2RSGA

Solution structure of the cert ph domain
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
94
structure length
94
Chain Sequence
VERCGVLSKWTNYIHGWQDRWVVLKNNALSYYKSEDETEYGCRGSICLSKAVITPHDFDECRFDISVNDSVWYLRAQDPDHRQQWIDAIEQHKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Collagen type IV alpha-3-binding protein
publication title Structural basis for the Golgi association by the pleckstrin homology domain of the ceramide trafficking protein (CERT)
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lipid transport
total genus 15
structure length 94
sequence length 94
ec nomenclature
pdb deposition date 2012-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2rsgA00
1ZC4B 4YL8A 2YSZA 5C5BA 2DTCA 3KRXA 5DHAB 5HE0A 3X23A 3SNHA 1UNPA 2HE7A 1NU2A 4PQ0A 1FOEA 3GYOA 4ZRJA 1UPQA 1MPHA 1U5FA 1MK9B 5C5BB 3PVWA 3FSSA 2AL6A 3ZVRA 3F5RA 1FHXA 1MIXA 5J3QA 3PZDA 4HB0B 3P6AA 1BTNA 2VRWB 3ZDTA 1P3RA 4WSFA 2EMTA 1WI1A 2K2UA 2M14A 1DDWA 3PVUA 1MIZB 1DROA 1AWEA 1KI1B 2LKOA 2QKLA 4KHOA 2GCJA 2DHIA 4Z2NA 4KHAA 2N0YA 5JHGA 1M7RA 4HB3B 2H7EA 4HATB 2DX1A 1K5DB 2LULA 3QIJA 3M1IB 3ULCA 2QKMA 1V88A 3DXDA 4HDQA 4HAWB 1SGHA 4DXAB 3SO6A 2DLWA 1LW3A 1NI2A 4IOYX 3SV1A 2M38A 3HK0A 4CHMA 3VIAA 1U29A 2EMSA 2K00A 3DXEA 1QQGA 2D9WA 1TJ6A 2GJYA 1BWNA 4TKNA 1FHOA 2P0DA 4MK0A 4A6FA 2DHJA 4K17A 4XWXA 2KCJA 2UZSA 1H10A 1K5GB 2J0KA 3HQCA 2CODA 2FJLA 2P8VA 1WJMA 4EKUA 5FI1A 1WGUA 3F0WA 1PLSA 2RSGA 5DH9B 3D8DA 1TQZA 2DYNA 2G35A 3ULBA 4A6HA 1GG3A 2KUPA 4MY6A 2RGNB 5KQ1A 4TYZA 2K2JA 4P7IA 1QC6A 2D10A 2MDXA 2W2WA 3PP2A 1U2BA 2EC1A 4CYEA 2LOZA 4KHBB 1WVHA 2RNRB 3TVVA 5D3YA 4K81A 3DXCA 2ELAA 2YRYA 4HB4B 3TFMA 1ZM0A 3D8FA 1EAZA 5HE2A 2HTHB 1MAIA 3PSCA 2I1JA 2J0MA 4IFSA 2D9XA 5JLJB 4F7GA 2GS0A 1UEFA 3RCPA 1MK7B 2W2XD 5JP4A 2YT1A 4A5KA 2R0DA 3BINA 4GMXB 1H4RA 4EJNA 4CHJA 2DN6A 2Q13A 1WGQA 2RLOA 4YONA 5D3XA 1W1GA 3WYFB 5C6RA 2Y7BA 3G9WA 1XODA 2D9ZA 1GC6A 1Y5OA 2LOXA 3IVFA 5HE1A 1XCGA 2P0FA 5J3YA 3GYPA 4F7HA 5EFXA 1UNQA 3FM8C 1ZVRA 1V5MA 1SHCA 2I1KA 4HB2B 2X18A 2J59M 5KQ4A 2DFKA 3TCAA 2Z0OA 2L1CA 3A8PA 1EF1A 1XX0A 4HDOA 1I7AA 3FEHA 3P7ZA 2ZPYA 1X11A 4HAXB 2P0HA 1P6SA 5CLQB 1KZGA 1DDMA 2ROVA 1V5UA 2Z0QA 1X05A 1X1GA 2RUKB 3QWMA 1FB8A 2Y8FA 1MKEA 5D3VA 2E2XA 5LONB 2DKQA 2EJ8A 5C16A 1DYNA 2D9YA 2D2QA 4A6FB 2R09A 1V61A 2L2IA 5GOWB 3PVLA 1PMSA 3D8EA 5D3WA 2DYQA 1IRSA 4C0AA 3AU5A 2UVMA 1U5DA 2YS5A 4IAPA 2AEHA 2D11A 3PEGA 3MPXA 2IYBA 3CIKA 2PZ1A 2LYDA 3TW1A 2LG1A 2GCLA 3BJIA 1UPRA 1U5GA 2JP2A 3V5WA 2H7DA 4HAYB 5DIFB 2CY4A 1I2HA 3LJUX 2Z0PA 1ZC3B 4K2PA 5LOPB 4HAUB 2YT0A 2YF0A 1BAKA 4WVFB 4HHVA 2IFSA 4EMOA 2CRFA 1U5EA 5J3TA 1M7EA 3ODOA 1DBHA 4K2OA 1OMWA 1GC7A 2VKIA 3SYXA 5L81A 1U27A 3A8QA 2DKPA 4GZUA 3VOQA 1X86A 5C79A 1P5TA 4ZRIA 3ML4A 3ODWA 4PNKA 2YVCA 3T06A 1V5PA 3KY9A 1Y19B 2J0JA 2MKRA 1XKEA 1RRPB 2COCA 4DX8A 1NTVA 2I5CA 4HAZB 1W1DA 4Z2MB 2CAYA 2OTXA 2MFQA 3AU4A 1EGXA 2UZRA 1AQCA 2DA0A 3PG7A 4F7UP 