2RSGA

Solution structure of the cert ph domain
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
94
structure length
94
Chain Sequence
VERCGVLSKWTNYIHGWQDRWVVLKNNALSYYKSEDETEYGCRGSICLSKAVITPHDFDECRFDISVNDSVWYLRAQDPDHRQQWIDAIEQHKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lipid transport
molecule keywords Collagen type IV alpha-3-binding protein
publication title Structural basis for the Golgi association by the pleckstrin homology domain of the ceramide trafficking protein (CERT)
pubmed doi rcsb
source organism Homo sapiens
total genus 15
structure length 94
sequence length 94
ec nomenclature
pdb deposition date 2012-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2rsgA00
4GN1A 1DDVA 2LKOA 2YT1A 2HE7A 2CODA 2X18A 1X05A 5KCVA 1Q67A 1QC6A 1DDMA 2ZPYA 1PMSA 2J59M 2K2JA 2YRYA 2LOXA 1WJ1A 1GC7A 3N7CA 2PZ1A 1V5UA 2Q13A 3HK0A 1X1FA 4NSWA 3SV1A 1V61A 2DX1A 3P6AA 3ULCA 2DTCA 4F7UP 1MK7B 2EMSA 1GC6A 4KHOA 2OTXA 2RGNB 2GS0A 1FHWA 3WYFB 2JP2A 4MK0A 2GJYA 2D4QA 3KY9A 5C16A 3ZVRA 2D11A 2L1CA 1Z87A 3PG7A 1BAKA 2Y8FA 3FSSA 2CY5A 3O96A 1LW3A 2R0DA 1X1GA 3PP2A 1X11A 1U5DA 2KGXB 2YS5A 1E5WA 2I1KA 2YS3A 1ZVRA 2YF0A 4D0NB 1DROA 1XCGA 3PVUA 1EGXA 2W2XC 3PEGA 4TYZA 1I7AA 1Y19B 4HAYB 2COAA 2E2XA 4GPTB 2DHKA 4CHMA 2YS1A 3A8PA 1K5GB 2P8VA 3A98B 5LOPB 3VOQA 4HHVA 2K2UA 3A8QA 1J19A 2GCJA 4ZRIA 5JHHA 5J3QA 4DXAB 4HAVB 1ZC4B 3ODWA 2ELBA 2D10A 3PVWA 2LG1A 3KSYA 4A6KA 2DFKA 1OQNA 2VKIA 3V5WA 1WJMA 1DDWA 1EF1A 1SGHA 4WSFA 3KRXA 1UPRA 2D9VA 3QIJA 2R09A 4HAWB 2AL6A 1PLSA 4A6HA 3TO1A 1UNRA 2UZSA 1XODA 4GMVA 5DHFB 1FGYA 3SUZA 5JLJB 4HAZB 2UVMA 3ODXA 2D9YA 3SNHA 1ISNA 1U5EA 1J0WA 2DLWA 4P7IA 4HATB 5FI0A 4C0AA 1WI1A 2J0JA 2CY4A 2D9WA 1U29A 3SYXA 4Y94A 1EVHA 2EMTA 4YONA 5CLLB 3AU4A 3DXDA 5DIFB 3ULBA 2ROZB 3U8ZA 3BINA 5HE2A 4BBKA 4WVFB 5C5BA 2Z0QA 5GOWB 2COFA 1SHCA 4EMOA 1FHOA 4A5KA 3BJIA 2DKQA 1UPQA 2UZRA 1P6SA 1P3RA 2DYNA 2VSZA 2Y8GA 4HDOA 2N23A 4HAUB 1RRPB 1MAIA 5FI1A 5L81A 2N0YA 5JHGA 2I5FA 2I5CA 5D3XA 1IRSA 5LONB 5JP4A 1NU2A 1ZC3B 3QBVB 1FGZA 3DXCA 1M7RA 4HB4B 4PQ0A 4GXBA 4MT7A 3MPXA 5D3YA 1WGQA 1KZ7A 1AWEA 2XQNM 2IYBA 1H10A 4IAPA 3AJ4A 4K2PA 5J3TA 4HAXB 2VRWB 5HE0A 2H7DA 1QQGA 4WJ7A 4ZRJA 2J0MA 3KZ1A 1BTNA 1V5PA 3T06A 3X23A 3GYOA 3KRWA 1N3HA 2M38A 2W2WA 3LJUX 3TFMA 1NTYA 1UNPA 2DKPA 1P5TA 2BCJA 2YSZA 5D3VA 5C79A 5J3YA 1DBHA 1UEFA 3HW2B 1DYNA 1UNQA 3SO6A 1ZSQA 1H4RA 2RLOA 3MDBC 2G35A 3D8DA 3M1IB 1FAOA 2DN6A 1NTVA 1TJ6A 1WVHA 3PSCA 3U7DA 2KCJA 2IFSA 1B55A 2LOZA 1U2BA 3CIKA 4CHJA 1NI2A 2CRFA 2DHIA 1FHXA 1W1HA 3P7ZA 4Z2MB 4A6FA 2CAYA 3UZTA 3D8FA 4KHAA 1XKEA 5D27A 1W1GA 4KAXB 2Z0PA 1KI1B 3FEHA 5CLQB 2HTHB 5C5BB 4B6HA 2ADZA 4IFSA 1WGUA 1BWNA 2YVCA 2KUPA 2EJ8A 4K17A 2ELAA 2DX5A 2NMBA 1MIZB 4IOYX 4ZRKA 5DHAB 4GZUA 2RSGA 4L6EA 1V88A 4DX8A 2COCA 3PVLA 2MDXA 2ROVA 1MKEA 3ML4A 4F7GA 1PFJA 1U5FA 4DX90 1GG3A 2Y7BA 4HDQA 1U5GA 2P0FA 1AQCA 2I1JA 4XWXA 2M14A 4EKUA 2YT0A 2DYQA 2EC1A 1I2HA 