2RSGA

Solution structure of the cert ph domain
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
94
structure length
94
Chain Sequence
b'VERCGVLSKWTNYIHGWQDRWVVLKNNALSYYKSEDETEYGCRGSICLSKAVITPHDFDECRFDISVNDSVWYLRAQDPDHRQQWIDAIEQHKT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Collagen type IV alpha-3-binding protein
publication title Structural basis for the Golgi association by the pleckstrin homology domain of the ceramide trafficking protein (CERT)
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lipid transport
total genus 15
structure length 94
sequence length 94
ec nomenclature
pdb deposition date 2012-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2rsgA00
4HAYB 4BBKA 1OQNA 3TO1A 2W2WA 1TQZA 2PZ1A 2GS0A 4GPTB 2Z0QA 1UNPA 1MK7B 3A8QA 2ELBA 4CHMA 4EKUA 1BWNA 4DBBA 3SO6A 4PQ0A 1AWEA 2H7EA 2NMBA 4EMOA 2K00A 1M7RA 1E5WA 2H7DA 4EJNA 4XWXA 3CIKA 1H4RA 2D11A 3FEHA 2P0FA 3T06A 5LOPB 2RNRB 5LONB 2N0YA 4KVGB 1FB8A 1NI2A 4PNKA 3KRXA 4MT7A 1GC6A 4A6FA 1EGXA 1RRPB 2W2XC 1B55A 4TYZA 1UPRA 3A98B 2D10A 2CAYA 2D4QA 1X1GA 5D3VA 3KSYA 1KZ7A 1UPQA 1X11A 3SNHA 2XQNM 2Y8GA 2V76A 3DXCA 2DX5A 1FGYA 1WI1A 2Y8FA 3AU4A 3TCAA 1MAIA 2L1CA 4HB2B 2VRWB 2X18A 5HE3A 2KUPA 3LJUX 2YT1A 2G35A 3V5WA 4HB0B 4KHOA 4F7UP 2MWNB 1Y19B 2EMSA 2LKOA 2YT0A 2DKQA 2DHKA 1ZM0A 2KCJA 3PVWA 1BAKA 2ELAA 1ZVRA 4DX90 1V88A 4MY6A 4K2OA 1MKEA 2CY5A 1FAOA 5JP4A 5DH9B 1UEFA 5CLLB 2I1JA 2KGXB 4NY0A 2DKPA 4GMXB 1MIXA 1DDWA 1SGHA 4YL8A 3VOQA 2RGNB 1P6SA 5L81A 1DDMA 1SHCA 1OY2A 3D8EA 4HDQA 2LOZA 1WG7A 4HAZB 4Y94A 5FI0A 5KQ1A 2VKIA 5HE2A 5FI1A 1PFJA 4ZRIA 3NSUA 4DXAB 4D0NB 3O96A 2D9YA 4WSFA 3ZDTA 3SUZA 4CYEA 2DHIA 2VSZA 3P7ZA 5C5BB 2I1KA 3FM8C 1U29A 1I2HA 1ZSQA 2JP2A 2ZPYA 4Z2MB 1V5PA 2LG1A 2QKMA 4KHBB 1WVHA 3PZDA 2RLOA 1BTKA 1K5DB 2I5FA 3D8DA 1IRSA 1WJ1A 1PLSA 1OMWA 1XX0A 2P8VA 2DA0A 2MKRA 1I7AA 1W1DA 5C6RA 5D27A 3U8ZA 3PVUA 4HHVA 1AQCA 1WGUA 4K17A 4F7GA 2E2XA 2LYDA 4C0AA 4HAUB 1Y5OA 2W2XD 3WA0A 2DFKA 5DHAB 2FJLA 1XD4A 1K5GB 1FHWA 1XR0B 4GXBA 2R0DA 4HAWB 5C79A 4HB3B 5HE0A 2K2JA 2D9WA 1Z87A 1X05A 3KY9A 2OQBA 4IFSA 4P7IA 2COFA 2DYNA 2HE7A 2YRYA 2COCA 1N3HA 5HE1A 1MIZB 1V89A 1U5DA 1XCGA 3KZ1A 4B6HA 2UZRA 2YSZA 1EVHA 4MK0A 4KHAA 1U27A 1NTVA 4HAXB 4A5KA 5DI9B 1NU2A 1P3RA 2GCLA 4GMVA 4GZUA 3QBVB 3PP2A 4HATB 4WJ7A 4A6KA 5J3TA 3RCPA 3KRWA 1DROA 3GYOA 4WVFB 1MK9B 4CHJA 3WYFB 5D3YA 5C5BA 3TW1A 1V5MA 5D3WA 2DTCA 3DXDA 3MDBC 4YONA 4A6FB 2J59M 3GYPA 1U5EA 3SV1A 1GG3A 5KCVA 2D9XA 4NSWA 1M7EA 2AL6A 1NTYA 5DHFB 2IFSA 3ODXA 4ZRKA 2D2QA 2QKLA 1UNRA 1J19A 2RVBB 1W1GA 3ODWA 1RJ2A 1XODA 2DLWA 2DYQA 2COAA 4IAPA 2Q13A 2ROZB 1XKEA 3PG7A 3G9WA 3QIJA 1U5GA 2AEHA 3N7CA 3M1IB 2J0JA 5KQ4A 1X1FA 5JHGA 4H8SA 2J0MA 3F0WA 3UZTA 1Q67A 3HK0A 1V5UA 2NZ8B 4Z2NA 3ODOA 3ULBA 5J3YA 2YS5A 3ML4A 4HB4B 1FOEA 2YVCA 3A8PA 5GOWB 1TJ6A 1KZGA 4ZRJA 2GJYA 2MFQA 3P6AA 1TXDA 3F5RA 2CRFA 1PMSA 2RUKB 1UNQA 3MPXA 5J3QA 3HQCA 3BINA 4L6EA 5DIFB 