3N7CA 1FAOA 2Y8GA 2COAA 3KZ1A 3A98B 3CXBB 4L6EA 3O96A 3UZTA 2N23A 2DX5A 1LB1A 3KSYA 1WG7A 3ODXA 3QBVB 2W2XC 4HAVB 2ADZA 4NSWA 1W1HA 4D0NB 2MWNB 1EVHA 2XQNM 1Q67A 4B6HA 1TXDA 1WJ1A 1XR0B 3TO1A 2ELBA 5CLLB 3U8ZA 1DDVA 1FHWA 2CY5A 2ROZB 1Z87A 1KZ7A 3OANA 4GMVA 1XD4A 5FI0A 2DHKA 5KCVA 1PFJA 3SUZA 1V89A 1OQNA 4Y94A 1OY2A 4BBKA 1J19A 5JHHA 1BTKA 4DX90 2NMBA 3NSUA 1X1FA 2OQBA 1E5WA 1ISNA 3U7DA 2NZ8B 4GPTB 2D9VA 3AJ4A 3MDBC 4KAXB 1J0WA 1ZSQA 2YS1A 4H8SA 2RVBB 5DHFB 2BCJA 3KRWA 4ZRKA 5DI9B 2VSZA 4A6KA 4MT7A 4DBBA 4GN1A 1FGYA 4WJ7A 5D27A 2KGXB 3HW2B 2YS3A 2I5FA 2V76A 3WA0A 2D4QA 1UNRA 4KVGB 1N3HA 2COFA 4GXBA 1FGZA 4NY0A 1RJ2A 5HE3A 1B55A 1NTYA
chains in the Genus database with same CATH superfamily
2R2YA 1ZC4B 4YL8A 2YSZA 5C5BA 2K49A 2DTCA 3KRXA 5DHAB 5HE0A 3X23A 3SNHA 1UNPA 2HE7A 1NU2A 4PQ0A 5I2MA 4QJ4B 1FOEA 3GYOA 4ZRJA 1UPQA 1MPHA 1U5FA 1MK9B 5C5BB 3PVWA 3FSSA 2AL6A 3ZVRA 3F5RA 1FHXA 1MIXA 5J3QA 3PZDA 4HB0B 3P6AA 1BTNA 2VRWB 3ZDTA 1P3RA 4WSFA 2EMTA 1WI1A 2K2UA 3B77A 4GOUA 2M14A 1DDWA 3PVUA 1MIZB 1DROA 1AWEA 1KI1B 2LKOA 2QKLA 4KHOA 2GCJA 2DHIA 4Z2NA 4KHAA 2N0YA 5JHGA 1M7RA 4HB3B 2H7EA 4HATB 2DX1A 4HSIA 1K5DB 2LULA 3QIJA 3A58A 3M1IB 3ULCA 2QKMA 1V88A 3DXDA 4HDQA 2K8EA 4HAWB 1SGHA 4DXAB 3SO6A 2DLWA 1LW3A 1NI2A 4IOYX 3SV1A 2M38A 3HK0A 4CHMA 3VIAA 1U29A 2EMSA 2K00A 4OT1A 3DXEA 1QQGA 2D9WA 1TJ6A 2GJYA 1BWNA 4TKNA 1FHOA 2P0DA 4MK0A 4A6FA 2DHJA 4K17A 4XWXA 2KCJA 2UZSA 1H10A 1K5GB 2J0KA 3HQCA 2CODA 2YT2A 2KR0A 2FJLA 2P8VA 1ZYIA 3HIEA 1WJMA 4EKUA 5FI1A 1WGUA 3F0WA 1PLSA 2RSGA 5DH9B 3D8DA 1TQZA 2DYNA 2G35A 3ULBA 4A6HA 1GG3A 4KHBA 2KUPA 4MY6A 2RGNB 5KQ1A 2FJUB 4TYZA 2K2JA 4P7IA 1QC6A 2D10A 2Z59A 2MDXA 2W2WA 3PP2A 1U2BA 2EC1A 4CYEA 2LOZA 4KHBB 1WVHA 2RNRB 3TVVA 5LG4B 5D3YA 4K81A 3U12A 3DXCA 2ELAA 2YRYA 4HB4B 3TFMA 3NWAA 1ZM0A 3D8FA 1EAZA 5HE2A 2HTHB 1MAIA 3PSCA 2I1JA 2J0MA 4IFSA 2D9XA 5JLJB 4F7GA 2GS0A 1UEFA 3RCPA 1MK7B 2W2XD 5JP4A 2YT1A 4A5KA 2R0DA 3BINA 4GMXB 1H4RA 4EJNA 4CHJA 2DN6A 3NW8A 1T77A 2Q13A 1WGQA 2RLOA 4YONA 5D3XA 1W1GA 3WYFB 5C6RA 2Y7BA 3G9WA 1XODA 2D9ZA 3DCXA 1GC6A 1Y5OA 2LOXA 3IVFA 5HE1A 1XCGA 2KUQA 2P0FA 5J3YA 3GYPA 4F7HA 5EFXA 1UNQA 3FM8C 1ZVRA 2ZKMX 1V5MA 1SHCA 5M4YB 2I1KA 4HB2B 2X18A 2J59M 5KQ4A 2DFKA 4CSQA 3TCAA 2Z0OA 2L1CA 3A8PA 1EF1A 4OSNA 1XX0A 4DIXA 4HDOA 2RRFA 1I7AA 3FEHA 3P7ZA 2ZPYA 1X11A 4HAXB 2P0HA 1P6SA 5CLQB 1KZGA 1DDMA 2ROVA 1V5UA 2Z0QA 1X05A 1X1GA 2RUKB 2NBVA 1FB8A 3QWMA 2Y8FA 1MKEA 4QJ3B 5D3VA 2E2XA 5LONB 2DKQA 2EJ8A 5C16A 1DYNA 2D9YA 2D2QA 4A6FB 2R09A 1V61A 2L2IA 5GOWB 3PVLA 1PMSA 3D8EA 5D3WA 2DYQA 1IRSA 4C0AA 3AU5A 2UVMA 1U5DA 2KIEA 2Z14A 2YS5A 4IAPA 2AEHA 2D11A 3PEGA 3MPXA 2IYBA 3CIKA 2PZ1A 2LYDA 3TW1A 2LG1A 2GCLA 3BJIA 1UPRA 1U5GA 2JP2A 3V5WA 2H7DA 4HAYB 5DIFB 2CY4A 1I2HA 3LJUX 2Z0PA 1ZC3B 4K2PA 5LOPB 4HAUB 2YT0A 2YF0A 1BAKA 4WVFB 4HHVA 2IFSA 4EMOA 2CRFA 1U5EA 5J3TA 1M7EA 3ODOA 1DBHA 4K2OA 1OMWA 1GC7A 2VKIA 2Z13A 3SYXA 5L81A 1U27A 3A8QA 