1KZGA 4H8SA 5HE1A 3TW1A 1EAZA 2GCLA 2D9XA 2J0KA 5KQ4A 5DH9B 3IVFA 2RVBB 1FB8A 4KVGB 5C6RA 2DA0A 1V89A 1MPHA 2FJLA 1XX0A 4K2OA 1BTKA 2P0DA 3NSUA 5D3WA 1XR0B 4HB2B 3FM8C 1V5MA 1OMWA 1RJ2A 2H7EA 4GMXB 1U27A 1K5DB 3D8EA 3G9WA 4HB0B 1Y5OA 2MWNB 4MY6A 3TCAA 1WG7A 3OANA 1X86A 2AEHA 5HE3A 2RUKB 4YL8A 4Z2NA 4A6FB 3RCPA 4KHBB 4F7HA 1OY2A 4EJNA 1MIXA 3F0WA 3ZDTA 3PZDA 2P0HA 2QKMA 3CXBB 2NZ8B 1MK9B 3TVVA 4PNKA 1LB1A 2LULA 3WA0A 2OQBA 1ZM0A 3AU5A 1FOEA 2RNRB 2D9ZA 4TKNA 4NY0A 2MFQA 2LYDA 2L2IA 1M7EA 5KQ1A 3F5RA 2QKLA 2Z0OA 3DXEA 2DHJA 3ODOA 1W1DA 1XD4A 1TXDA 3QWMA 1TQZA 4K81A 4HB3B 2V76A 5DI9B 2D2QA 2K00A 5EFXA 3HQCA 2MKRA 3VIAA 4DBBA 2W2XD 3GYPA 4CYEA
chains in the Genus database with same CATH superfamily
4GN1A 1DDVA 2LKOA 2YT1A 2HE7A 2CODA 2X18A 1X05A 5KCVA 1Q67A 1QC6A 1DDMA 2ZPYA 1PMSA 2J59M 2K2JA 2YRYA 3DCXA 2LOXA 2KIEA 1WJ1A 1GC7A 3N7CA 2PZ1A 1V5UA 2K8EA 2Q13A 3HK0A 1X1FA 4NSWA 3SV1A 1V61A 2DX1A 3P6AA 3ULCA 2DTCA 4DIXA 4F7UP 1MK7B 2EMSA 1GC6A 4KHOA 2OTXA 2RGNB 2GS0A 1FHWA 3WYFB 2JP2A 4MK0A 2GJYA 2D4QA 3KY9A 5C16A 3ZVRA 2D11A 2L1CA 1Z87A 3PG7A 1BAKA 4GNKB 2Y8FA 3FSSA 2CY5A 3O96A 1LW3A 3A58A 5I2SA 2R0DA 1X1GA 3PP2A 1X11A 4QXAB 1U5DA 2KGXB 2YS5A 1E5WA 3NWDA 2I1KA 2YS3A 1ZVRA 2YF0A 4QJ3B 4D0NB 1DROA 1XCGA 3PVUA 1EGXA 2W2XC 3PEGA 4TYZA 1I7AA 1Y19B 4L1RA 3NW8A 4HAYB 2COAA 2E2XA 4GPTB 2DHKA 4CHMA 2YS1A 3A8PA 1K5GB 2P8VA 3A98B 5LOPB 3VOQA 4HHVA 2K2UA 3A8QA 1J19A 2GCJA 4ZRIA 5JHHA 5J3QA 4DXAB 4HAVB 1ZC4B 3ODWA 2ELBA 2D10A 3PVWA 2LG1A 3KSYA 4CSQA 4A6KA 2DFKA 1OQNA 2VKIA 3V5WA 1WJMA 1DDWA 1EF1A 1SGHA 4WSFA 3KRXA 1UPRA 2D9VA 3QIJA 2R09A 4HAWB 2AL6A 1PLSA 4A6HA 3TO1A 1UNRA 2UZSA 1XODA 4GMVA 5DHFB 1FGYA 3SUZA 5JLJB 4HAZB 2UVMA 3ODXA 2D9YA 3SNHA 1ISNA 1U5EA 1J0WA 2DLWA 4P7IA 4HATB 5FI0A 4C0AA 1WI1A 3NWAA 2J0JA 2CY4A 2D9WA 1U29A 3SYXA 4Y94A 1EVHA 2EMTA 4YONA 5CLLB 1MI1A 3AU4A 3DXDA 5DIFB 3ULBA 2ROZB 3OHMB 3U8ZA 3BINA 5HE2A 4BBKA 4WVFB 5C5BA 2K49A 2Z0QA 5GOWB 2COFA 1SHCA 4EMOA 1FHOA 4A5KA 3BJIA 5M4YB 2DKQA 1UPQA 2UZRA 1P6SA 1P3RA 2DYNA 2VSZA 2Y8GA 4HDOA 2N23A 4HAUB 1RRPB 1MAIA 5FI1A 5L81A 2N0YA 5JHGA 2I5FA 2I5CA 5D3XA 1IRSA 5LONB 4GOUA 5JP4A 1NU2A 1ZC3B 3QBVB 1FGZA 3DXCA 1M7RA 4HB4B 4PQ0A 4GXBA 5IRSA 4MT7A 3MPXA 5D3YA 1WGQA 1KZ7A 1AWEA 2XQNM 2IYBA 1H10A 4IAPA 4OT1A 3AJ4A 4K2PA 5J3TA 3HSAA 4HAXB 2VRWB 5HE0A 2H7DA 1QQGA 4WJ7A 4ZRJA 2J0MA 3KZ1A 1BTNA 1V5PA 3T06A 3X23A 3GYOA 3KRWA 1N3HA 2M38A 2W2WA 3LJUX 3TFMA 1NTYA 1UNPA 2DKPA 1P5TA 2BCJA 2YSZA 5D3VA 5C79A 3U12A 5J3YA 1DBHA 1UEFA 4HSIA 5LG4B 3HW2B 1DYNA 1UNQA 3SO6A 1ZSQA 1H4RA 2RLOA 3MDBC 2G35A 4QJ5B 1T77A 3D8DA 1ZYIA 3M1IB 1FAOA 2DN6A 1NTVA 1TJ6A 1WVHA 3PSCA 3U7DA 2KCJA 2IFSA 1B55A 2LOZA 1U2BA 3CIKA 4CHJA 1NI2A 2CRFA 2DHIA 1FHXA 1W1HA 3P7ZA 4Z2MB 4A6FA 4KHBA 2CAYA 3UZTA 3D8FA 4KHAA 1XKEA 5D27A 1W1GA 4KAXB 2Z0PA 2Z4DA 1KI1B 3FEHA 5CLQB 2HTHB 5C5BB 2R2YA 4B6HA 2ADZA 4IFSA 3FVCA 1WGUA 1BWNA 2YVCA 2KUPA 2EJ8A 4K17A 2ELAA 2DX5A 2NMBA 