3SYXA 1J0WA 3PSCA 1FHOA 2I5CA 5JHHA 3QWMA 1DYNA 2YS3A 2IYBA 4A6HA 2K2UA 2P0HA 1BTNA 4K2PA 2UVMA 1LW3A 1ISNA 1EAZA 2DHJA 4GN1A 2Z0PA 2ROVA 5EFXA 3ZVRA 1WJMA 1KI1B 2M14A 5D3XA 1EF1A 4HAVB 2J0KA 2YF0A 5C16A 2D9VA 1U2BA 3PEGA 2UZSA 2CY4A 3IVFA 2M38A 4DX8A 1ZC4B 2MDXA 3HW2B 3ULCA 4TKNA 3X23A 2ADZA 2D9ZA 2EJ8A 2BCJA 2Y7BA 4KAXB 1DDVA 1W1HA 2EC1A 3OANA 3BJIA 1ZC3B 2OTXA 2GCJA 1QC6A 1FGZA 1FHXA 4K81A 1GC7A 2RSGA 2DN6A 3U7DA 1P5TA 5JLJB 3VIAA 1H10A 2L2IA 1MPHA 1V61A 2EMTA 2LULA 4F7HA 3CXBB 2N23A 3DXEA 3TFMA 2HTHB 2Z0OA 3AU5A 2CODA 2YS1A 2LOXA 1DBHA 3D8FA 3PVLA 2R09A 2DX1A 1WGQA 1X86A 4IOYX 3TVVA 3FSSA 3AJ4A 1U5FA 1QQGA 4HDOA 5CLQB 1LB1A 2P0DA
chains in the Genus database with same CATH superfamily
1ZYIA 4HAYB 4BBKA 1OQNA 3TO1A 2GUMA 2W2WA 1TQZA 2PZ1A 2GS0A 4GPTB 2Z0QA 1UNPA 1MK7B 3A8QA 2ZKMX 2ELBA 3U12A 4CHMA 4EKUA 1BWNA 4DBBA 3SO6A 4PQ0A 1AWEA 2H7EA 4QJ4B 2NMBA 4EMOA 2K00A 1M7RA 1E5WA 2H7DA 4EJNA 4XWXA 3NWFA 3CIKA 1H4RA 2D11A 3FEHA 2P0FA 3T06A 5LOPB 2RNRB 5LONB 2N0YA 4KVGB 1FB8A 1NI2A 4PNKA 3KRXA 4MT7A 2Z59A 1GC6A 4A6FA 1EGXA 1RRPB 2W2XC 1B55A 4TYZA 1UPRA 3A98B 4GOUA 2D10A 2CAYA 2D4QA 1X1GA 5D3VA 4OSNA 3KSYA 1KZ7A 1UPQA 1X11A 3SNHA 2XQNM 2Y8GA 2V76A 3DXCA 2DX5A 1FGYA 1WI1A 3A58A 2Y8FA 3AU4A 3TCAA 1MAIA 2L1CA 4HB2B 2VRWB 2X18A 5HE3A 2KUPA 3LJUX 2YT1A 2G35A 3V5WA 4HB0B 4KHOA 4F7UP 2MWNB 1Y19B 2EMSA 2LKOA 2YT0A 2DKQA 2DHKA 1ZM0A 2KCJA 3OHMB 3PVWA 1BAKA 2ELAA 1ZVRA 4DX90 1V88A 1MI1A 4MY6A 4K2OA 1MKEA 2CY5A 1FAOA 5JP4A 5DH9B 1UEFA 5CLLB 2I1JA 2KGXB 4NY0A 2DKPA 4GMXB 1MIXA 1DDWA 1SGHA 4GNKB 4YL8A 5LG4B 3VOQA 2RGNB 1P6SA 5L81A 1DDMA 1SHCA 1OY2A 3D8EA 4HDQA 2LOZA 1WG7A 4HAZB 4Y94A 5FI0A 5KQ1A 2VKIA 5HE2A 5FI1A 1PFJA 4ZRIA 3NSUA 4DXAB 4D0NB 3O96A 2D9YA 4HSIA 4WSFA 3ZDTA 3SUZA 4CYEA 2DHIA 2VSZA 3P7ZA 5C5BB 2I1KA 3FM8C 1U29A 4QJ5B 1I2HA 1ZSQA 2JP2A 2NBVA 2ZPYA 4Z2MB 1V5PA 2LG1A 2QKMA 4KHBB 1WVHA 3PZDA 2RLOA 1BTKA 1K5DB 2I5FA 3B77A 1IRSA 1WJ1A 3D8DA 1PLSA 1OMWA 1XX0A 2P8VA 2DA0A 2MKRA 1I7AA 2Z4DA 1W1DA 5C6RA 5D27A 3U8ZA 3PVUA 4HHVA 1AQCA 1WGUA 4K17A 4F7GA 2E2XA 2LYDA 2FJUB 4C0AA 4HAUB 1Y5OA 2W2XD 3WA0A 2DFKA 3HSAA 5DHAB 2FJLA 1XD4A 1K5GB 1FHWA 1XR0B 4GXBA 5I2MA 2R0DA 2KR0A 4HAWB 5C79A 4HB3B 5HE0A 2K2JA 5I2SA 2D9WA 1Z87A 1X05A 3KY9A 2OQBA 2K49A 4IFSA 4P7IA 2COFA 2DYNA 2HE7A 2YRYA 2KUQA 2COCA 1N3HA 5HE1A 1MIZB 1V89A 4OT1A 1U5DA 2K8EA 1XCGA 3KZ1A 4B6HA 2UZRA 2YSZA 1EVHA 4MK0A 4KHAA 4QXAB 3NW8A 1U27A 1NTVA 4HAXB 4A5KA 2Z13A 5DI9B 1NU2A 1P3RA 2GCLA 4GMVA 4GZUA 3QBVB 3PP2A 4HATB 4WJ7A 2RRFA 4A6KA 5J3TA 4L1RA 2R2YA 3RCPA 3KRWA 1DROA 3GYOA 4WVFB 1MK9B 2YT2A 4QJ3B 4CHJA 3WYFB 5D3YA 5C5BA 3TW1A 1V5MA 2Z14A 5D3WA 2DTCA 3DXDA 3MDBC 4YONA 4A6FB 2J59M 3GYPA 1U5EA 3SV1A 1GG3A 1T77A 5KCVA 2D9XA 4NSWA 1M7EA 2AL6A 1NTYA 5DHFB 2IFSA 3DCXA 3ODXA 4ZRKA 2D2QA 2QKLA 1UNRA 1J19A 2RVBB 1W1GA 3NWAA 3ODWA 4D6WA 1RJ2A 1XODA 2DLWA 2DYQA 2COAA 4IAPA 2Q13A 5IRSA 2ROZB 1XKEA 3PG7A 3G9WA 3QIJA 1U5GA 2AEHA 