2DKPA 4GZUA 3VOQA 1X86A 5C79A 1P5TA 4ZRIA 3ML4A 3ODWA 4PNKA 2YVCA 4GNKB 3T06A 1V5PA 3KY9A 1Y19B 2J0JA 2MKRA 1XKEA 1RRPB 2COCA 4DX8A 5I2SA 1NTVA 2I5CA 4D6WA 4HAZB 1W1DA 4Z2MB 2CAYA 2OTXA 2MFQA 3AU4A 1EGXA 2UZRA 1AQCA 2DA0A 4L1RA 3PG7A 2KIGA 4F7UP 3N7CA 1FAOA 2Y8GA 2COAA 3KZ1A 3A98B 3NWFA 3CXBB 4L6EA 3O96A 3UZTA 3FVCA 2N23A 2DX5A 1LB1A 3KSYA 1WG7A 3ODXA 3QBVB 2W2XC 4HAVB 2ADZA 4NSWA 1W1HA 4QJ5B 5IRSA 4D0NB 2MWNB 1EVHA 2XQNM 1Q67A 4B6HA 1TXDA 1WJ1A 1XR0B 3TO1A 4QXAB 2ELBA 5CLLB 3U8ZA 1DDVA 1FHWA 2CY5A 2ROZB 1Z87A 1KZ7A 3OANA 4GMVA 1XD4A 5FI0A 2DHKA 5KCVA 1PFJA 3SUZA 1V89A 1OQNA 4Y94A 1OY2A 4BBKA 1J19A 5JHHA 1BTKA 4DX90 2NMBA 3NSUA 1X1FA 2OQBA 1E5WA 1ISNA 3U7DA 2NZ8B 4GPTB 2D9VA 3AJ4A 3MDBC 4KAXB 2Z4DA 1J0WA 1ZSQA 2YS1A 4H8SA 2RVBB 5DHFB 2BCJA 3KRWA 4ZRKA 5DI9B 2VSZA 4A6KA 4MT7A 4DBBA 4GN1A 1FGYA 4WJ7A 5D27A 1MI1A 2KGXB 3HW2B 2YS3A 3OHMB 2I5FA 2V76A 3WA0A 2D4QA 3NWDA 1UNRA 4KVGB 1N3HA 2COFA 2GUMA 4GXBA 1FGZA 4NY0A 1RJ2A 5HE3A 1B55A 1NTYA 3HSAA
chains in the Genus database with same CATH topology
1ZC4B 4YL8A 2YSZA 5C5BA 2DTCA 3KRXA 5DHAB 5HE0A 3X23A 3SNHA 1UNPA 2HE7A 1NU2A 4PQ0A 1FOEA 3GYOA 4ZRJA 1UPQA 1MPHA 1U5FA 1MK9B 5C5BB 3PVWA 3FSSA 2AL6A 3ZVRA 3F5RA 1FHXA 1MIXA 5J3QA 3PZDA 4HB0B 3P6AA 1BTNA 2VRWB 3ZDTA 1P3RA 4WSFA 2EMTA 1WI1A 2K2UA 2M14A 1DDWA 3PVUA 1MIZB 1DROA 1AWEA 1KI1B 2LKOA 2QKLA 4KHOA 2GCJA 2DHIA 4Z2NA 4KHAA 2N0YA 5JHGA 1M7RA 4HB3B 2H7EA 4HATB 2DX1A 1K5DB 2LULA 3QIJA 3M1IB 3ULCA 2QKMA 1V88A 3DXDA 4HDQA 4HAWB 1SGHA 4DXAB 3SO6A 2DLWA 1LW3A 1NI2A 4IOYX 3SV1A 2M38A 3HK0A 4CHMA 3VIAA 1U29A 2EMSA 2K00A 3DXEA 1QQGA 2D9WA 1TJ6A 2GJYA 1BWNA 4TKNA 1FHOA 2P0DA 4MK0A 4A6FA 2DHJA 4K17A 4XWXA 2KCJA 2UZSA 1H10A 1K5GB 2J0KA 3HQCA 2CODA 2FJLA 2P8VA 1WJMA 4EKUA 5FI1A 1WGUA 3F0WA 1PLSA 2RSGA 5DH9B 3D8DA 1TQZA 2DYNA 2G35A 3ULBA 4A6HA 1GG3A 2KUPA 4MY6A 2RGNB 5KQ1A 4TYZA 2K2JA 4P7IA 1QC6A 2D10A 2MDXA 2W2WA 3PP2A 1U2BA 2EC1A 4CYEA 2LOZA 4KHBB 1WVHA 2RNRB 3TVVA 5D3YA 4K81A 3DXCA 2ELAA 2YRYA 4HB4B 3TFMA 1ZM0A 3D8FA 1EAZA 5HE2A 2HTHB 1MAIA 3PSCA 2I1JA 2J0MA 4IFSA 2D9XA 5JLJB 4F7GA 2GS0A 1UEFA 3RCPA 1MK7B 2W2XD 5JP4A 2YT1A 4A5KA 2R0DA 3BINA 4GMXB 1H4RA 4EJNA 4CHJA 2DN6A 2Q13A 1WGQA 2RLOA 4YONA 5D3XA 1W1GA 3WYFB 5C6RA 2Y7BA 3G9WA 1XODA 2D9ZA 1GC6A 1Y5OA 2LOXA 3IVFA 5HE1A 1XCGA 2P0FA 5J3YA 3GYPA 4F7HA 5EFXA 1UNQA 3FM8C 1ZVRA 1V5MA 1SHCA 2I1KA 4HB2B 2X18A 2J59M 5KQ4A 2DFKA 3TCAA 2Z0OA 2L1CA 3A8PA 1EF1A 1XX0A 4HDOA 1I7AA 3FEHA 3P7ZA 2ZPYA 1X11A 4HAXB 2P0HA 1P6SA 5CLQB 1KZGA 1DDMA 2ROVA 1V5UA 2Z0QA 1X05A 1X1GA 2RUKB 3QWMA 1FB8A 2Y8FA 1MKEA 5D3VA 2E2XA 5LONB 2DKQA 2EJ8A 5C16A 1DYNA 2D9YA 2D2QA 4A6FB 2R09A 1V61A 2L2IA 5GOWB 3PVLA 1PMSA 3D8EA 5D3WA 2DYQA 1IRSA 4C0AA 3AU5A 2UVMA 1U5DA 2YS5A 4IAPA 2AEHA 2D11A 3PEGA 3MPXA 2IYBA 3CIKA 2PZ1A 2LYDA 3TW1A 2LG1A 2GCLA 3BJIA 1UPRA 1U5GA 2JP2A 3V5WA 2H7DA 4HAYB 5DIFB 2CY4A 1I2HA 3LJUX 2Z0PA 1ZC3B 4K2PA 5LOPB 4HAUB 2YT0A 2YF0A 1BAKA 4WVFB 4HHVA 