2CY4A

Crystal structure of phosphotyrosine binding (ptb) domain of epidermal growth factor receptor pathway substrate-8 (eps8) related protein 1 from mus musculus (form-1 crystal)
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
129
structure length
129
Chain Sequence
ADVSQYHVNHLVTFCLGEEDGVHTVEDASRKLAVMDSQGRVWAQEMLLRVSPSQVTLLDPVSKEELESYPLDAIVRCDAVMPRGRSRSLLLLVCQEPERAQPDVHFFQGLLLGAELIREDIQGALQNYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of phosphotyrosine binding (PTB) domain of epidermal growth factor receptor pathway substrate-8 (EPS8) related protein 1 from Mus musculus (form-1 crystal)
rcsb
source organism Mus musculus
molecule tags Signaling protein
molecule keywords epidermal growth factor receptor pathway substrate 8-like pr
total genus 27
structure length 129
sequence length 129
ec nomenclature
pdb deposition date 2005-07-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08416 PTB Phosphotyrosine-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2cy4A00
3ULCA 4WVFB 3N7CA 3D8EA 5GOWB 4DX90 4NSWA 3P6AA 5HE0A 2D9VA 3KY9A 4EJNA 3RCPA 2CY4A 1GG3A 1N3HA 4IOYX 2W2WA 1J19A 2RSGA 1FHXA 1H4RA 1V5MA 1ZVRA 5C79A 2CAYA 2EC1A 3TW1A 2GCJA 1WGUA 1W1DA 2ADZA 5JHHA 3VOQA 4HAUB 2DA0A 2ELBA 4YONA 2M14A 2M38A 2X18A 1WI1A 1V88A 4TYZA 3A8QA 2J0KA 2DKQA 1U5FA 2UVMA 2YSZA 1XCGA 2COCA 3VIAA 2HE7A 3HK0A 2VKIA 1B55A 4GMXB 4HDQA 1V5UA 3CIKA 4IAPA 3PG7A 1U5DA 1X1GA 2W2XD 3CXBB 2D9WA 3PSCA 3DXEA 2VSZA 2HTHB 1MPHA 4GXBA 2MFQA 4DBBA 3ODWA 2ROVA 2JP2A 4KHOA 3GYOA 2K2UA 4L6EA 1ZC3B 1WJMA 5DIFB 1ZM0A 2XQNM 1PFJA 4CHMA 2G35A 1EGXA 1DDWA 3ML4A 2DTCA 1UPQA 4PQ0A 1Q67A 4K81A 4WJ7A 4XWXA 1ZC4B 4A6HA 3UZTA 4HAXB 1UPRA 1WG7A 1M7EA 1PMSA 2YRYA 2MWNB 1RJ2A 1KZGA 2CY5A 4K2OA 1LB1A 4GZUA 4PNKA 5CLLB 2NZ8B 3KRXA 2Z0OA 1X86A 2P0HA 2COAA 1K5DB 1W1GA 2KUPA 2N0YA 1P6SA 5JHGA 2DX5A 4MK0A 3QIJA 2I5FA 3NSUA 4YL8A 3PVWA 3O96A 1SHCA 4EMOA 