1MIZB 4IOYX 4ZRKA 5DHAB 4GZUA 2RSGA 4L6EA 1V88A 4DX8A 2COCA 3PVLA 2MDXA 2ROVA 2RRFA 2ZKMX 1MKEA 3ML4A 4F7GA 1PFJA 1U5FA 4DX90 1GG3A 2Y7BA 4HDQA 1U5GA 2P0FA 1AQCA 2I1JA 4XWXA 2M14A 4EKUA 4OSNA 2YT0A 2DYQA 2EC1A 1I2HA 1KZGA 4H8SA 5HE1A 3TW1A 1EAZA 2GCLA 2D9XA 2J0KA 5KQ4A 5DH9B 2YT2A 3IVFA 2RVBB 1FB8A 4KVGB 5C6RA 2DA0A 1V89A 1MPHA 2FJLA 1XX0A 4K2OA 1BTKA 2P0DA 3NSUA 5D3WA 1XR0B 4HB2B 3FM8C 1V5MA 1OMWA 2KUQA 1RJ2A 2H7EA 4GMXB 1U27A 1K5DB 3D8EA 3G9WA 4HB0B 2KR0A 1Y5OA 2MWNB 4MY6A 2KIGA 3TCAA 2Z14A 1WG7A 3OANA 1X86A 2AEHA 2FJUB 2RUKB 5HE3A 4YL8A 4Z2NA 4A6FB 3RCPA 4QJ4B 4KHBB 4F7HA 1OY2A 4EJNA 1MIXA 3F0WA 3ZDTA 3PZDA 2P0HA 2QKMA 3CXBB 2NZ8B 1MK9B 3TVVA 4PNKA 1LB1A 2LULA 3WA0A 3B77A 2OQBA 1ZM0A 3AU5A 1FOEA 2RNRB 2D9ZA 4TKNA 4NY0A 2MFQA 2LYDA 2L2IA 1M7EA 5KQ1A 3F5RA 2QKLA 3NWFA 2Z0OA 3DXEA 2NBVA 2DHJA 3ODOA 1W1DA 1XD4A 2GUMA 1TXDA 5I2MA 3QWMA 1TQZA 2Z13A 2Z59A 4D6WA 4K81A 4HB3B 2V76A 5DI9B 2D2QA 2K00A 3HIEA 5EFXA 3HQCA 2MKRA 3VIAA 4DBBA 2W2XD 3GYPA 4CYEA
chains in the Genus database with same CATH topology
4GN1A 1DDVA 2LKOA 2YT1A 2HE7A 2CODA 2X18A 1X05A 5KCVA 1Q67A 1QC6A 1DDMA 2ZPYA 1PMSA 2J59M 2K2JA 2YRYA 2LOXA 1WJ1A 1GC7A 3N7CA 2PZ1A 1V5UA 2Q13A 3HK0A 1X1FA 4NSWA 3SV1A 1V61A 2DX1A 3P6AA 3ULCA 2DTCA 4F7UP 1MK7B 2EMSA 1GC6A 4KHOA 2OTXA 2RGNB 2GS0A 1FHWA 3WYFB 2JP2A 4MK0A 2GJYA 2D4QA 3KY9A 5C16A 3ZVRA 2D11A 2L1CA 1Z87A 3PG7A 1BAKA 2Y8FA 3FSSA 2CY5A 3O96A 1LW3A 2R0DA 1X1GA 3PP2A 1X11A 1U5DA 2KGXB 2YS5A 1E5WA 2I1KA 2YS3A 1ZVRA 2YF0A 4D0NB 1DROA 1XCGA 3PVUA 1EGXA 2W2XC 3PEGA 4TYZA 1I7AA 1Y19B 4HAYB 2COAA 2E2XA 4GPTB 2DHKA 4CHMA 2YS1A 3A8PA 1K5GB 2P8VA 3A98B 5LOPB 3VOQA 4HHVA 2K2UA 3A8QA 1J19A 2GCJA 4ZRIA 5JHHA 5J3QA 4DXAB 4HAVB 1ZC4B 3ODWA 2ELBA 2D10A 3PVWA 2LG1A 3KSYA 4A6KA 2DFKA 1OQNA 2VKIA 3V5WA 1WJMA 1DDWA 1EF1A 1SGHA 4WSFA 3KRXA 1UPRA 2D9VA 3QIJA 2R09A 4HAWB 2AL6A 1PLSA 4A6HA 3TO1A 1UNRA 2UZSA 1XODA 4GMVA 5DHFB 1FGYA 3SUZA 5JLJB 4HAZB 2UVMA 3ODXA 2D9YA 3SNHA 1ISNA 1U5EA 1J0WA 2DLWA 4P7IA 4HATB 5FI0A 4C0AA 1WI1A 2J0JA 2CY4A 2D9WA 1U29A 3SYXA 4Y94A 1EVHA 2EMTA 4YONA 5CLLB 3AU4A 3DXDA 5DIFB 3ULBA 2ROZB 3U8ZA 3BINA 5HE2A 4BBKA 4WVFB 5C5BA 2Z0QA 5GOWB 2COFA 1SHCA 4EMOA 1FHOA 4A5KA 3BJIA 2DKQA 1UPQA 2UZRA 1P6SA 1P3RA 2DYNA 2VSZA 2Y8GA 4HDOA 2N23A 4HAUB 1RRPB 1MAIA 5FI1A 5L81A 2N0YA 5JHGA 2I5FA 2I5CA 5D3XA 1IRSA 5LONB 5JP4A 1NU2A 1ZC3B 3QBVB 1FGZA 3DXCA 1M7RA 4HB4B 4PQ0A 4GXBA 4MT7A 3MPXA 5D3YA 1WGQA 1KZ7A 1AWEA 2XQNM 2IYBA 1H10A 4IAPA 3AJ4A 4K2PA 5J3TA 4HAXB 2VRWB 5HE0A 2H7DA 1QQGA 4WJ7A 4ZRJA 2J0MA 3KZ1A 1BTNA 1V5PA 3T06A 3X23A 3GYOA 3KRWA 1N3HA 2M38A 2W2WA 3LJUX 3TFMA 1NTYA 1UNPA 2DKPA 1P5TA 2BCJA 2YSZA 5D3VA 5C79A 5J3YA 1DBHA 1UEFA 3HW2B 1DYNA 1UNQA 3SO6A 1ZSQA 1H4RA 2RLOA 3MDBC 2G35A 3D8DA 3M1IB 1FAOA 2DN6A 1NTVA 1TJ6A 1WVHA 3PSCA 3U7DA 2KCJA 2IFSA 1B55A 2LOZA 1U2BA 3CIKA 4CHJA 1NI2A 2CRFA 2DHIA 1FHXA 1W1HA 3P7ZA 4Z2MB 4A6FA 2CAYA 3UZTA 3D8FA 4KHAA 1XKEA 5D27A 1W1GA 