2IFSA 4EMOA 2CRFA 1U5EA 5J3TA 1M7EA 3ODOA 1DBHA 4K2OA 1OMWA 1GC7A 2VKIA 3SYXA 5L81A 1U27A 3A8QA 2DKPA 4GZUA 3VOQA 1X86A 5C79A 1P5TA 4ZRIA 3ML4A 3ODWA 4PNKA 2YVCA 3T06A 1V5PA 3KY9A 1Y19B 2J0JA 2MKRA 1XKEA 1RRPB 2COCA 4DX8A 1NTVA 2I5CA 4HAZB 1W1DA 4Z2MB 2CAYA 2OTXA 2MFQA 3AU4A 1EGXA 2UZRA 1AQCA 2DA0A 3PG7A 4F7UP 3N7CA 1FAOA 2Y8GA 2COAA 3KZ1A 3A98B 3CXBB 4L6EA 3O96A 3UZTA 2N23A 2DX5A 1LB1A 3KSYA 1WG7A 3ODXA 3QBVB 2W2XC 4HAVB 2ADZA 4NSWA 1W1HA 4D0NB 2MWNB 1EVHA 2XQNM 1Q67A 4B6HA 1TXDA 1WJ1A 1XR0B 3TO1A 2ELBA 5CLLB 3U8ZA 1DDVA 1FHWA 2CY5A 2ROZB 1Z87A 1KZ7A 3OANA 4GMVA 1XD4A 5FI0A 2DHKA 5KCVA 1PFJA 3SUZA 1V89A 1OQNA 4Y94A 1OY2A 4BBKA 1J19A 5JHHA 1BTKA 4DX90 2NMBA 3NSUA 1X1FA 2OQBA 1E5WA 1ISNA 3U7DA 2NZ8B 4GPTB 2D9VA 3AJ4A 3MDBC 4KAXB 1J0WA 1ZSQA 2YS1A 4H8SA 2RVBB 5DHFB 2BCJA 3KRWA 4ZRKA 5DI9B 2VSZA 4A6KA 4MT7A 4DBBA 4GN1A 1FGYA 4WJ7A 5D27A 2KGXB 3HW2B 2YS3A 2I5FA 2V76A 3WA0A 2D4QA 1UNRA 4KVGB 1N3HA 2COFA 4GXBA 1FGZA 4NY0A 1RJ2A 5HE3A 1B55A 1NTYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZC4 B;  4YL8 A;  2YSZ A;  5C5B A;  2DTC A;  3KRX A;  5DHA B;  5HE0 A;  3X23 A;  3SNH A;  1UNP A;  2HE7 A;  1NU2 A;  4PQ0 A;  1FOE A;  3GYO A;  4ZRJ A;  1UPQ A;  1MPH A;  1U5F A;  1MK9 B;  5C5B B;  3PVW A;  3FSS A;  2AL6 A;  3ZVR A;  3F5R A;  1FHX A;  1MIX A;  5J3Q A;  3PZD A;  4HB0 B;  3P6A A;  1BTN A;  2VRW B;  3ZDT A;  1P3R A;  4WSF A;  2EMT A;  1WI1 A;  2K2U A;  2M14 A;  1DDW A;  3PVU A;  1MIZ B;  1DRO A;  1AWE A;  1KI1 B;  2LKO A;  2QKL A;  4KHO A;  2GCJ A;  2DHI A;  4Z2N A;  4KHA A;  2N0Y A;  5JHG A;  1M7R A;  4HB3 B;  2H7E A;  4HAT B;  2DX1 A;  1K5D B;  2LUL A;  3QIJ A;  3M1I B;  3ULC A;  2QKM A;  1V88 A;  3DXD A;  4HDQ A;  4HAW B;  1SGH A;  4DXA B;  3SO6 A;  2DLW A;  1LW3 A;  1NI2 A;  4IOY X;  3SV1 A;  2M38 A;  3HK0 A;  4CHM A;  3VIA A;  1U29 A;  2EMS A;  2K00 A;  3DXE A;  1QQG A;  2D9W A;  1TJ6 A;  2GJY A;  1BWN A;  4TKN A;  1FHO A;  2P0D A;  4MK0 A;  4A6F A;  2DHJ A;  4K17 A;  4XWX A;  2KCJ A;  2UZS A;  1H10 A;  1K5G B;  2J0K A;  3HQC A;  2COD A;  2FJL A;  2P8V A;  1WJM A;  4EKU A;  5FI1 A;  1WGU A;  3F0W A;  1PLS A;  2RSG A;  5DH9 B;  3D8D A;  1TQZ A;  2DYN A;  2G35 A;  3ULB A;  4A6H A;  1GG3 A;  2KUP A;  4MY6 A;  2RGN B;  5KQ1 A;  4TYZ A;  2K2J A;  4P7I A;  1QC6 A;  2D10 A;  2MDX A;  2W2W A;  3PP2 A;  1U2B A;  2EC1 A;  4CYE A;  2LOZ A;  4KHB B;  1WVH A;  2RNR B;  3TVV A;  5D3Y A;  4K81 A;  3DXC A;  2ELA A;  2YRY A;  4HB4 B;  3TFM A;  1ZM0 A;  3D8F A;  1EAZ A;  5HE2 A;  2HTH B;  1MAI A;  3PSC A;  2I1J A;  2J0M A;  4IFS A;  2D9X A;  5JLJ B;  4F7G A;  2GS0 A;  1UEF A;  3RCP A;  1MK7 B;  2W2X D;  5JP4 A;  2YT1 A;  4A5K A;  2R0D A;  3BIN A;  4GMX B;  1H4R A;  4EJN A;  4CHJ A;  2DN6 A;  2Q13 A;  1WGQ A;  2RLO A;  4YON A;  5D3X A;  1W1G A;  3WYF B;  5C6R A;  2Y7B A;  3G9W A;  1XOD A;  2D9Z A;  1GC6 A;  1Y5O A;  2LOX A;  3IVF A;  5HE1 A;  1XCG A;  2P0F A;  5J3Y