2D10A 4HAZB 1RRPB 2RVBB 1NU2A 2D9ZA 5J3TA 1NTVA 4HB4B 4KVGB 3DXDA 1EAZA 3BINA 4KAXB 3P7ZA 2YS5A 4A6FB 1MAIA 5LOPB 3AU5A 5FI1A 2Q13A 1I2HA 2BCJA 3LJUX 4GMVA 3FM8C 3G9WA 2AL6A 1P5TA 2DHKA 1FGZA 2ELAA 2H7EA 2J59M 2QKMA 2I1JA 3ODOA 1DDVA 2Z0PA 3AJ4A 1QQGA 1XD4A 1Y19B 2GCLA 5JP4A 1Y5OA 1X05A 1XR0B 3PVUA 1MIZB 1MIXA 1FGYA 5C5BB 2EMSA 1GC6A 4F7GA 5KQ1A 5FI0A 5D3XA 2J0MA 2R0DA 3SV1A 2OQBA 2Y7BA 1V89A 2CODA 1K5GB 3PVLA 3D8DA 2DHIA 4GN1A 5D3YA 3MPXA 2DHJA 4HAWB 5DH9B 2EJ8A 2Y8FA 2DKPA 3DXCA 2N23A 2D9XA 2DFKA 1PLSA 5C5BA 2CRFA 1TJ6A 4B6HA 2IYBA 4F7UP 2LYDA 4KHAA 4C0AA 5J3YA 4KHBB 4HAVB 4WSFA 1KZ7A 3KSYA 3QWMA 2DX1A 1OY2A 2W2XC 3TO1A 4HAYB 1EF1A 3HW2B 1MK9B 3PZDA 1U29A 4D0NB 1Z87A 2D2QA 5LONB 1UNPA 1XX0A 5C16A 2LKOA 2EMTA 2L1CA 3IVFA 2J0JA 2D11A 3T06A 2YS1A 2GS0A 1FHOA 1DROA 2ROZB 1X1FA 3F5RA 3SNHA 2KCJA 2K00A 3ZVRA 3GYPA 3QBVB 1NTYA 2D4QA 1XKEA 2VRWB 2YT0A 1KI1B 4MY6A 3OANA 1J0WA 1H10A 3KRWA 3X23A 2RUKB 4HATB 1SGHA 5HE1A 1E5WA 1U5EA 3HQCA 1AWEA 1DYNA 5DHAB 2MKRA 1M7RA 2YVCA 1P3RA 4GPTB 4DXAB 1I7AA 1EVHA 3FSSA 4HB0B 5L81A 2DN6A 2IFSA 4NY0A 4A6FA 4A5KA 1U2BA 2YT1A 2FJLA 3KZ1A 3BJIA 2V76A 2LOXA 3TVVA 3A98B 1UEFA 4DX8A 4Z2NA 1WVHA 5D3VA 2DLWA 5HE2A 1XODA 2LG1A 4CYEA 1WJ1A 3SUZA 1FB8A 3PEGA 1WGQA 2NMBA 5HE3A 4HB2B 3ODXA 2Z0QA 4ZRKA 1U27A 1FHWA 4K17A 2UZRA 1BTNA 1X11A 1U5GA 1BAKA 3ULBA 1QC6A 2H7DA 5D3WA 2COFA 3SO6A 1FOEA 1GC7A 1UNRA 2MDXA 4K2PA 2LOZA 2D9YA 1DDMA 2P8VA 2PZ1A 1TQZA 1TXDA 3D8FA 3WYFB 1ISNA 3V5WA 4HB3B 2YF0A 1IRSA 2P0DA 1W1HA 2OTXA 4P7IA 5KQ4A 1FAOA 1NI2A 4CHJA 1MKEA 4BBKA 1V5PA 2LULA 3U8ZA 5D27A 1UNQA 2K2JA 2GJYA 2QKLA 2L2IA 5CLQB 1OQNA 2I1KA 4MT7A 2Y8GA 2UZSA 2AEHA 3MDBC 2KGXB 3U7DA 3WA0A 5C6RA 1ZSQA 4F7HA 5KCVA 2I5CA 4H8SA 3SYXA 4Z2MB 5J3QA 5EFXA 3ZDTA 2ZPYA 3AU4A 1LW3A 2R09A 2YS3A 3M1IB 2RGNB 5JLJB 1AQCA 2P0FA 1MK7B 1V61A 4A6KA 4HHVA 4EKUA 1OMWA 5DI9B 1DBHA 3TCAA 1BWNA 3TFMA 3A8PA 4IFSA 2DYNA 4ZRIA 2RLOA 5DHFB 4TKNA 2DYQA 4ZRJA 4Y94A 4HDOA 2RNRB 3PP2A 3F0WA 3FEHA 2E2XA 1BTKA