4KAXB 2Z0PA 1KI1B 3FEHA 5CLQB 2HTHB 5C5BB 4B6HA 2ADZA 4IFSA 1WGUA 1BWNA 2YVCA 2KUPA 2EJ8A 4K17A 2ELAA 2DX5A 2NMBA 1MIZB 4IOYX 4ZRKA 5DHAB 4GZUA 2RSGA 4L6EA 1V88A 4DX8A 2COCA 3PVLA 2MDXA 2ROVA 1MKEA 3ML4A 4F7GA 1PFJA 1U5FA 4DX90 1GG3A 2Y7BA 4HDQA 1U5GA 2P0FA 1AQCA 2I1JA 4XWXA 2M14A 4EKUA 2YT0A 2DYQA 2EC1A 1I2HA 1KZGA 4H8SA 5HE1A 3TW1A 1EAZA 2GCLA 2D9XA 2J0KA 5KQ4A 5DH9B 3IVFA 2RVBB 1FB8A 4KVGB 5C6RA 2DA0A 1V89A 1MPHA 2FJLA 1XX0A 4K2OA 1BTKA 2P0DA 3NSUA 5D3WA 1XR0B 4HB2B 3FM8C 1V5MA 1OMWA 1RJ2A 2H7EA 4GMXB 1U27A 1K5DB 3D8EA 3G9WA 4HB0B 1Y5OA 2MWNB 4MY6A 3TCAA 1WG7A 3OANA 1X86A 2AEHA 5HE3A 2RUKB 4YL8A 4Z2NA 4A6FB 3RCPA 4KHBB 4F7HA 1OY2A 4EJNA 1MIXA 3F0WA 3ZDTA 3PZDA 2P0HA 2QKMA 3CXBB 2NZ8B 1MK9B 3TVVA 4PNKA 1LB1A 2LULA 3WA0A 2OQBA 1ZM0A 3AU5A 1FOEA 2RNRB 2D9ZA 4TKNA 4NY0A 2MFQA 2LYDA 2L2IA 1M7EA 5KQ1A 3F5RA 2QKLA 2Z0OA 3DXEA 2DHJA 3ODOA 1W1DA 1XD4A 1TXDA 3QWMA 1TQZA 4K81A 4HB3B 2V76A 5DI9B 2D2QA 2K00A 5EFXA 3HQCA 2MKRA 3VIAA 4DBBA 2W2XD 3GYPA 4CYEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GN1 A;  1DDV A;  2LKO A;  2YT1 A;  2HE7 A;  2COD A;  2X18 A;  1X05 A;  5KCV A;  1Q67 A;  1QC6 A;  1DDM A;  2ZPY A;  1PMS A;  2J59 M;  2K2J A;  2YRY A;  2LOX A;  1WJ1 A;  1GC7 A;  3N7C A;  2PZ1 A;  1V5U A;  2Q13 A;  3HK0 A;  1X1F A;  4NSW A;  3SV1 A;  1V61 A;  2DX1 A;  3P6A A;  3ULC A;  2DTC A;  4F7U P;  1MK7 B;  2EMS A;  1GC6 A;  4KHO A;  2OTX A;  2RGN B;  2GS0 A;  1FHW A;  3WYF B;  2JP2 A;  4MK0 A;  2GJY A;  2D4Q A;  3KY9 A;  5C16 A;  3ZVR A;  2D11 A;  2L1C A;  1Z87 A;  3PG7 A;  1BAK A;  2Y8F A;  3FSS A;  2CY5 A;  3O96 A;  1LW3 A;  2R0D A;  1X1G A;  3PP2 A;  1X11 A;  1U5D A;  2KGX B;  2YS5 A;  1E5W A;  2I1K A;  2YS3 A;  1ZVR A;  2YF0 A;  4D0N B;  1DRO A;  1XCG A;  3PVU A;  1EGX A;  2W2X C;  3PEG A;  4TYZ A;  1I7A A;  1Y19 B;  4HAY B;  2COA A;  2E2X A;  4GPT B;  2DHK A;  4CHM A;  2YS1 A;  3A8P A;  1K5G B;  2P8V A;  3A98 B;  5LOP B;  3VOQ A;  4HHV A;  2K2U A;  3A8Q A;  1J19 A;  2GCJ A;  4ZRI A;  5JHH A;  5J3Q A;  4DXA B;  4HAV B;  1ZC4 B;  3ODW A;  2ELB A;  2D10 A;  3PVW A;  2LG1 A;  3KSY A;  4A6K A;  2DFK A;  1OQN A;  2VKI A;  3V5W A;  1WJM A;  1DDW A;  1EF1 A;  1SGH A;  4WSF A;  3KRX A;  1UPR A;  2D9V A;  3QIJ A;  2R09 A;  4HAW B;  2AL6 A;  1PLS A;  4A6H A;  3TO1 A;  1UNR A;  2UZS A;  1XOD A;  4GMV A;  5DHF B;  1FGY A;  3SUZ A;  5JLJ B;  4HAZ B;  2UVM A;  3ODX A;  2D9Y A;  3SNH A;  1ISN A;  1U5E A;  1J0W A;  2DLW A;  4P7I A;  4HAT B;  5FI0 A;  4C0A A;  1WI1 A;  2J0J A;  2CY4 A;  2D9W A;  1U29 A;  3SYX A;  4Y94 A;  1EVH A;  2EMT A;  4YON A;  5CLL B;  3AU4 A;  3DXD A;  5DIF B;  3ULB A;  2ROZ B;  3U8Z A;  3BIN A;  5HE2 A;  4BBK A;  4WVF B;  5C5B A;  2Z0Q A;  5GOW B;  2COF A;  1SHC A;  4EMO A;  1FHO A;  4A5K A;  3BJI A;  2DKQ A;  1UPQ A;  2UZR A;  1P6S A;  1P3R A;  2DYN A;  2VSZ A;  2Y8G A;  4HDO A;  2N23 A;  4HAU B;  1RRP B;  1MAI A;  5FI1 A;  5L81 A;  2N0Y A;  