3N7CA 3M1IB 2J0JA 5KQ4A 1X1FA 5JHGA 4H8SA 2J0MA 3F0WA 3UZTA 1Q67A 3HK0A 1V5UA 2NZ8B 4Z2NA 3ODOA 3ULBA 5J3YA 2YS5A 3ML4A 4HB4B 1FOEA 2YVCA 3A8PA 5GOWB 1TJ6A 1KZGA 4ZRJA 2GJYA 2MFQA 3P6AA 1TXDA 3F5RA 2CRFA 1PMSA 2RUKB 1UNQA 3MPXA 5J3QA 3HQCA 3BINA 4L6EA 5DIFB 3SYXA 1J0WA 3PSCA 1FHOA 2I5CA 5JHHA 3HIEA 3QWMA 4CSQA 4DIXA 1DYNA 2YS3A 2IYBA 4A6HA 2K2UA 2P0HA 1BTNA 4K2PA 2UVMA 1LW3A 1ISNA 1EAZA 2DHJA 4GN1A 2Z0PA 2ROVA 5EFXA 3ZVRA 1WJMA 1KI1B 2M14A 5D3XA 1EF1A 4HAVB 2J0KA 2YF0A 5C16A 2D9VA 1U2BA 3PEGA 2UZSA 2CY4A 3IVFA 2M38A 4DX8A 1ZC4B 3HW2B 2MDXA 3ULCA 4TKNA 3X23A 3NWDA 2ADZA 5M4YB 2D9ZA 2EJ8A 2BCJA 2Y7BA 4KAXB 1DDVA 4KHBA 1W1HA 2EC1A 3OANA 3BJIA 1ZC3B 2OTXA 2GCJA 1QC6A 1FGZA 1FHXA 4K81A 1GC7A 2RSGA 2DN6A 3U7DA 1P5TA 3FVCA 5JLJB 3VIAA 1H10A 2L2IA 1MPHA 1V61A 2EMTA 2LULA 4F7HA 3CXBB 2N23A 3DXEA 3TFMA 2HTHB 2Z0OA 3AU5A 2CODA 2YS1A 2LOXA 1DBHA 3D8FA 3PVLA 2KIEA 2DX1A 2R09A 1WGQA 1X86A 2KIGA 4IOYX 3TVVA 3FSSA 3AJ4A 1U5FA 1QQGA 4HDOA 5CLQB 1LB1A 2P0DA
chains in the Genus database with same CATH topology
4HAYB 4BBKA 1OQNA 3TO1A 2W2WA 1TQZA 2PZ1A 2GS0A 4GPTB 2Z0QA 1UNPA 1MK7B 3A8QA 2ELBA 4CHMA 4EKUA 1BWNA 4DBBA 3SO6A 4PQ0A 1AWEA 2H7EA 2NMBA 4EMOA 2K00A 1M7RA 1E5WA 2H7DA 4EJNA 4XWXA 3CIKA 1H4RA 2D11A 3FEHA 2P0FA 3T06A 5LOPB 2RNRB 5LONB 2N0YA 4KVGB 1FB8A 1NI2A 4PNKA 3KRXA 4MT7A 1GC6A 4A6FA 1EGXA 1RRPB 2W2XC 1B55A 4TYZA 1UPRA 3A98B 2D10A 2CAYA 2D4QA 1X1GA 5D3VA 3KSYA 1KZ7A 1UPQA 1X11A 3SNHA 2XQNM 2Y8GA 2V76A 3DXCA 2DX5A 1FGYA 1WI1A 2Y8FA 3AU4A 3TCAA 1MAIA 2L1CA 4HB2B 2VRWB 2X18A 5HE3A 2KUPA 3LJUX 2YT1A 2G35A 3V5WA 4HB0B 4KHOA 4F7UP 2MWNB 1Y19B 2EMSA 2LKOA 2YT0A 2DKQA 2DHKA 1ZM0A 2KCJA 3PVWA 1BAKA 2ELAA 1ZVRA 4DX90 1V88A 4MY6A 4K2OA 1MKEA 2CY5A 1FAOA 5JP4A 5DH9B 1UEFA 5CLLB 2I1JA 2KGXB 4NY0A 2DKPA 4GMXB 1MIXA 1DDWA 1SGHA 4YL8A 3VOQA 2RGNB 1P6SA 5L81A 1DDMA 1SHCA 1OY2A 3D8EA 4HDQA 2LOZA 1WG7A 4HAZB 4Y94A 5FI0A 5KQ1A 2VKIA 5HE2A 5FI1A 1PFJA 4ZRIA 3NSUA 4DXAB 4D0NB 3O96A 2D9YA 4WSFA 3ZDTA 3SUZA 4CYEA 2DHIA 2VSZA 3P7ZA 5C5BB 2I1KA 3FM8C 1U29A 1I2HA 1ZSQA 2JP2A 2ZPYA 4Z2MB 1V5PA 2LG1A 2QKMA 4KHBB 1WVHA 3PZDA 2RLOA 1BTKA 1K5DB 2I5FA 3D8DA 1IRSA 1WJ1A 1PLSA 1OMWA 1XX0A 2P8VA 2DA0A 2MKRA 1I7AA 1W1DA 5C6RA 5D27A 3U8ZA 3PVUA 4HHVA 1AQCA 1WGUA 4K17A 4F7GA 2E2XA 2LYDA 4C0AA 4HAUB 1Y5OA 2W2XD 3WA0A 2DFKA 5DHAB 2FJLA 1XD4A 1K5GB 1FHWA 1XR0B 4GXBA 2R0DA 4HAWB 5C79A 4HB3B 5HE0A 2K2JA 2D9WA 1Z87A 1X05A 3KY9A 2OQBA 4IFSA 4P7IA 2COFA 2DYNA 2HE7A 2YRYA 2COCA 1N3HA 5HE1A 1MIZB 1V89A 1U5DA 1XCGA 3KZ1A 4B6HA 2UZRA 2YSZA 1EVHA 4MK0A 4KHAA 1U27A 1NTVA 4HAXB 4A5KA 5DI9B 1NU2A 1P3RA 2GCLA 4GMVA 4GZUA 3QBVB 3PP2A 4HATB 4WJ7A 4A6KA 5J3TA 3RCPA 3KRWA 1DROA 3GYOA 4WVFB 1MK9B 4CHJA 3WYFB 5D3YA 5C5BA 3TW1A 1V5MA 5D3WA 2DTCA 3DXDA 3MDBC 4YONA 4A6FB 2J59M 3GYPA 1U5EA 3SV1A 1GG3A 5KCVA 2D9XA 4NSWA 1M7EA 2AL6A 1NTYA 5DHFB 2IFSA 3ODXA 4ZRKA 2D2QA 2QKLA 1UNRA 1J19A 2RVBB 1W1GA 3ODWA 1RJ2A 1XODA 2DLWA 2DYQA 