A;  3GYP A;  4F7H A;  5EFX A;  1UNQ A;  3FM8 C;  1ZVR A;  1V5M A;  1SHC A;  2I1K A;  4HB2 B;  2X18 A;  2J59 M;  5KQ4 A;  2DFK A;  3TCA A;  2Z0O A;  2L1C A;  3A8P A;  1EF1 A;  1XX0 A;  4HDO A;  1I7A A;  3FEH A;  3P7Z A;  2ZPY A;  1X11 A;  4HAX B;  2P0H A;  1P6S A;  5CLQ B;  1KZG A;  1DDM A;  2ROV A;  1V5U A;  2Z0Q A;  1X05 A;  1X1G A;  2RUK B;  3QWM A;  1FB8 A;  2Y8F A;  1MKE A;  5D3V A;  2E2X A;  5LON B;  2DKQ A;  2EJ8 A;  5C16 A;  1DYN A;  2D9Y A;  2D2Q A;  4A6F B;  2R09 A;  1V61 A;  2L2I A;  5GOW B;  3PVL A;  1PMS A;  3D8E A;  5D3W A;  2DYQ A;  1IRS A;  4C0A A;  3AU5 A;  2UVM A;  1U5D A;  2YS5 A;  4IAP A;  2AEH A;  2D11 A;  3PEG A;  3MPX A;  2IYB A;  3CIK A;  2PZ1 A;  2LYD A;  3TW1 A;  2LG1 A;  2GCL A;  3BJI A;  1UPR A;  1U5G A;  2JP2 A;  3V5W A;  2H7D A;  4HAY B;  5DIF B;  2CY4 A;  1I2H A;  3LJU X;  2Z0P A;  1ZC3 B;  4K2P A;  5LOP B;  4HAU B;  2YT0 A;  2YF0 A;  1BAK A;  4WVF B;  4HHV A;  2IFS A;  4EMO A;  2CRF A;  1U5E A;  5J3T A;  1M7E A;  3ODO A;  1DBH A;  4K2O A;  1OMW A;  1GC7 A;  2VKI A;  3SYX A;  5L81 A;  1U27 A;  3A8Q A;  2DKP A;  4GZU A;  3VOQ A;  1X86 A;  5C79 A;  1P5T A;  4ZRI A;  3ML4 A;  3ODW A;  4PNK A;  2YVC A;  3T06 A;  1V5P A;  3KY9 A;  1Y19 B;  2J0J A;  2MKR A;  1XKE A;  1RRP B;  2COC A;  4DX8 A;  1NTV A;  2I5C A;  4HAZ B;  1W1D A;  4Z2M B;  2CAY A;  2OTX A;  2MFQ A;  3AU4 A;  1EGX A;  2UZR A;  1AQC A;  2DA0 A;  3PG7 A;  4F7U P;  3N7C A;  1FAO A;  2Y8G A;  2COA A;  3KZ1 A;  3A98 B;  3CXB B;  4L6E A;  3O96 A;  3UZT A;  2N23 A;  2DX5 A;  1LB1 A;  3KSY A;  1WG7 A;  3ODX A;  3QBV B;  2W2X C;  4HAV B;  2ADZ A;  4NSW A;  1W1H A;  4D0N B;  2MWN B;  1EVH A;  2XQN M;  1Q67 A;  4B6H A;  1TXD A;  1WJ1 A;  1XR0 B;  3TO1 A;  2ELB A;  5CLL B;  3U8Z A;  1DDV A;  1FHW A;  2CY5 A;  2ROZ B;  1Z87 A;  1KZ7 A;  3OAN A;  4GMV A;  1XD4 A;  5FI0 A;  2DHK A;  5KCV A;  1PFJ A;  3SUZ A;  1V89 A;  1OQN A;  4Y94 A;  1OY2 A;  4BBK A;  1J19 A;  5JHH A;  1BTK A;  4DX9 0;  2NMB A;  3NSU A;  1X1F A;  2OQB A;  1E5W A;  1ISN A;  3U7D A;  2NZ8 B;  4GPT B;  2D9V A;  3AJ4 A;  3MDB C;  4KAX B;  1J0W A;  1ZSQ A;  2YS1 A;  4H8S A;  2RVB B;  5DHF B;  2BCJ A;  3KRW A;  4ZRK A;  5DI9 B;  2VSZ A;  4A6K A;  4MT7 A;  4DBB A;  4GN1 A;  1FGY A;  4WJ7 A;  5D27 A;  2KGX B;  3HW2 B;  2YS3 A;  2I5F A;  2V76 A;  3WA0 A;  2D4Q A;  1UNR A;  4KVG B;  1N3H A;  2COF A;  4GXB A;  1FGZ A;  4NY0 A;  1RJ2 A;  5HE3 A;  1B55 A;  1NTY A; 
#chains in the Genus database with same CATH topology