chains in the Genus database with same CATH superfamily
3ULCA 4WVFB 3N7CA 3D8EA 3NWAA 5I2SA 2RRFA 5GOWB 4DX90 4NSWA 3P6AA 5HE0A 2D9VA 3KY9A 4EJNA 3RCPA 2CY4A 1GG3A 1N3HA 4IOYX 2W2WA 1J19A 5LG4B 2RSGA 1FHXA 1H4RA 1MI1A 1V5MA 1ZVRA 5C79A 2CAYA 2EC1A 3TW1A 2GCJA 1WGUA 5IRSA 1W1DA 2YT2A 2ADZA 5JHHA 3VOQA 4HAUB 2DA0A 2ELBA 4YONA 2M14A 2M38A 2X18A 1WI1A 1V88A 4TYZA 3A8QA 2J0KA 2DKQA 1U5FA 1T77A 2UVMA 2Z13A 2YSZA 4GOUA 1XCGA 2COCA 3DCXA 3B77A 3VIAA 2HE7A 3HK0A 2VKIA 1B55A 4DIXA 4GMXB 4HDQA 1V5UA 3CIKA 4IAPA 3PG7A 1U5DA 1X1GA 2W2XD 3CXBB 2D9WA 3PSCA 3DXEA 2VSZA 2HTHB 1MPHA 4GXBA 2MFQA 4DBBA 3ODWA 2ROVA 2JP2A 4KHOA 3OHMB 3GYOA 2K2UA 4L6EA 1ZC3B 1WJMA 5DIFB 1ZM0A 2XQNM 1PFJA 4CHMA 2G35A 1EGXA 1DDWA 3ML4A 2DTCA 1UPQA 4PQ0A 4QJ4B 1Q67A 4K81A 4WJ7A 4XWXA 1ZC4B 4A6HA 3UZTA 4HAXB 1UPRA 1WG7A 1M7EA 1PMSA 2YRYA 1ZYIA 2MWNB 1RJ2A 1KZGA 2CY5A 4K2OA 1LB1A 4GZUA 4PNKA 5CLLB 2NZ8B 3KRXA 2Z0OA 1X86A 2P0HA 2COAA 1K5DB 3NW8A 1W1GA 2KUPA 2N0YA 1P6SA 5JHGA 2DX5A 4MK0A 2Z14A 4L1RA 3QIJA 2I5FA 3NSUA 4YL8A 3PVWA 3O96A 1SHCA 2Z4DA 4EMOA 2D10A 4HAZB 1RRPB 2RVBB 1NU2A 2D9ZA 5J3TA 1NTVA 4HB4B 4KVGB 3DXDA 1EAZA 4KHBA 3BINA 4GNKB 3P7ZA 4KAXB 2YS5A 4A6FB 1MAIA 5LOPB 3AU5A 5FI1A 2Q13A 4HSIA 1I2HA 2BCJA 2GUMA 3LJUX 4GMVA 3FM8C 3G9WA 2AL6A 1P5TA 2DHKA 1FGZA 2ELAA 2H7EA 2J59M 2QKMA 2I1JA 3ODOA 1DDVA 2Z0PA 3AJ4A 1QQGA 1XD4A 1Y19B 3HSAA 2GCLA 5JP4A 1Y5OA 1X05A 1XR0B 3PVUA 1MIZB 1MIXA 1FGYA 5C5BB 2EMSA 1GC6A 4F7GA 5KQ1A 5FI0A 5D3XA 2J0MA 2R0DA 3SV1A 2OQBA 2Y7BA 3FVCA 1V89A 2CODA 1K5GB 3PVLA 3D8DA 2DHIA 4GN1A 5D3YA 3MPXA 2DHJA 4HAWB 5DH9B 2EJ8A 2Y8FA 2DKPA 3DXCA 2N23A 2D9XA 2DFKA 1PLSA 5C5BA 2CRFA 1TJ6A 4B6HA 2IYBA 4F7UP 2LYDA 4KHAA 4C0AA 5J3YA 2K49A 4KHBB 4HAVB 4WSFA 1KZ7A 3KSYA 3QWMA 2DX1A 1OY2A 2W2XC 3TO1A 4HAYB 1EF1A 3HW2B 1MK9B 3PZDA 1U29A 4D0NB 1Z87A 2D2QA 5LONB 1UNPA 2FJUB 1XX0A 