DN6 A;  2K2U A;  2DKQ A;  3HK0 A;  3DCX A;  3ODW A;  3TVV A;  1UNP A;  2Z0P A;  4HAY B;  4PNK A;  5KCV A;  1UPR A;  3SNH A;  1GG3 A;  4CHM A;  1ZM0 A;  2IFS A;  1XCG A;  3QIJ A;  1J0W A;  3PP2 A;  5HE1 A;  1XD4 A;  3VOQ A;  2Z0O A;  1W1H A;  2FJL A;  1MI1 A;  3A98 B;  5C6R A;  1WI1 A;  4TKN A;  5M4Y B;  2E2X A;  2P0F A;  4H8S A;  1NTY A;  2EMS A;  4A6F A;  3A8Q A;  2QKM A;  4D0N B;  1DYN A;  4TYZ A;  5C79 A;  3NWA A;  3OAN A;  2H7D A;  2DHK A;  5D3X A;  3CXB B;  4QJ5 B;  2J0J A;  2OQB A;  3PVW A;  4YL8 A;  2DTC A;  1J19 A;  2N0Y A;  4HAW B;  1V89 A;  3X23 A;  4QJ3 B;  2KIE A;  2I1K A;  4DX8 A;  1FHO A;  4Z2N A;  1EVH A;  3ODX A;  4NSW A;  3HSA A;  2KUP A;  2AL6 A;  2P0H A;  2GS0 A;  2YT1 A;  2MWN B;  5D27 A;  2DHJ A;  1ZVR A;  2ELA A;  3PEG A;  1Y5O A;  5HE2 A;  4KHO A;  3CIK A;  4BBK A;  1PMS A;  1XR0 B;  3KY9 A;  2K2J A;  2VKI A;  4Z2M B;  2P0D A;  3PG7 A;  2K8E A;  3DXD A;  5C5B A;  3AJ4 A;  4A6H A;  1OMW A;  3SUZ A;  2LUL A;  1X1G A;  3NW8 A;  1BWN A;  2GCL A;  4ZRK A;  2MKR A;  1UNR A;  1GC7 A;  4IOY X;  1MK7 B;  4WJ7 A;  4GPT B;  2LOX A;  1W1D A;  1QQG A;  1V88 A;  1TJ6 A;  3O96 A;  2ADZ A;  4CHJ A;  1Z87 A;  2V76 A;  3NSU A;  4DX9 0;  3F5R A;  1EAZ A;  1U5F A;  5JHH A;  1FB8 A;  3GYO A;  2NBV A;  2RLO A;  2UZR A;  3WYF B;  5LG4 B;  4HDQ A;  5CLL B;  3F0W A;  1WG7 A;  2EMT A;  2YSZ A;  2YRY A;  4IAP A;  2D4Q A;  5J3T A;  1T77 A;  4ZRI A;  4OT1 A;  1BTN A;  2CRF A;  1NU2 A;  3KZ1 A;  3ULC A;  4D6W A;  1I7A A;  3M1I B;  2DYQ A;  3V5W A;  3D8F A;  1EF1 A;  1ZC3 B;  1KI1 B;  1RJ2 A;  1E5W A;  2Z13 A;  4KHB A;  3DXE A;  1OY2 A;  3SV1 A;  4GMX B;  2KGX B;  4CYE A;  5IRS A;  3LJU X;  4GXB A;  2M38 A;  1NTV A;  1ZSQ A;  1TQZ A;  2I1J A;  5D3W A;  3HIE A;  3FVC A;  4F7U P;  1BAK A;  5FI0 A;  1DDW A;  1SHC A;  1P5T A;  1AWE A;  4KVG B;  2LYD A;  2UZS A;  2QKL A;  3TO1 A;  1DRO A;  4EJN A;  4OSN A;  2DKP A;  1WVH A;  4YON A;  1K5D B;  3BJI A;  2GUM A;  1U29 A;  3D8D A;  2YVC A;  4HB0 B;  1MIX A;  5JHG A;  2COF A;  2EC1 A;  1MKE A;  2K00 A;  2LG1 A;  4A5K A;  1MK9 B;  2L2I A;  2D11 A;  4HAZ B;  5CLQ B;  3PVL A;  3PVU A;  1MPH A;  3TCA A;  1ISN A;  3NWF A;  5DIF B;  1M7R A;  2LKO A;  1SGH A;  1UEF A;  3A8P A;  5KQ1 A;  2HE7 A;  5JLJ B;  1WJ1 A;  2RGN B;  4HAU B;  1X05 A;  1V5P A;  2MFQ A;  4MK0 A;  3PSC A;  4KHA A;  2Q13 A;  4EMO A;  5DI9 B;  3VIA A;  2EJ8 A;  2RRF A;  3QBV B;  4PQ0 A;  4MT7 A;  4GOU A;  1X1F A;  2OTX A;  4HB2 B;  2D9V A;  4HAX B;  1ZC4 B;  5D3Y A;  3RCP A;  2DYN A;  5L81 A;  4L1R A;  1MIZ B;  2CAY A;  1FGY A;  4QJ4 B;  5C5B B;  1Y19 B;  2LOZ A;  1ZYI A;  3D8E A;  1U5G A;  4K81 A;  1LW3 A;  1XX0 A;  1KZG A;  2COA A;  4C0A A;  3DXC A;  2ELB A;  1V5U A;  2J59 M;  1RRP B;  2Y8F A;  2R0D A;  3A58 A;  3N7C A;  3IVF A;  2YS3 A;  2H7E A;  2MDX A;  1FHW A;  2JP2 A;  1AQC A;  4L6E A;  2Z4D A;  2D9X A;  3NWD A;  2J0M A;  1FGZ A;  2ROV A;  5KQ4 A;  2N23 A;  2ZKM X;  2GJY A;  5JP4 A;  2D9Y A;  2K49 A;  2G35 A;  3G9W A;  1X86 A;  2BCJ A;  3BIN A;  1V5M A;  1H4R A;  1I2H A;  1P6S A;  4MY6 A;  2YF0 A;  3QWM A;  5GOW B;  1XOD A;  4GMV A;  2DLW A;  4DIX A;  5LOP B;  1PFJ A;  2RUK B;  3ML4 A;  3U8Z A;  4DBB A;  2Z59 A;  3KRW A;  2J0K A; 
#chains in the Genus database with same CATH homology
 1BTK A;  4HB3 B;  2YS5 A;  4HAV B;  4IFS A;  2XQN M;  2ZPY A;  3P7Z A;  1MAI A;  1W1G A;  3ODO A;  1P3R A;  5DHA B;  4K17 A;  1IRS A;  2W2W A;  1FAO A;  5J3Y A;  3TW1 A;  1FHX A;  2DA0 A;  4KAX B;  1DBH A;  2DHI A;  2D10 A;  4DXA B;  2D9Z A;  2I5C A;  3PZD A;  4K2P A;  5HE3 A;  4F7G A;  2D9W A;  3FM8 C;  4A6K A;  3ZVR A;  3KSY A;  1M7E A;  3TFM A;  4GN1 A;  2UVM A;  2DX5 A;  2I5F A;  2CY5 A;  4HB4 B;  4EKU A;  1UPQ A;  3U7D A;  1LB1 A;  1EGX A;  5J3Q A;  2Z0Q A;  2COC A;  5FI1 A;  1N3H A;  3HW2 B;  5DHF B;  2ROZ B;  4HHV A;  4NY0 A;  4WSF A;  2R09 A;  2DFK A;  1U5E A;  3MDB C;  4KHB B;  4K2O A;  2VRW B;  1U27 A;  2CY4 A;  1XKE A;  2YS1 A;  1U5D A;  4ZRJ A;  5DH9 B;  1WGU A;  2RNR B;  4B6H A;  1U2B A;  2HTH B;  3SO6 A;  1V61 A;  4XWX A;  4WVF B;  4HAT B;  3GYP A;  2AEH A;  2M14 A;  3T06 A;  5D3V A;  4F7H A;  1Q67 A;  1PLS A;  4A6F B;  1OQN A;  1TXD A;  4Y94 A;  5HE0 A;  3P6A A;  2RSG A;  2YT0 A;  2DX1 A;  2W2X D;  2NZ8 B;  2KCJ A;  4GZU A;  3ZDT A;  2PZ1 A;  1K5G B;  4P7I A;  2IYB A;  1WGQ A;  3HQC A;  3FEH A;  2Y7B A;  2RVB B;  1UNQ A;  2GCJ A;  5EFX A;  3WA0 A;  3UZT A;  1DDV A;  2W2X C;  2X18 A;  1FOE A;  3ULB A;  1KZ7 A;  4HDO A;  1H10 A;  1WJM A;  1X11 A;  1NI2 A;  2VSZ A;  1GC6 A;  2Y8G A;  2L1C A;  2D2Q A;  1B55 A;  3AU4 A;  5C16 A;  3FSS A;  1QC6 A;  5LON B;  2NMB A;  3AU5 A;  3SYX A;  2P8V A;  3MPX A;  3KRX A;  1DDM A;  2COD A;  2DN6 A;  2K2U A;  2DKQ A;  3HK0 A;  3ODW A;  3TVV A;  1UNP A;  2Z0P A;  4HAY B;  4PNK A;  5KCV A;  1UPR A;  3SNH A;  1GG3 A;  4CHM A;  1ZM0 A;  2IFS A;  1XCG A;  3QIJ A;  1J0W A;  3PP2 A;  5HE1 A;  1XD4 A;  3VOQ A;  2Z0O A;  1W1H A;  2FJL A;  3A98 B;  5C6R A;  1WI1 A;  4TKN A;  2E2X A;  2P0F A;  4H8S A;  1NTY A;  2EMS A;  4A6F A;  3A8Q A;  2QKM A;  4D0N B;  1DYN A;  4TYZ A;  5C79 