2COAA 4IAPA 2Q13A 2ROZB 1XKEA 3PG7A 3G9WA 3QIJA 1U5GA 2AEHA 3N7CA 3M1IB 2J0JA 5KQ4A 1X1FA 5JHGA 4H8SA 2J0MA 3F0WA 3UZTA 1Q67A 3HK0A 1V5UA 2NZ8B 4Z2NA 3ODOA 3ULBA 5J3YA 2YS5A 3ML4A 4HB4B 1FOEA 2YVCA 3A8PA 5GOWB 1TJ6A 1KZGA 4ZRJA 2GJYA 2MFQA 3P6AA 1TXDA 3F5RA 2CRFA 1PMSA 2RUKB 1UNQA 3MPXA 5J3QA 3HQCA 3BINA 4L6EA 5DIFB 3SYXA 1J0WA 3PSCA 1FHOA 2I5CA 5JHHA 3QWMA 1DYNA 2YS3A 2IYBA 4A6HA 2K2UA 2P0HA 1BTNA 4K2PA 2UVMA 1LW3A 1ISNA 1EAZA 2DHJA 4GN1A 2Z0PA 2ROVA 5EFXA 3ZVRA 1WJMA 1KI1B 2M14A 5D3XA 1EF1A 4HAVB 2J0KA 2YF0A 5C16A 2D9VA 1U2BA 3PEGA 2UZSA 2CY4A 3IVFA 2M38A 4DX8A 1ZC4B 2MDXA 3HW2B 3ULCA 4TKNA 3X23A 2ADZA 2D9ZA 2EJ8A 2BCJA 2Y7BA 4KAXB 1DDVA 1W1HA 2EC1A 3OANA 3BJIA 1ZC3B 2OTXA 2GCJA 1QC6A 1FGZA 1FHXA 4K81A 1GC7A 2RSGA 2DN6A 3U7DA 1P5TA 5JLJB 3VIAA 1H10A 2L2IA 1MPHA 1V61A 2EMTA 2LULA 4F7HA 3CXBB 2N23A 3DXEA 3TFMA 2HTHB 2Z0OA 3AU5A 2CODA 2YS1A 2LOXA 1DBHA 3D8FA 3PVLA 2R09A 2DX1A 1WGQA 1X86A 4IOYX 3TVVA 3FSSA 3AJ4A 1U5FA 1QQGA 4HDOA 5CLQB 1LB1A 2P0DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HAY B;  4BBK A;  1OQN A;  3TO1 A;  2W2W A;  1TQZ A;  2PZ1 A;  2GS0 A;  4GPT B;  2Z0Q A;  1UNP A;  1MK7 B;  3A8Q A;  2ELB A;  4CHM A;  4EKU A;  1BWN A;  4DBB A;  3SO6 A;  4PQ0 A;  1AWE A;  2H7E A;  2NMB A;  4EMO A;  2K00 A;  1M7R A;  1E5W A;  2H7D A;  4EJN A;  4XWX A;  3CIK A;  1H4R A;  2D11 A;  3FEH A;  2P0F A;  3T06 A;  5LOP B;  2RNR B;  5LON B;  2N0Y A;  4KVG B;  1FB8 A;  1NI2 A;  4PNK A;  3KRX A;  4MT7 A;  1GC6 A;  4A6F A;  1EGX A;  1RRP B;  2W2X C;  1B55 A;  4TYZ A;  1UPR A;  3A98 B;  2D10 A;  2CAY A;  2D4Q A;  1X1G A;  5D3V A;  3KSY A;  1KZ7 A;  1UPQ A;  1X11 A;  3SNH A;  2XQN M;  2Y8G A;  2V76 A;  3DXC A;  2DX5 A;  1FGY A;  1WI1 A;  2Y8F A;  3AU4 A;  3TCA A;  1MAI A;  2L1C A;  4HB2 B;  2VRW B;  2X18 A;  5HE3 A;  2KUP A;  3LJU X;  2YT1 A;  2G35 A;  3V5W A;  4HB0 B;  4KHO A;  4F7U P;  2MWN B;  1Y19 B;  2EMS A;  2LKO A;  2YT0 A;  2DKQ A;  2DHK A;  1ZM0 A;  2KCJ A;  3PVW A;  1BAK A;  2ELA A;  1ZVR A;  4DX9 0;  1V88 A;  4MY6 A;  4K2O A;  1MKE A;  2CY5 A;  1FAO A;  5JP4 A;  5DH9 B;  1UEF A;  5CLL B;  2I1J A;  2KGX B;  4NY0 A;  2DKP A;  4GMX B;  1MIX A;  1DDW A;  1SGH A;  4YL8 A;  3VOQ A;  2RGN B;  1P6S A;  5L81 A;  1DDM A;  1SHC A;  1OY2 A;  3D8E A;  4HDQ A;  2LOZ A;  1WG7 A;  4HAZ B;  4Y94 A;  5FI0 A;  5KQ1 A;  2VKI A;  5HE2 A;  5FI1 A;  1PFJ A;  4ZRI A;  3NSU A;  4DXA B;  4D0N B;  3O96 A;  2D9Y A;  4WSF A;  3ZDT A;  3SUZ A;  4CYE A;  2DHI A;  2VSZ A;  3P7Z A;  5C5B B;  2I1K A;  3FM8 C;  1U29 A;  1I2H A;  1ZSQ A;  2JP2 A;  2ZPY A;  4Z2M B;  1V5P A;  2LG1 A;  2QKM A;  4KHB B;  1WVH A;  3PZD A;  2RLO A;  1BTK A;  1K5D B;  2I5F A;  3D8D A;  1IRS A;  1WJ1 A;  1PLS A;  1OMW A;  1XX0 A;  2P8V A;  2DA0 A;  2MKR A;  1I7A A;  1W1D A;  5C6R A;  5D27 A;  3U8Z A;  3PVU A;  4HHV A;  1AQC A;  1WGU A;  4K17 A;  4F7G A;  2E2X A;  2LYD A;  4C0A A;  4HAU B;  1Y5O A;  2W2X D;  3WA0 A;  2DFK A;  5DHA B;  2FJL A;  1XD4 A;  1K5G B;  1FHW A;  1XR0 B;  4GXB A;  2R0D A;  4HAW B;  5C79 A;  4HB3 B;  5HE0 A;  2K2J A;  2D9W A;  1Z87 A;  1X05 A;  3KY9 A;  2OQB A;  4IFS A;  4P7I A;  2COF A;  2DYN A;  2HE7 A;  2YRY A;  2COC A;  1N3H A;  5HE1 A;  1MIZ B;  1V89 A;  1U5D A;  1XCG A;  3KZ1 A;  4B6H A;  2UZR A;  2YSZ A;  1EVH A;  4MK0 A;  4KHA A;  1U27 A;  1NTV A;  4HAX B;  4A5K A;  5DI9 B;  1NU2 A;  1P3R A;  2GCL A;  4GMV A;  4GZU A;  3QBV B;  3PP2 A;  4HAT B;  4WJ7 A;  4A6K A;  5J3T A;  3RCP A;  3KRW A;  1DRO A;  3GYO A;  4WVF B;  1MK9 B;  4CHJ A;  3WYF B;  5D3Y A;  5C5B A;  3TW1 A;  1V5M A;  5D3W A;  2DTC A;  3DXD A;  3MDB C;  4YON A;  4A6F B;  2J59 M;  3GYP A;  1U5E A;  3SV1 A;  1GG3 A;  5KCV A;  2D9X A;  4NSW A;  1M7E A;  2AL6 A;  1NTY A;  5DHF B;  2IFS A;  3ODX A;  4ZRK A;  2D2Q A;  2QKL A;  1UNR A;  1J19 A;  2RVB B;  1W1G A;  3ODW A;  1RJ2 A;  1XOD A;  2DLW A;  2DYQ A;  2COA A;  4IAP A;  2Q13 A;  2ROZ B;  1XKE A;  3PG7 A;  3G9W A;  3QIJ A;  1U5G A;  2AEH A;  3N7C A;  3M1I B;  2J0J A;  5KQ4 A;  1X1F A;  5JHG A;  4H8S A;  2J0M A;  3F0W A;  3UZT A;  1Q67 A;  3HK0 A;  1V5U A;  2NZ8 B;  4Z2N A;  3ODO A;  3ULB A;  5J3Y A;  2YS5 A;  3ML4 A;  4HB4 B;  1FOE A;  2YVC A;  3A8P A;  5GOW B;  1TJ6 A;  1KZG A;  4ZRJ A;  2GJY A;  2MFQ A;  3P6A A;  1TXD A;  3F5R A;  2CRF A;  1PMS A;  2RUK B;  1UNQ A;  3MPX A;  5J3Q A;  3HQC A;  3BIN A;  4L6E A;  5DIF B;  3SYX A;  1J0W A;  3PSC A;  1FHO A;  2I5C A;  5JHH A;  3QWM A;  1DYN A;  2YS3 A;  2IYB A;  4A6H A;  2K2U A;  2P0H A;  1BTN A;  4K2P A;  2UVM A;  1LW3 A;  1ISN A;  1EAZ A;  2DHJ A;  4GN1 A;  2Z0P A;  2ROV A;  5EFX A;  3ZVR A;  1WJM A;  1KI1 B;  2M14 A;  5D3X A;  1EF1 A;  4HAV B;  2J0K A;  2YF0 A;  5C16 A;  2D9V A;  1U2B A;  3PEG A;  2UZS A;  2CY4 A;  3IVF A;  2M38 A;  4DX8 A;  1ZC4 B;  2MDX A;  3HW2 B;  3ULC A;  4TKN A;  3X23 A;  2ADZ A;  2D9Z A;  2EJ8 A;  2BCJ A;  2Y7B A;  4KAX B;  1DDV A;  1W1H A;  2EC1 A;  3OAN A;  3BJI A;  1ZC3 B;  2OTX A;  2GCJ A;  1QC6 A;  1FGZ A;  1FHX A;  4K81 A;  1GC7 A;  2RSG A;  2DN6 A;  3U7D A;  1P5T A;  5JLJ B;  3VIA A;  1H10 A;  2L2I A;  1MPH A;  1V61 A;  2EMT A;  2LUL A;  4F7H A;  3CXB B;  2N23 A;  3DXE A;  3TFM A;  2HTH B;  2Z0O A;  3AU5 A;  2COD A;  2YS1 A;  2LOX A;  1DBH A;  3D8F A;  3PVL A;  2R09 A;  2DX1 A;  1WGQ A;  1X86 A;  4IOY X;  3TVV A;  3FSS A;  3AJ4 A;  1U5F A;  1QQG A;  4HDO A;  5CLQ B;  1LB1 A;  2P0D A; 
#chains in the Genus database with same CATH topology