 2R2Y A;  1ZC4 B;  4YL8 A;  2YSZ A;  5C5B A;  2K49 A;  2DTC A;  3KRX A;  5DHA B;  5HE0 A;  3X23 A;  3SNH A;  1UNP A;  2HE7 A;  1NU2 A;  4PQ0 A;  5I2M A;  4QJ4 B;  1FOE A;  3GYO A;  4ZRJ A;  1UPQ A;  1MPH A;  1U5F A;  1MK9 B;  5C5B B;  3PVW A;  3FSS A;  2AL6 A;  3ZVR A;  3F5R A;  1FHX A;  1MIX A;  5J3Q A;  3PZD A;  4HB0 B;  3P6A A;  1BTN A;  2VRW B;  3ZDT A;  1P3R A;  4WSF A;  2EMT A;  1WI1 A;  2K2U A;  3B77 A;  4GOU A;  2M14 A;  1DDW A;  3PVU A;  1MIZ B;  1DRO A;  1AWE A;  1KI1 B;  2LKO A;  2QKL A;  4KHO A;  2GCJ A;  2DHI A;  4Z2N A;  4KHA A;  2N0Y A;  5JHG A;  1M7R A;  4HB3 B;  2H7E A;  4HAT B;  2DX1 A;  4HSI A;  1K5D B;  2LUL A;  3QIJ A;  3A58 A;  3M1I B;  3ULC A;  2QKM A;  1V88 A;  3DXD A;  4HDQ A;  2K8E A;  4HAW B;  1SGH A;  4DXA B;  3SO6 A;  2DLW A;  1LW3 A;  1NI2 A;  4IOY X;  3SV1 A;  2M38 A;  3HK0 A;  4CHM A;  3VIA A;  1U29 A;  2EMS A;  2K00 A;  4OT1 A;  3DXE A;  1QQG A;  2D9W A;  1TJ6 A;  2GJY A;  1BWN A;  4TKN A;  1FHO A;  2P0D A;  4MK0 A;  4A6F A;  2DHJ A;  4K17 A;  4XWX A;  2KCJ A;  2UZS A;  1H10 A;  1K5G B;  2J0K A;  3HQC A;  2COD A;  2YT2 A;  2KR0 A;  2FJL A;  2P8V A;  1ZYI A;  3HIE A;  1WJM A;  4EKU A;  5FI1 A;  1WGU A;  3F0W A;  1PLS A;  2RSG A;  5DH9 B;  3D8D A;  1TQZ A;  2DYN A;  2G35 A;  3ULB A;  4A6H A;  1GG3 A;  4KHB A;  2KUP A;  4MY6 A;  2RGN B;  5KQ1 A;  2FJU B;  4TYZ A;  2K2J A;  4P7I A;  1QC6 A;  2D10 A;  2Z59 A;  2MDX A;  2W2W A;  3PP2 A;  1U2B A;  2EC1 A;  4CYE A;  2LOZ A;  4KHB B;  1WVH A;  2RNR B;  3TVV A;  5LG4 B;  5D3Y A;  4K81 A;  3U12 A;  3DXC A;  2ELA A;  2YRY A;  4HB4 B;  3TFM A;  3NWA A;  1ZM0 A;  3D8F A;  1EAZ A;  5HE2 A;  2HTH B;  1MAI A;  3PSC A;  2I1J A;  2J0M A;  4IFS A;  2D9X A;  5JLJ B;  4F7G A;  2GS0 A;  1UEF A;  3RCP A;  1MK7 B;  2W2X D;  5JP4 A;  2YT1 A;  4A5K A;  2R0D A;  3BIN A;  4GMX B;  1H4R A;  4EJN A;  4CHJ A;  2DN6 A;  3NW8 A;  1T77 A;  2Q13 A;  1WGQ A;  2RLO A;  4YON A;  5D3X A;  1W1G A;  3WYF B;  5C6R A;  2Y7B A;  3G9W A;  1XOD A;  2D9Z A;  3DCX A;  1GC6 A;  1Y5O A;  2LOX A;  3IVF A;  5HE1 A;  1XCG A;  2KUQ A;  2P0F A;  5J3Y A;  3GYP A;  4F7H A;  5EFX A;  1UNQ A;  3FM8 C;  1ZVR A;  2ZKM X;  1V5M A;  1SHC A;  5M4Y B;  2I1K A;  4HB2 B;  2X18 A;  2J59 M;  5KQ4 A;  2DFK A;  4CSQ A;  3TCA A;  2Z0O A;  2L1C A;  3A8P A;  1EF1 A;  4OSN A;  1XX0 A;  4DIX A;  4HDO A;  2RRF A;  1I7A A;  3FEH A;  3P7Z A;  2ZPY A;  1X11 A;  4HAX B;  2P0H A;  1P6S A;  5CLQ B;  1KZG A;  1DDM A;  2ROV A;  1V5U A;  2Z0Q A;  1X05 A;  1X1G A;  2RUK B;  2NBV A;  1FB8 A;  3QWM A;  2Y8F A;  1MKE A;  4QJ3 B;  5D3V A;  2E2X A;  5LON B;  2DKQ A;  2EJ8 A;  5C16 A;  1DYN A;  2D9Y A;  2D2Q A;  4A6F B;  2R09 A;  1V61 A;  2L2I A;  5GOW B;  3PVL A;  1PMS A;  3D8E A;  5D3W A;  2DYQ A;  1IRS A;  4C0A A;  3AU5 A;  2UVM A;  1U5D A;  2KIE A;  2Z14 A;  2YS5 A;  4IAP A;  2AEH A;  2D11 A;  3PEG A;  3MPX A;  2IYB A;  3CIK A;  2PZ1 A;  2LYD A;  3TW1 A;  2LG1 A;  2GCL A;  3BJI A;  1UPR A;  1U5G A;  2JP2 A;  3V5W A;  2H7D A;  4HAY B;  5DIF B;  2CY4 A;  1I2H A;  3LJU X;  2Z0P A;  1ZC3 B;  4K2P A;  5LOP B;  4HAU B;  2YT0 A;  2YF0 A;  1BAK A;  4WVF B;  4HHV A;  2IFS A;  4EMO A;  2CRF A;  1U5E A;  5J3T A;  1M7E A;  3ODO A;  1DBH A;  4K2O A;  1OMW A;  1GC7 A;  2VKI A;  2Z13 A;  3SYX A;  5L81 A;  1U27 A;  3A8Q A;  2DKP A;  4GZU A;  3VOQ A;  1X86 A;  5C79 A;  1P5T A;  4ZRI