5JHG A;  2I5F A;  2I5C A;  5D3X A;  1IRS A;  5LON B;  5JP4 A;  1NU2 A;  1ZC3 B;  3QBV B;  1FGZ A;  3DXC A;  1M7R A;  4HB4 B;  4PQ0 A;  4GXB A;  4MT7 A;  3MPX A;  5D3Y A;  1WGQ A;  1KZ7 A;  1AWE A;  2XQN M;  2IYB A;  1H10 A;  4IAP A;  3AJ4 A;  4K2P A;  5J3T A;  4HAX B;  2VRW B;  5HE0 A;  2H7D A;  1QQG A;  4WJ7 A;  4ZRJ A;  2J0M A;  3KZ1 A;  1BTN A;  1V5P A;  3T06 A;  3X23 A;  3GYO A;  3KRW A;  1N3H A;  2M38 A;  2W2W A;  3LJU X;  3TFM A;  1NTY A;  1UNP A;  2DKP A;  1P5T A;  2BCJ A;  2YSZ A;  5D3V A;  5C79 A;  5J3Y A;  1DBH A;  1UEF A;  3HW2 B;  1DYN A;  1UNQ A;  3SO6 A;  1ZSQ A;  1H4R A;  2RLO A;  3MDB C;  2G35 A;  3D8D A;  3M1I B;  1FAO A;  2DN6 A;  1NTV A;  1TJ6 A;  1WVH A;  3PSC A;  3U7D A;  2KCJ A;  2IFS A;  1B55 A;  2LOZ A;  1U2B A;  3CIK A;  4CHJ A;  1NI2 A;  2CRF A;  2DHI A;  1FHX A;  1W1H A;  3P7Z A;  4Z2M B;  4A6F A;  2CAY A;  3UZT A;  3D8F A;  4KHA A;  1XKE A;  5D27 A;  1W1G A;  4KAX B;  2Z0P A;  1KI1 B;  3FEH A;  5CLQ B;  2HTH B;  5C5B B;  4B6H A;  2ADZ A;  4IFS A;  1WGU A;  1BWN A;  2YVC A;  2KUP A;  2EJ8 A;  4K17 A;  2ELA A;  2DX5 A;  2NMB A;  1MIZ B;  4IOY X;  4ZRK A;  5DHA B;  4GZU A;  2RSG A;  4L6E A;  1V88 A;  4DX8 A;  2COC A;  3PVL A;  2MDX A;  2ROV A;  1MKE A;  3ML4 A;  4F7G A;  1PFJ A;  1U5F A;  4DX9 0;  1GG3 A;  2Y7B A;  4HDQ A;  1U5G A;  2P0F A;  1AQC A;  2I1J A;  4XWX A;  2M14 A;  4EKU A;  2YT0 A;  2DYQ A;  2EC1 A;  1I2H A;  1KZG A;  4H8S A;  5HE1 A;  3TW1 A;  1EAZ A;  2GCL A;  2D9X A;  2J0K A;  5KQ4 A;  5DH9 B;  3IVF A;  2RVB B;  1FB8 A;  4KVG B;  5C6R A;  2DA0 A;  1V89 A;  1MPH A;  2FJL A;  1XX0 A;  4K2O A;  1BTK A;  2P0D A;  3NSU A;  5D3W A;  1XR0 B;  4HB2 B;  3FM8 C;  1V5M A;  1OMW A;  1RJ2 A;  2H7E A;  4GMX B;  1U27 A;  1K5D B;  3D8E A;  3G9W A;  4HB0 B;  1Y5O A;  2MWN B;  4MY6 A;  3TCA A;  1WG7 A;  3OAN A;  1X86 A;  2AEH A;  5HE3 A;  2RUK B;  4YL8 A;  4Z2N A;  4A6F B;  3RCP A;  4KHB B;  4F7H A;  1OY2 A;  4EJN A;  1MIX A;  3F0W A;  3ZDT A;  3PZD A;  2P0H A;  2QKM A;  3CXB B;  2NZ8 B;  1MK9 B;  3TVV A;  4PNK A;  1LB1 A;  2LUL A;  3WA0 A;  2OQB A;  1ZM0 A;  3AU5 A;  1FOE A;  2RNR B;  2D9Z A;  4TKN A;  4NY0 A;  2MFQ A;  2LYD A;  2L2I A;  1M7E A;  5KQ1 A;  3F5R A;  2QKL A;  2Z0O A;  3DXE A;  2DHJ A;  3ODO A;  1W1D A;  1XD4 A;  1TXD A;  3QWM A;  1TQZ A;  4K81 A;  4HB3 B;  2V76 A;  5DI9 B;  2D2Q A;  2K00 A;  5EFX A;  3HQC A;  2MKR A;  3VIA A;  4DBB A;  2W2X D;  3GYP A;  4CYE A; 
#chains in the Genus database with same CATH topology