 1ZYI A;  4HAY B;  4BBK A;  1OQN A;  3TO1 A;  2GUM A;  2W2W A;  1TQZ A;  2PZ1 A;  2GS0 A;  4GPT B;  2Z0Q A;  1UNP A;  1MK7 B;  3A8Q A;  2ZKM X;  2ELB A;  3U12 A;  4CHM A;  4EKU A;  1BWN A;  4DBB A;  3SO6 A;  4PQ0 A;  1AWE A;  2H7E A;  4QJ4 B;  2NMB A;  4EMO A;  2K00 A;  1M7R A;  1E5W A;  2H7D A;  4EJN A;  4XWX A;  3NWF A;  3CIK A;  1H4R A;  2D11 A;  3FEH A;  2P0F A;  3T06 A;  5LOP B;  2RNR B;  5LON B;  2N0Y A;  4KVG B;  1FB8 A;  1NI2 A;  4PNK A;  3KRX A;  4MT7 A;  2Z59 A;  1GC6 A;  4A6F A;  1EGX A;  1RRP B;  2W2X C;  1B55 A;  4TYZ A;  1UPR A;  3A98 B;  4GOU A;  2D10 A;  2CAY A;  2D4Q A;  1X1G A;  5D3V A;  4OSN A;  3KSY A;  1KZ7 A;  1UPQ A;  1X11 A;  3SNH A;  2XQN M;  2Y8G A;  2V76 A;  3DXC A;  2DX5 A;  1FGY A;  1WI1 A;  3A58 A;  2Y8F A;  3AU4 A;  3TCA A;  1MAI A;  2L1C A;  4HB2 B;  2VRW B;  2X18 A;  5HE3 A;  2KUP A;  3LJU X;  2YT1 A;  2G35 A;  3V5W A;  4HB0 B;  4KHO A;  4F7U P;  2MWN B;  1Y19 B;  2EMS A;  2LKO A;  2YT0 A;  2DKQ A;  2DHK A;  1ZM0 A;  2KCJ A;  3OHM B;  3PVW A;  1BAK A;  2ELA A;  1ZVR A;  4DX9 0;  1V88 A;  1MI1 A;  4MY6 A;  4K2O A;  1MKE A;  2CY5 A;  1FAO A;  5JP4 A;  5DH9 B;  1UEF A;  5CLL B;  2I1J A;  2KGX B;  4NY0 A;  2DKP A;  4GMX B;  1MIX A;  1DDW A;  1SGH A;  4GNK B;  4YL8 A;  5LG4 B;  3VOQ A;  2RGN B;  1P6S A;  5L81 A;  1DDM A;  1SHC A;  1OY2 A;  3D8E A;  4HDQ A;  2LOZ A;  1WG7 A;  4HAZ B;  4Y94 A;  5FI0 A;  5KQ1 A;  2VKI A;  5HE2 A;  5FI1 A;  1PFJ A;  4ZRI A;  3NSU A;  4DXA B;  4D0N B;  3O96 A;  2D9Y A;  4HSI A;  4WSF A;  3ZDT A;  3SUZ A;  4CYE A;  2DHI A;  2VSZ A;  3P7Z A;  5C5B B;  2I1K A;  3FM8 C;  1U29 A;  4QJ5 B;  1I2H A;  1ZSQ A;  2JP2 A;  2NBV A;  2ZPY A;  4Z2M B;  1V5P A;  2LG1 A;  2QKM A;  4KHB B;  1WVH A;  3PZD A;  2RLO A;  1BTK A;  1K5D B;  2I5F A;  3B77 A;  1IRS A;  1WJ1 A;  3D8D A;  1PLS A;  1OMW A;  1XX0 A;  2P8V A;  2DA0 A;  2MKR A;  1I7A A;  2Z4D A;  1W1D A;  5C6R A;  5D27 A;  3U8Z A;  3PVU A;  4HHV A;  1AQC A;  1WGU A;  4K17 A;  4F7G A;  2E2X A;  2LYD A;  2FJU B;  4C0A A;  4HAU B;  1Y5O A;  2W2X D;  3WA0 A;  2DFK A;  3HSA A;  5DHA B;  2FJL A;  1XD4 A;  1K5G B;  1FHW A;  1XR0 B;  4GXB A;  5I2M A;  2R0D A;  2KR0 A;  4HAW B;  5C79 A;  4HB3 B;  5HE0 A;  2K2J A;  5I2S A;  2D9W A;  1Z87 A;  1X05 A;  3KY9 A;  2OQB A;  2K49 A;  4IFS A;  4P7I A;  2COF A;  2DYN A;  2HE7 A;  2YRY A;  2KUQ A;  2COC A;  1N3H A;  5HE1 A;  1MIZ B;  1V89 A;  4OT1 A;  1U5D A;  2K8E A;  1XCG A;  3KZ1 A;  4B6H A;  2UZR A;  2YSZ A;  1EVH A;  4MK0 A;  4KHA A;  4QXA B;  3NW8 A;  1U27 A;  1NTV A;  4HAX B;  4A5K A;  2Z13 A;  5DI9 B;  1NU2 A;  1P3R A;  2GCL A;  4GMV A;  4GZU A;  3QBV B;  3PP2 A;  4HAT B;  4WJ7 A;  2RRF A;  4A6K A;  5J3T A;  4L1R A;  2R2Y A;  3RCP A;  3KRW A;  1DRO A;  3GYO A;  4WVF B;  1MK9 B;  2YT2 A;  4QJ3 B;  4CHJ A;  3WYF B;  5D3Y A;  5C5B A;  3TW1 A;  1V5M A;  2Z14 A;  5D3W A;  2DTC A;  3DXD A;  3MDB C;  4YON A;  4A6F B;  2J59 M;  3GYP A;  1U5E A;  3SV1 A;  1GG3 A;  1T77 A;  5KCV A;  2D9X A;  4NSW A;  1M7E A;  2AL6 A;  1NTY A;  5DHF B;  2IFS A;  3DCX A;  3ODX A;  4ZRK A;  2D2Q A;  2QKL A;  1UNR A;  1J19 A;  2RVB B;  1W1G A;  3NWA A;  3ODW A;  4D6W A;  1RJ2 A;  1XOD A;  2DLW A;  2DYQ A;  2COA A;  4IAP A;  2Q13 A;  5IRS A;  2ROZ B;  1XKE A;  3PG7 A;  3G9W A;  3QIJ A;  1U5G A;  2AEH A;  3N7C A;  3M1I B;  2J0J A;  5KQ4 A;  1X1F A;  5JHG A;  4H8S