A;  3ML4 A;  3ODW A;  4PNK A;  2YVC A;  4GNK B;  3T06 A;  1V5P A;  3KY9 A;  1Y19 B;  2J0J A;  2MKR A;  1XKE A;  1RRP B;  2COC A;  4DX8 A;  5I2S A;  1NTV A;  2I5C A;  4D6W A;  4HAZ B;  1W1D A;  4Z2M B;  2CAY A;  2OTX A;  2MFQ A;  3AU4 A;  1EGX A;  2UZR A;  1AQC A;  2DA0 A;  4L1R A;  3PG7 A;  2KIG A;  4F7U P;  3N7C A;  1FAO A;  2Y8G A;  2COA A;  3KZ1 A;  3A98 B;  3NWF A;  3CXB B;  4L6E A;  3O96 A;  3UZT A;  3FVC A;  2N23 A;  2DX5 A;  1LB1 A;  3KSY A;  1WG7 A;  3ODX A;  3QBV B;  2W2X C;  4HAV B;  2ADZ A;  4NSW A;  1W1H A;  4QJ5 B;  5IRS A;  4D0N B;  2MWN B;  1EVH A;  2XQN M;  1Q67 A;  4B6H A;  1TXD A;  1WJ1 A;  1XR0 B;  3TO1 A;  4QXA B;  2ELB A;  5CLL B;  3U8Z A;  1DDV A;  1FHW A;  2CY5 A;  2ROZ B;  1Z87 A;  1KZ7 A;  3OAN A;  4GMV A;  1XD4 A;  5FI0 A;  2DHK A;  5KCV A;  1PFJ A;  3SUZ A;  1V89 A;  1OQN A;  4Y94 A;  1OY2 A;  4BBK A;  1J19 A;  5JHH A;  1BTK A;  4DX9 0;  2NMB A;  3NSU A;  1X1F A;  2OQB A;  1E5W A;  1ISN A;  3U7D A;  2NZ8 B;  4GPT B;  2D9V A;  3AJ4 A;  3MDB C;  4KAX B;  2Z4D A;  1J0W A;  1ZSQ A;  2YS1 A;  4H8S A;  2RVB B;  5DHF B;  2BCJ A;  3KRW A;  4ZRK A;  5DI9 B;  2VSZ A;  4A6K A;  4MT7 A;  4DBB A;  4GN1 A;  1FGY A;  4WJ7 A;  5D27 A;  1MI1 A;  2KGX B;  3HW2 B;  2YS3 A;  3OHM B;  2I5F A;  2V76 A;  3WA0 A;  2D4Q A;  3NWD A;  1UNR A;  4KVG B;  1N3H A;  2COF A;  2GUM A;  4GXB A;  1FGZ A;  4NY0 A;  1RJ2 A;  5HE3 A;  1B55 A;  1NTY A;  3HSA A; 
#chains in the Genus database with same CATH homology
 1ZC4 B;  4YL8 A;  2YSZ A;  5C5B A;  2DTC A;  3KRX A;  5DHA B;  5HE0 A;  3X23 A;  3SNH A;  1UNP A;  2HE7 A;  1NU2 A;  4PQ0 A;  1FOE A;  3GYO A;  4ZRJ A;  1UPQ A;  1MPH A;  1U5F A;  1MK9 B;  5C5B B;  3PVW A;  3FSS A;  2AL6 A;  3ZVR A;  3F5R A;  1FHX A;  1MIX A;  5J3Q A;  3PZD A;  4HB0 B;  3P6A A;  1BTN A;  2VRW B;  3ZDT A;  1P3R A;  4WSF A;  2EMT A;  1WI1 A;  2K2U A;  2M14 A;  1DDW A;  3PVU A;  1MIZ B;  1DRO A;  1AWE A;  1KI1 B;  2LKO A;  2QKL A;  4KHO A;  2GCJ A;  2DHI A;  4Z2N A;  4KHA A;  2N0Y A;  5JHG A;  1M7R A;  4HB3 B;  2H7E A;  4HAT B;  2DX1 A;  1K5D B;  2LUL A;  3QIJ A;  3M1I B;  3ULC A;  2QKM A;  1V88 A;  3DXD A;  4HDQ A;  4HAW B;  1SGH A;  4DXA B;  3SO6 A;  2DLW A;  1LW3 A;  1NI2 A;  4IOY X;  3SV1 A;  2M38 A;  3HK0 A;  4CHM A;  3VIA A;  1U29 A;  2EMS A;  2K00 A;  3DXE A;  1QQG A;  2D9W A;  1TJ6 A;  2GJY A;  1BWN A;  4TKN A;  1FHO A;  2P0D A;  4MK0 A;  4A6F A;  2DHJ A;  4K17 A;  4XWX A;  2KCJ A;  2UZS A;  1H10 A;  1K5G B;  2J0K A;  3HQC A;  2COD A;  2FJL A;  2P8V A;  1WJM A;  4EKU A;  5FI1 A;  1WGU A;  3F0W A;  1PLS A;  2RSG A;  5DH9 B;  3D8D A;  1TQZ A;  2DYN A;  2G35 A;  3ULB A;  4A6H A;  1GG3 A;  2KUP A;  4MY6 A;  2RGN B;  5KQ1 A;  4TYZ A;  2K2J A;  4P7I A;  1QC6 A;  2D10 A;  2MDX A;  2W2W A;  3PP2 A;  1U2B A;  2EC1 A;  4CYE A;  2LOZ A;  4KHB B;  1WVH A;  2RNR B;  3TVV A;  5D3Y A;  4K81 A;  3DXC A;  2ELA A;  2YRY A;  4HB4 B;  3TFM A;  1ZM0 A;  