 4GN1 A;  1DDV A;  2LKO A;  2YT1 A;  2HE7 A;  2COD A;  2X18 A;  1X05 A;  5KCV A;  1Q67 A;  1QC6 A;  1DDM A;  2ZPY A;  1PMS A;  2J59 M;  2K2J A;  2YRY A;  3DCX A;  2LOX A;  2KIE A;  1WJ1 A;  1GC7 A;  3N7C A;  2PZ1 A;  1V5U A;  2K8E A;  2Q13 A;  3HK0 A;  1X1F A;  4NSW A;  3SV1 A;  1V61 A;  2DX1 A;  3P6A A;  3ULC A;  2DTC A;  4DIX A;  4F7U P;  1MK7 B;  2EMS A;  1GC6 A;  4KHO A;  2OTX A;  2RGN B;  2GS0 A;  1FHW A;  3WYF B;  2JP2 A;  4MK0 A;  2GJY A;  2D4Q A;  3KY9 A;  5C16 A;  3ZVR A;  2D11 A;  2L1C A;  1Z87 A;  3PG7 A;  1BAK A;  4GNK B;  2Y8F A;  3FSS A;  2CY5 A;  3O96 A;  1LW3 A;  3A58 A;  5I2S A;  2R0D A;  1X1G A;  3PP2 A;  1X11 A;  4QXA B;  1U5D A;  2KGX B;  2YS5 A;  1E5W A;  3NWD A;  2I1K A;  2YS3 A;  1ZVR A;  2YF0 A;  4QJ3 B;  4D0N B;  1DRO A;  1XCG A;  3PVU A;  1EGX A;  2W2X C;  3PEG A;  4TYZ A;  1I7A A;  1Y19 B;  4L1R A;  3NW8 A;  4HAY B;  2COA A;  2E2X A;  4GPT B;  2DHK A;  4CHM A;  2YS1 A;  3A8P A;  1K5G B;  2P8V A;  3A98 B;  5LOP B;  3VOQ A;  4HHV A;  2K2U A;  3A8Q A;  1J19 A;  2GCJ A;  4ZRI A;  5JHH A;  5J3Q A;  4DXA B;  4HAV B;  1ZC4 B;  3ODW A;  2ELB A;  2D10 A;  3PVW A;  2LG1 A;  3KSY A;  4CSQ A;  4A6K A;  2DFK A;  1OQN A;  2VKI A;  3V5W A;  1WJM A;  1DDW A;  1EF1 A;  1SGH A;  4WSF A;  3KRX A;  1UPR A;  2D9V A;  3QIJ A;  2R09 A;  4HAW B;  2AL6 A;  1PLS A;  4A6H A;  3TO1 A;  1UNR A;  2UZS A;  1XOD A;  4GMV A;  5DHF B;  1FGY A;  3SUZ A;  5JLJ B;  4HAZ B;  2UVM A;  3ODX A;  2D9Y A;  3SNH A;  1ISN A;  1U5E A;  1J0W A;  2DLW A;  4P7I A;  4HAT B;  5FI0 A;  4C0A A;  1WI1 A;  3NWA A;  2J0J A;  2CY4 A;  2D9W A;  1U29 A;  3SYX A;  4Y94 A;  1EVH A;  2EMT A;  4YON A;  5CLL B;  1MI1 A;  3AU4 A;  3DXD A;  5DIF B;  3ULB A;  2ROZ B;  3OHM B;  3U8Z A;  3BIN A;  5HE2 A;  4BBK A;  4WVF B;  5C5B A;  2K49 A;  2Z0Q A;  5GOW B;  2COF A;  1SHC A;  4EMO A;  1FHO A;  4A5K A;  3BJI A;  5M4Y B;  2DKQ A;  1UPQ A;  2UZR A;  1P6S A;  1P3R A;  2DYN A;  2VSZ A;  2Y8G A;  4HDO A;  2N23 A;  4HAU B;  1RRP B;  1MAI A;  5FI1 A;  5L81 A;  2N0Y A;  5JHG A;  2I5F A;  2I5C A;  5D3X A;  1IRS A;  5LON B;  4GOU A;  5JP4 A;  1NU2 A;  1ZC3 B;  3QBV B;  1FGZ A;  3DXC A;  1M7R A;  4HB4 B;  4PQ0 A;  4GXB A;  5IRS A;  4MT7 A;  3MPX A;  5D3Y A;  1WGQ A;  1KZ7 A;  1AWE A;  2XQN M;  2IYB A;  1H10 A;  4IAP A;  4OT1 A;  3AJ4 A;  4K2P A;  5J3T A;  3HSA A;  4HAX B;  2VRW B;  5HE0 A;  2H7D A;  1QQG A;  4WJ7 A;  4ZRJ A;  2J0M A;  3KZ1 A;  1BTN A;  1V5P A;  3T06 A;  3X23 A;  3GYO A;  3KRW A;  1N3H A;  2M38 A;  2W2W A;  3LJU X;  3TFM A;  1NTY A;  1UNP A;  2DKP A;  1P5T A;  2BCJ A;  2YSZ A;  5D3V A;  5C79 A;  3U12 A;  5J3Y A;  1DBH A;  1UEF A;  4HSI A;  5LG4 B;  3HW2 B;  1DYN A;  1UNQ A;  3SO6 A;  1ZSQ A;  1H4R A;  2RLO A;  3MDB C;  2G35 A;  4QJ5 B;  1T77 A;  3D8D A;  1ZYI A;  3M1I B;  1FAO A;  2DN6 A;  1NTV A;  1TJ6 A;  1WVH A;  3PSC A;  3U7D A;  2KCJ A;  2IFS A;  1B55 A;  2LOZ A;  1U2B A;  3CIK A;  4CHJ A;  1NI2 A;  2CRF A;  2DHI A;  1FHX A;  1W1H A;  3P7Z A;  4Z2M B;  4A6F A;  4KHB A;  2CAY A;  3UZT A;  3D8F A;  4KHA A;  1XKE A;  5D27 A;  1W1G A;  4KAX B;  2Z0P A;  2Z4D A;  1KI1 B;  3FEH A;  5CLQ B;  2HTH B;  5C5B B;  2R2Y A;  4B6H A;  2ADZ A;  4IFS A;  3FVC A;  1WGU A;  1BWN A;  2YVC A;  2KUP A;  2EJ8 A;  4K17 A;  2ELA A;  2DX5 A;  2NMB A;  1MIZ B;  4IOY X;  4ZRK A;  5DHA B;  4GZU A;  2RSG A;  4L6E A;  1V88 