A;  2J0M A;  3F0W A;  3UZT A;  1Q67 A;  3HK0 A;  1V5U A;  2NZ8 B;  4Z2N A;  3ODO A;  3ULB A;  5J3Y A;  2YS5 A;  3ML4 A;  4HB4 B;  1FOE A;  2YVC A;  3A8P A;  5GOW B;  1TJ6 A;  1KZG A;  4ZRJ A;  2GJY A;  2MFQ A;  3P6A A;  1TXD A;  3F5R A;  2CRF A;  1PMS A;  2RUK B;  1UNQ A;  3MPX A;  5J3Q A;  3HQC A;  3BIN A;  4L6E A;  5DIF B;  3SYX A;  1J0W A;  3PSC A;  1FHO A;  2I5C A;  5JHH A;  3HIE A;  3QWM A;  4CSQ A;  4DIX A;  1DYN A;  2YS3 A;  2IYB A;  4A6H A;  2K2U A;  2P0H A;  1BTN A;  4K2P A;  2UVM A;  1LW3 A;  1ISN A;  1EAZ A;  2DHJ A;  4GN1 A;  2Z0P A;  2ROV A;  5EFX A;  3ZVR A;  1WJM A;  1KI1 B;  2M14 A;  5D3X A;  1EF1 A;  4HAV B;  2J0K A;  2YF0 A;  5C16 A;  2D9V A;  1U2B A;  3PEG A;  2UZS A;  2CY4 A;  3IVF A;  2M38 A;  4DX8 A;  1ZC4 B;  3HW2 B;  2MDX A;  3ULC A;  4TKN A;  3X23 A;  3NWD A;  2ADZ A;  5M4Y B;  2D9Z A;  2EJ8 A;  2BCJ A;  2Y7B A;  4KAX B;  1DDV A;  4KHB A;  1W1H A;  2EC1 A;  3OAN A;  3BJI A;  1ZC3 B;  2OTX A;  2GCJ A;  1QC6 A;  1FGZ A;  1FHX A;  4K81 A;  1GC7 A;  2RSG A;  2DN6 A;  3U7D A;  1P5T A;  3FVC A;  5JLJ B;  3VIA A;  1H10 A;  2L2I A;  1MPH A;  1V61 A;  2EMT A;  2LUL A;  4F7H A;  3CXB B;  2N23 A;  3DXE A;  3TFM A;  2HTH B;  2Z0O A;  3AU5 A;  2COD A;  2YS1 A;  2LOX A;  1DBH A;  3D8F A;  3PVL A;  2KIE A;  2DX1 A;  2R09 A;  1WGQ A;  1X86 A;  2KIG A;  4IOY X;  3TVV A;  3FSS A;  3AJ4 A;  1U5F A;  1QQG A;  4HDO A;  5CLQ B;  1LB1 A;  2P0D A; 
#chains in the Genus database with same CATH homology
 4HAY B;  4BBK A;  1OQN A;  3TO1 A;  2W2W A;  1TQZ A;  2PZ1 A;  2GS0 A;  4GPT B;  2Z0Q A;  1UNP A;  1MK7 B;  3A8Q A;  2ELB A;  4CHM A;  4EKU A;  1BWN A;  4DBB A;  3SO6 A;  4PQ0 A;  1AWE A;  2H7E A;  2NMB A;  4EMO A;  2K00 A;  1M7R A;  1E5W A;  2H7D A;  4EJN A;  4XWX A;  3CIK A;  1H4R A;  2D11 A;  3FEH A;  2P0F A;  3T06 A;  5LOP B;  2RNR B;  5LON B;  2N0Y A;  4KVG B;  1FB8 A;  1NI2 A;  4PNK A;  3KRX A;  4MT7 A;  1GC6 A;  4A6F A;  1EGX A;  1RRP B;  2W2X C;  1B55 A;  4TYZ A;  1UPR A;  3A98 B;  2D10 A;  2CAY A;  2D4Q A;  1X1G A;  5D3V A;  3KSY A;  1KZ7 A;  1UPQ A;  1X11 A;  3SNH A;  2XQN M;  2Y8G A;  2V76 A;  3DXC A;  2DX5 A;  1FGY A;  1WI1 A;  2Y8F A;  3AU4 A;  3TCA A;  1MAI A;  2L1C A;  4HB2 B;  2VRW B;  2X18 A;  5HE3 A;  2KUP A;  3LJU X;  2YT1 A;  2G35 A;  3V5W A;  4HB0 B;  4KHO A;  4F7U P;  2MWN B;  1Y19 B;  2EMS A;  2LKO A;  2YT0 A;  2DKQ A;  2DHK A;  1ZM0 A;  2KCJ A;  3PVW A;  1BAK A;  2ELA A;  1ZVR A;  4DX9 0;  1V88 A;  4MY6 A;  4K2O A;  1MKE A;  2CY5 A;  1FAO A;  5JP4 A;  5DH9 B;  1UEF A;  5CLL B;  2I1J A;  2KGX B;  4NY0 A;  2DKP A;  4GMX B;  1MIX A;  1DDW A;  1SGH A;  4YL8 A;  3VOQ A;  2RGN B;  1P6S A;  5L81 A;  1DDM A;  1SHC A;  1OY2 A;  3D8E A;  4HDQ A;  2LOZ A;  1WG7 A;  4HAZ B;  4Y94 A;  5FI0 A;  5KQ1 A;  2VKI A;  5HE2 A;  5FI1 A;  1PFJ A;  4ZRI A;  3NSU A;  4DXA B;  4D0N B;  3O96 A;  2D9Y A;  4WSF A;  3ZDT A;  3SUZ A;  4CYE A;  2DHI A;  2VSZ A;  