A;  3OAN A;  2H7D A;  2DHK A;  5D3X A;  3CXB B;  2J0J A;  2OQB A;  3PVW A;  4YL8 A;  2DTC A;  1J19 A;  2N0Y A;  4HAW B;  1V89 A;  3X23 A;  2I1K A;  4DX8 A;  1FHO A;  4Z2N A;  1EVH A;  3ODX A;  4NSW A;  2KUP A;  2AL6 A;  2P0H A;  2GS0 A;  2YT1 A;  2MWN B;  5D27 A;  2DHJ A;  1ZVR A;  2ELA A;  3PEG A;  1Y5O A;  5HE2 A;  4KHO A;  3CIK A;  4BBK A;  1PMS A;  1XR0 B;  3KY9 A;  2K2J A;  2VKI A;  4Z2M B;  2P0D A;  3PG7 A;  3DXD A;  5C5B A;  3AJ4 A;  4A6H A;  1OMW A;  3SUZ A;  2LUL A;  1X1G A;  1BWN A;  2GCL A;  4ZRK A;  2MKR A;  1UNR A;  1GC7 A;  4IOY X;  1MK7 B;  4WJ7 A;  4GPT B;  2LOX A;  1W1D A;  1QQG A;  1V88 A;  1TJ6 A;  3O96 A;  2ADZ A;  4CHJ A;  1Z87 A;  2V76 A;  3NSU A;  4DX9 0;  3F5R A;  1EAZ A;  1U5F A;  5JHH A;  1FB8 A;  3GYO A;  2RLO A;  2UZR A;  3WYF B;  4HDQ A;  5CLL B;  3F0W A;  1WG7 A;  2EMT A;  2YSZ A;  2YRY A;  4IAP A;  2D4Q A;  5J3T A;  4ZRI A;  1BTN A;  2CRF A;  1NU2 A;  3KZ1 A;  3ULC A;  1I7A A;  3M1I B;  2DYQ A;  3V5W A;  3D8F A;  1EF1 A;  1ZC3 B;  1KI1 B;  1RJ2 A;  1E5W A;  3DXE A;  1OY2 A;  3SV1 A;  4GMX B;  2KGX B;  4CYE A;  3LJU X;  4GXB A;  2M38 A;  1NTV A;  1ZSQ A;  1TQZ A;  2I1J A;  5D3W A;  4F7U P;  1BAK A;  5FI0 A;  1DDW A;  1SHC A;  1P5T A;  1AWE A;  4KVG B;  2LYD A;  2UZS A;  2QKL A;  3TO1 A;  1DRO A;  4EJN A;  2DKP A;  1WVH A;  4YON A;  1K5D B;  3BJI A;  1U29 A;  3D8D A;  2YVC A;  4HB0 B;  1MIX A;  5JHG A;  2COF A;  2EC1 A;  1MKE A;  2K00 A;  2LG1 A;  4A5K A;  1MK9 B;  2L2I A;  2D11 A;  4HAZ B;  5CLQ B;  3PVL A;  3PVU A;  1MPH A;  3TCA A;  1ISN A;  5DIF B;  1M7R A;  2LKO A;  1SGH A;  1UEF A;  3A8P A;  5KQ1 A;  2HE7 A;  5JLJ B;  1WJ1 A;  2RGN B;  4HAU B;  1X05 A;  1V5P A;  2MFQ A;  4MK0 A;  3PSC A;  4KHA A;  2Q13 A;  4EMO A;  5DI9 B;  3VIA A;  2EJ8 A;  4PQ0 A;  3QBV B;  4MT7 A;  1X1F A;  2OTX A;  4HB2 B;  2D9V A;  4HAX B;  1ZC4 B;  5D3Y A;  3RCP A;  2DYN A;  5L81 A;  1MIZ B;  2CAY A;  1FGY A;  5C5B B;  1Y19 B;  2LOZ A;  3D8E A;  1U5G A;  4K81 A;  1LW3 A;  1XX0 A;  1KZG A;  2COA A;  4C0A A;  3DXC A;  2ELB A;  1V5U A;  2J59 M;  1RRP B;  2Y8F A;  2R0D A;  3N7C A;  3IVF A;  2YS3 A;  2H7E A;  2MDX A;  1FHW A;  2JP2 A;  1AQC A;  4L6E A;  2D9X A;  2J0M A;  1FGZ A;  2ROV A;  5KQ4 A;  2N23 A;  2GJY A;  5JP4 A;  2D9Y A;  2G35 A;  3G9W A;  1X86 A;  2BCJ A;  3BIN A;  1V5M A;  1H4R A;  1I2H A;  1P6S A;  4MY6 A;  2YF0 A;  3QWM A;  5GOW B;  1XOD A;  4GMV A;  2DLW A;  5LOP B;  1PFJ A;  2RUK B;  3ML4 A;  3U8Z A;  4DBB A;  3KRW A;  2J0K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...