A;  4DX8 A;  2COC A;  3PVL A;  2MDX A;  2ROV A;  2RRF A;  2ZKM X;  1MKE A;  3ML4 A;  4F7G A;  1PFJ A;  1U5F A;  4DX9 0;  1GG3 A;  2Y7B A;  4HDQ A;  1U5G A;  2P0F A;  1AQC A;  2I1J A;  4XWX A;  2M14 A;  4EKU A;  4OSN A;  2YT0 A;  2DYQ A;  2EC1 A;  1I2H A;  1KZG A;  4H8S A;  5HE1 A;  3TW1 A;  1EAZ A;  2GCL A;  2D9X A;  2J0K A;  5KQ4 A;  5DH9 B;  2YT2 A;  3IVF A;  2RVB B;  1FB8 A;  4KVG B;  5C6R A;  2DA0 A;  1V89 A;  1MPH A;  2FJL A;  1XX0 A;  4K2O A;  1BTK A;  2P0D A;  3NSU A;  5D3W A;  1XR0 B;  4HB2 B;  3FM8 C;  1V5M A;  1OMW A;  2KUQ A;  1RJ2 A;  2H7E A;  4GMX B;  1U27 A;  1K5D B;  3D8E A;  3G9W A;  4HB0 B;  2KR0 A;  1Y5O A;  2MWN B;  4MY6 A;  2KIG A;  3TCA A;  2Z14 A;  1WG7 A;  3OAN A;  1X86 A;  2AEH A;  2FJU B;  2RUK B;  5HE3 A;  4YL8 A;  4Z2N A;  4A6F B;  3RCP A;  4QJ4 B;  4KHB B;  4F7H A;  1OY2 A;  4EJN A;  1MIX A;  3F0W A;  3ZDT A;  3PZD A;  2P0H A;  2QKM A;  3CXB B;  2NZ8 B;  1MK9 B;  3TVV A;  4PNK A;  1LB1 A;  2LUL A;  3WA0 A;  3B77 A;  2OQB A;  1ZM0 A;  3AU5 A;  1FOE A;  2RNR B;  2D9Z A;  4TKN A;  4NY0 A;  2MFQ A;  2LYD A;  2L2I A;  1M7E A;  5KQ1 A;  3F5R A;  2QKL A;  3NWF A;  2Z0O A;  3DXE A;  2NBV A;  2DHJ A;  3ODO A;  1W1D A;  1XD4 A;  2GUM A;  1TXD A;  5I2M A;  3QWM A;  1TQZ A;  2Z13 A;  2Z59 A;  4D6W A;  4K81 A;  4HB3 B;  2V76 A;  5DI9 B;  2D2Q A;  2K00 A;  3HIE A;  5EFX A;  3HQC A;  2MKR A;  3VIA A;  4DBB A;  2W2X D;  3GYP A;  4CYE A; 
#chains in the Genus database with same CATH homology
 4GN1 A;  1DDV A;  2LKO A;  2YT1 A;  2HE7 A;  2COD A;  2X18 A;  1X05 A;  5KCV A;  1Q67 A;  1QC6 A;  1DDM A;  2ZPY A;  1PMS A;  2J59 M;  2K2J A;  2YRY A;  2LOX A;  1WJ1 A;  1GC7 A;  3N7C A;  2PZ1 A;  1V5U A;  2Q13 A;  3HK0 A;  1X1F A;  4NSW A;  3SV1 A;  1V61 A;  2DX1 A;  3P6A A;  3ULC A;  2DTC A;  4F7U P;  1MK7 B;  2EMS A;  1GC6 A;  4KHO A;  2OTX A;  2RGN B;  2GS0 A;  1FHW A;  3WYF B;  2JP2 A;  4MK0 A;  2GJY A;  2D4Q A;  3KY9 A;  5C16 A;  3ZVR A;  2D11 A;  2L1C A;  1Z87 A;  3PG7 A;  1BAK A;  2Y8F A;  3FSS A;  2CY5 A;  3O96 A;  1LW3 A;  2R0D A;  1X1G A;  3PP2 A;  1X11 A;  1U5D A;  2KGX B;  2YS5 A;  1E5W A;  2I1K A;  2YS3 A;  1ZVR A;  2YF0 A;  4D0N B;  1DRO A;  1XCG A;  3PVU A;  1EGX A;  2W2X C;  3PEG A;  4TYZ A;  1I7A A;  1Y19 B;  4HAY B;  2COA A;  2E2X A;  4GPT B;  2DHK A;  4CHM A;  2YS1 A;  3A8P A;  1K5G B;  2P8V A;  3A98 B;  5LOP B;  3VOQ A;  4HHV A;  2K2U A;  3A8Q A;  1J19 A;  2GCJ A;  4ZRI A;  5JHH A;  5J3Q A;  4DXA B;  4HAV B;  1ZC4 B;  3ODW A;  2ELB A;  2D10 A;  3PVW A;  2LG1 A;  3KSY A;  4A6K A;  2DFK A;  1OQN A;  2VKI A;  3V5W A;  1WJM A;  1DDW A;  1EF1 A;  1SGH A;  4WSF A;  3KRX A;  1UPR A;  2D9V A;  3QIJ A;  2R09 A;  4HAW B;  2AL6 A;  1PLS A;  4A6H A;  3TO1 A;  1UNR A;  2UZS A;  1XOD A;  4GMV A;  5DHF B;  1FGY A;  3SUZ A;  5JLJ B;  4HAZ B;  2UVM A;  3ODX A;  2D9Y A;  3SNH A;  1ISN A;  1U5E A;  1J0W A;  2DLW A;  4P7I A;  4HAT B;  5FI0 A;  4C0A A;  