3D8F A;  1EAZ A;  5HE2 A;  2HTH B;  1MAI A;  3PSC A;  2I1J A;  2J0M A;  4IFS A;  2D9X A;  5JLJ B;  4F7G A;  2GS0 A;  1UEF A;  3RCP A;  1MK7 B;  2W2X D;  5JP4 A;  2YT1 A;  4A5K A;  2R0D A;  3BIN A;  4GMX B;  1H4R A;  4EJN A;  4CHJ A;  2DN6 A;  2Q13 A;  1WGQ A;  2RLO A;  4YON A;  5D3X A;  1W1G A;  3WYF B;  5C6R A;  2Y7B A;  3G9W A;  1XOD A;  2D9Z A;  1GC6 A;  1Y5O A;  2LOX A;  3IVF A;  5HE1 A;  1XCG A;  2P0F A;  5J3Y A;  3GYP A;  4F7H A;  5EFX A;  1UNQ A;  3FM8 C;  1ZVR A;  1V5M A;  1SHC A;  2I1K A;  4HB2 B;  2X18 A;  2J59 M;  5KQ4 A;  2DFK A;  3TCA A;  2Z0O A;  2L1C A;  3A8P A;  1EF1 A;  1XX0 A;  4HDO A;  1I7A A;  3FEH A;  3P7Z A;  2ZPY A;  1X11 A;  4HAX B;  2P0H A;  1P6S A;  5CLQ B;  1KZG A;  1DDM A;  2ROV A;  1V5U A;  2Z0Q A;  1X05 A;  1X1G A;  2RUK B;  3QWM A;  1FB8 A;  2Y8F A;  1MKE A;  5D3V A;  2E2X A;  5LON B;  2DKQ A;  2EJ8 A;  5C16 A;  1DYN A;  2D9Y A;  2D2Q A;  4A6F B;  2R09 A;  1V61 A;  2L2I A;  5GOW B;  3PVL A;  1PMS A;  3D8E A;  5D3W A;  2DYQ A;  1IRS A;  4C0A A;  3AU5 A;  2UVM A;  1U5D A;  2YS5 A;  4IAP A;  2AEH A;  2D11 A;  3PEG A;  3MPX A;  2IYB A;  3CIK A;  2PZ1 A;  2LYD A;  3TW1 A;  2LG1 A;  2GCL A;  3BJI A;  1UPR A;  1U5G A;  2JP2 A;  3V5W A;  2H7D A;  4HAY B;  5DIF B;  2CY4 A;  1I2H A;  3LJU X;  2Z0P A;  1ZC3 B;  4K2P A;  5LOP B;  4HAU B;  2YT0 A;  2YF0 A;  1BAK A;  4WVF B;  4HHV A;  2IFS A;  4EMO A;  2CRF A;  1U5E A;  5J3T A;  1M7E A;  3ODO A;  1DBH A;  4K2O A;  1OMW A;  1GC7 A;  2VKI A;  3SYX A;  5L81 A;  1U27 A;  3A8Q A;  2DKP A;  4GZU A;  3VOQ A;  1X86 A;  5C79 A;  1P5T A;  4ZRI A;  3ML4 A;  3ODW A;  4PNK A;  2YVC A;  3T06 A;  1V5P A;  3KY9 A;  1Y19 B;  2J0J A;  2MKR A;  1XKE A;  1RRP B;  2COC A;  4DX8 A;  1NTV A;  2I5C A;  4HAZ B;  1W1D A;  4Z2M B;  2CAY A;  2OTX A;  2MFQ A;  3AU4 A;  1EGX A;  2UZR A;  1AQC A;  2DA0 A;  3PG7 A;  4F7U P;  3N7C A;  1FAO A;  2Y8G A;  2COA A;  3KZ1 A;  3A98 B;  3CXB B;  4L6E A;  3O96 A;  3UZT A;  2N23 A;  2DX5 A;  1LB1 A;  3KSY A;  1WG7 A;  3ODX A;  3QBV B;  2W2X C;  4HAV B;  2ADZ A;  4NSW A;  1W1H A;  4D0N B;  2MWN B;  1EVH A;  2XQN M;  1Q67 A;  4B6H A;  1TXD A;  1WJ1 A;  1XR0 B;  3TO1 A;  2ELB A;  5CLL B;  3U8Z A;  1DDV A;  1FHW A;  2CY5 A;  2ROZ B;  1Z87 A;  1KZ7 A;  3OAN A;  4GMV A;  1XD4 A;  5FI0 A;  2DHK A;  5KCV A;  1PFJ A;  3SUZ A;  1V89 A;  1OQN A;  4Y94 A;  1OY2 A;  4BBK A;  1J19 A;  5JHH A;  1BTK A;  4DX9 0;  2NMB A;  3NSU A;  1X1F A;  2OQB A;  1E5W A;  1ISN A;  3U7D A;  2NZ8 B;  4GPT B;  2D9V A;  3AJ4 A;  3MDB C;  4KAX B;  1J0W A;  1ZSQ A;  2YS1 A;  4H8S A;  2RVB B;  5DHF B;  2BCJ A;  3KRW A;  4ZRK A;  5DI9 B;  2VSZ A;  4A6K A;  4MT7 A;  4DBB A;  4GN1 A;  1FGY A;  4WJ7 A;  5D27 A;  2KGX B;  3HW2 B;  2YS3 A;  2I5F A;  2V76 A;  3WA0 A;  2D4Q A;  1UNR A;  4KVG B;  1N3H A;  2COF A;  4GXB A;  1FGZ A;  4NY0 A;  1RJ2 A;  5HE3 A;  1B55 A;  1NTY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...