3P7Z A;  5C5B B;  2I1K A;  3FM8 C;  1U29 A;  1I2H A;  1ZSQ A;  2JP2 A;  2ZPY A;  4Z2M B;  1V5P A;  2LG1 A;  2QKM A;  4KHB B;  1WVH A;  3PZD A;  2RLO A;  1BTK A;  1K5D B;  2I5F A;  3D8D A;  1IRS A;  1WJ1 A;  1PLS A;  1OMW A;  1XX0 A;  2P8V A;  2DA0 A;  2MKR A;  1I7A A;  1W1D A;  5C6R A;  5D27 A;  3U8Z A;  3PVU A;  4HHV A;  1AQC A;  1WGU A;  4K17 A;  4F7G A;  2E2X A;  2LYD A;  4C0A A;  4HAU B;  1Y5O A;  2W2X D;  3WA0 A;  2DFK A;  5DHA B;  2FJL A;  1XD4 A;  1K5G B;  1FHW A;  1XR0 B;  4GXB A;  2R0D A;  4HAW B;  5C79 A;  4HB3 B;  5HE0 A;  2K2J A;  2D9W A;  1Z87 A;  1X05 A;  3KY9 A;  2OQB A;  4IFS A;  4P7I A;  2COF A;  2DYN A;  2HE7 A;  2YRY A;  2COC A;  1N3H A;  5HE1 A;  1MIZ B;  1V89 A;  1U5D A;  1XCG A;  3KZ1 A;  4B6H A;  2UZR A;  2YSZ A;  1EVH A;  4MK0 A;  4KHA A;  1U27 A;  1NTV A;  4HAX B;  4A5K A;  5DI9 B;  1NU2 A;  1P3R A;  2GCL A;  4GMV A;  4GZU A;  3QBV B;  3PP2 A;  4HAT B;  4WJ7 A;  4A6K A;  5J3T A;  3RCP A;  3KRW A;  1DRO A;  3GYO A;  4WVF B;  1MK9 B;  4CHJ A;  3WYF B;  5D3Y A;  5C5B A;  3TW1 A;  1V5M A;  5D3W A;  2DTC A;  3DXD A;  3MDB C;  4YON A;  4A6F B;  2J59 M;  3GYP A;  1U5E A;  3SV1 A;  1GG3 A;  5KCV A;  2D9X A;  4NSW A;  1M7E A;  2AL6 A;  1NTY A;  5DHF B;  2IFS A;  3ODX A;  4ZRK A;  2D2Q A;  2QKL A;  1UNR A;  1J19 A;  2RVB B;  1W1G A;  3ODW A;  1RJ2 A;  1XOD A;  2DLW A;  2DYQ A;  2COA A;  4IAP A;  2Q13 A;  2ROZ B;  1XKE A;  3PG7 A;  3G9W A;  3QIJ A;  1U5G A;  2AEH A;  3N7C A;  3M1I B;  2J0J A;  5KQ4 A;  1X1F A;  5JHG A;  4H8S A;  2J0M A;  3F0W A;  3UZT A;  1Q67 A;  3HK0 A;  1V5U A;  2NZ8 B;  4Z2N A;  3ODO A;  3ULB A;  5J3Y A;  2YS5 A;  3ML4 A;  4HB4 B;  1FOE A;  2YVC A;  3A8P A;  5GOW B;  1TJ6 A;  1KZG A;  4ZRJ A;  2GJY A;  2MFQ A;  3P6A A;  1TXD A;  3F5R A;  2CRF A;  1PMS A;  2RUK B;  1UNQ A;  3MPX A;  5J3Q A;  3HQC A;  3BIN A;  4L6E A;  5DIF B;  3SYX A;  1J0W A;  3PSC A;  1FHO A;  2I5C A;  5JHH A;  3QWM A;  1DYN A;  2YS3 A;  2IYB A;  4A6H A;  2K2U A;  2P0H A;  1BTN A;  4K2P A;  2UVM A;  1LW3 A;  1ISN A;  1EAZ A;  2DHJ A;  4GN1 A;  2Z0P A;  2ROV A;  5EFX A;  3ZVR A;  1WJM A;  1KI1 B;  2M14 A;  5D3X A;  1EF1 A;  4HAV B;  2J0K A;  2YF0 A;  5C16 A;  2D9V A;  1U2B A;  3PEG A;  2UZS A;  2CY4 A;  3IVF A;  2M38 A;  4DX8 A;  1ZC4 B;  2MDX A;  3HW2 B;  3ULC A;  4TKN A;  3X23 A;  2ADZ A;  2D9Z A;  2EJ8 A;  2BCJ A;  2Y7B A;  4KAX B;  1DDV A;  1W1H A;  2EC1 A;  3OAN A;  3BJI A;  1ZC3 B;  2OTX A;  2GCJ A;  1QC6 A;  1FGZ A;  1FHX A;  4K81 A;  1GC7 A;  2RSG A;  2DN6 A;  3U7D A;  1P5T A;  5JLJ B;  3VIA A;  1H10 A;  2L2I A;  1MPH A;  1V61 A;  2EMT A;  2LUL A;  4F7H A;  3CXB B;  2N23 A;  3DXE A;  3TFM A;  2HTH B;  2Z0O A;  3AU5 A;  2COD A;  2YS1 A;  2LOX A;  1DBH A;  3D8F A;  3PVL A;  2R09 A;  2DX1 A;  1WGQ A;  1X86 A;  4IOY X;  3TVV A;  3FSS A;  3AJ4 A;  1U5F A;  1QQG A;  4HDO A;  5CLQ B;  1LB1 A;  2P0D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...