1WI1 A;  2J0J A;  2CY4 A;  2D9W A;  1U29 A;  3SYX A;  4Y94 A;  1EVH A;  2EMT A;  4YON A;  5CLL B;  3AU4 A;  3DXD A;  5DIF B;  3ULB A;  2ROZ B;  3U8Z A;  3BIN A;  5HE2 A;  4BBK A;  4WVF B;  5C5B A;  2Z0Q A;  5GOW B;  2COF A;  1SHC A;  4EMO A;  1FHO A;  4A5K A;  3BJI A;  2DKQ A;  1UPQ A;  2UZR A;  1P6S A;  1P3R A;  2DYN A;  2VSZ A;  2Y8G A;  4HDO A;  2N23 A;  4HAU B;  1RRP B;  1MAI A;  5FI1 A;  5L81 A;  2N0Y A;  5JHG A;  2I5F A;  2I5C A;  5D3X A;  1IRS A;  5LON B;  5JP4 A;  1NU2 A;  1ZC3 B;  3QBV B;  1FGZ A;  3DXC A;  1M7R A;  4HB4 B;  4PQ0 A;  4GXB A;  4MT7 A;  3MPX A;  5D3Y A;  1WGQ A;  1KZ7 A;  1AWE A;  2XQN M;  2IYB A;  1H10 A;  4IAP A;  3AJ4 A;  4K2P A;  5J3T A;  4HAX B;  2VRW B;  5HE0 A;  2H7D A;  1QQG A;  4WJ7 A;  4ZRJ A;  2J0M A;  3KZ1 A;  1BTN A;  1V5P A;  3T06 A;  3X23 A;  3GYO A;  3KRW A;  1N3H A;  2M38 A;  2W2W A;  3LJU X;  3TFM A;  1NTY A;  1UNP A;  2DKP A;  1P5T A;  2BCJ A;  2YSZ A;  5D3V A;  5C79 A;  5J3Y A;  1DBH A;  1UEF A;  3HW2 B;  1DYN A;  1UNQ A;  3SO6 A;  1ZSQ A;  1H4R A;  2RLO A;  3MDB C;  2G35 A;  3D8D A;  3M1I B;  1FAO A;  2DN6 A;  1NTV A;  1TJ6 A;  1WVH A;  3PSC A;  3U7D A;  2KCJ A;  2IFS A;  1B55 A;  2LOZ A;  1U2B A;  3CIK A;  4CHJ A;  1NI2 A;  2CRF A;  2DHI A;  1FHX A;  1W1H A;  3P7Z A;  4Z2M B;  4A6F A;  2CAY A;  3UZT A;  3D8F A;  4KHA A;  1XKE A;  5D27 A;  1W1G A;  4KAX B;  2Z0P A;  1KI1 B;  3FEH A;  5CLQ B;  2HTH B;  5C5B B;  4B6H A;  2ADZ A;  4IFS A;  1WGU A;  1BWN A;  2YVC A;  2KUP A;  2EJ8 A;  4K17 A;  2ELA A;  2DX5 A;  2NMB A;  1MIZ B;  4IOY X;  4ZRK A;  5DHA B;  4GZU A;  2RSG A;  4L6E A;  1V88 A;  4DX8 A;  2COC A;  3PVL A;  2MDX A;  2ROV A;  1MKE A;  3ML4 A;  4F7G A;  1PFJ A;  1U5F A;  4DX9 0;  1GG3 A;  2Y7B A;  4HDQ A;  1U5G A;  2P0F A;  1AQC A;  2I1J A;  4XWX A;  2M14 A;  4EKU A;  2YT0 A;  2DYQ A;  2EC1 A;  1I2H A;  1KZG A;  4H8S A;  5HE1 A;  3TW1 A;  1EAZ A;  2GCL A;  2D9X A;  2J0K A;  5KQ4 A;  5DH9 B;  3IVF A;  2RVB B;  1FB8 A;  4KVG B;  5C6R A;  2DA0 A;  1V89 A;  1MPH A;  2FJL A;  1XX0 A;  4K2O A;  1BTK A;  2P0D A;  3NSU A;  5D3W A;  1XR0 B;  4HB2 B;  3FM8 C;  1V5M A;  1OMW A;  1RJ2 A;  2H7E A;  4GMX B;  1U27 A;  1K5D B;  3D8E A;  3G9W A;  4HB0 B;  1Y5O A;  2MWN B;  4MY6 A;  3TCA A;  1WG7 A;  3OAN A;  1X86 A;  2AEH A;  5HE3 A;  2RUK B;  4YL8 A;  4Z2N A;  4A6F B;  3RCP A;  4KHB B;  4F7H A;  1OY2 A;  4EJN A;  1MIX A;  3F0W A;  3ZDT A;  3PZD A;  2P0H A;  2QKM A;  3CXB B;  2NZ8 B;  1MK9 B;  3TVV A;  4PNK A;  1LB1 A;  2LUL A;  3WA0 A;  2OQB A;  1ZM0 A;  3AU5 A;  1FOE A;  2RNR B;  2D9Z A;  4TKN A;  4NY0 A;  2MFQ A;  2LYD A;  2L2I A;  1M7E A;  5KQ1 A;  3F5R A;  2QKL A;  2Z0O A;  3DXE A;  2DHJ A;  3ODO A;  1W1D A;  1XD4 A;  1TXD A;  3QWM A;  1TQZ A;  4K81 A;  4HB3 B;  2V76 A;  5DI9 B;  2D2Q A;  2K00 A;  5EFX A;  3HQC A;  2MKR A;  3VIA A;  4DBB A;  2W2X D;  3GYP A;  4CYE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...