2ZKMX 5C16A 2LKOA 2EMTA 2L1CA 3IVFA 2J0JA 2D11A 3T06A 2YS1A 2KUQA 2GS0A 1FHOA 1DROA 2ROZB 1X1FA 3F5RA 3SNHA 2KCJA 2K00A 3ZVRA 3GYPA 3QBVB 4D6WA 2Z59A 1NTYA 2D4QA 1XKEA 2VRWB 4OT1A 2YT0A 1KI1B 4MY6A 3OANA 1J0WA 1H10A 3KRWA 3X23A 2RUKB 4HATB 4CSQA 1SGHA 5HE1A 1E5WA 1U5EA 3HQCA 1AWEA 3A58A 4QJ3B 1DYNA 5DHAB 2MKRA 1M7RA 2YVCA 2NBVA 1P3RA 4GPTB 4DXAB 1I7AA 1EVHA 3FSSA 4HB0B 5L81A 2DN6A 2IFSA 4NY0A 4A6FA 4A5KA 1U2BA 2YT1A 2FJLA 3KZ1A 3BJIA 2V76A 2LOXA 3TVVA 3A98B 1UEFA 4DX8A 4Z2NA 1WVHA 5D3VA 2DLWA 5HE2A 1XODA 2LG1A 4CYEA 1WJ1A 3SUZA 1FB8A 3PEGA 1WGQA 2NMBA 5HE3A 4QJ5B 4HB2B 3ODXA 2Z0QA 4ZRKA 1U27A 1FHWA 4K17A 2UZRA 1BTNA 1X11A 1U5GA 1BAKA 3ULBA 1QC6A 2H7DA 5D3WA 5I2MA 2COFA 3SO6A 1FOEA 1GC7A 1UNRA 2MDXA 3NWDA 4K2PA 4OSNA 2LOZA 2D9YA 3U12A 2P8VA 1DDMA 2PZ1A 2KIGA 1TQZA 1TXDA 3D8FA 3WYFB 1ISNA 3V5WA 4HB3B 2YF0A 4QXAB 1IRSA 5M4YB 2P0DA 1W1HA 2OTXA 4P7IA 2K8EA 5KQ4A 1FAOA 1NI2A 4CHJA 1MKEA 4BBKA 1V5PA 2LULA 3U8ZA 5D27A 1UNQA 2K2JA 2GJYA 2QKLA 3NWFA 2L2IA 5CLQB 1OQNA 2I1KA 4MT7A 2Y8GA 2UZSA 2AEHA 3MDBC 2KGXB 3U7DA 3WA0A 5C6RA 1ZSQA 4F7HA 5KCVA 2I5CA 4H8SA 3SYXA 4Z2MB 5J3QA 5EFXA 3ZDTA 2ZPYA 3AU4A 1LW3A 2R09A 2YS3A 3M1IB 2RGNB 2KIEA 5JLJB 1AQCA 2P0FA 1MK7B 1V61A 4A6KA 4HHVA 4EKUA 1OMWA 5DI9B 1DBHA 3TCAA 1BWNA 3TFMA 3A8PA 4IFSA 2R2YA 2DYNA 4ZRIA 2RLOA 5DHFB 4TKNA 2DYQA 3HIEA 4ZRJA 4Y94A 4HDOA 2RNRB 2KR0A 3PP2A 3F0WA 3FEHA 2E2XA 1BTKA
chains in the Genus database with same CATH topology
3ULCA 4WVFB 3N7CA 3D8EA 5GOWB 4DX90 4NSWA 3P6AA 5HE0A 2D9VA 3KY9A 4EJNA 3RCPA 2CY4A 1GG3A 1N3HA 4IOYX 2W2WA 1J19A 2RSGA 1FHXA 1H4RA 1V5MA 1ZVRA 5C79A 2CAYA 2EC1A 3TW1A 2GCJA 1WGUA 1W1DA 2ADZA 5JHHA 3VOQA 4HAUB 2DA0A 2ELBA 4YONA 2M14A 2M38A 2X18A 1WI1A 1V88A 4TYZA 3A8QA 2J0KA 2DKQA 1U5FA 2UVMA 2YSZA 1XCGA 2COCA 3VIAA 2HE7A 3HK0A 2VKIA 1B55A 4GMXB 4HDQA 1V5UA 3CIKA 4IAPA 3PG7A 1U5DA 1X1GA 2W2XD 3CXBB 2D9WA 3PSCA 3DXEA 2VSZA 2HTHB 1MPHA 4GXBA 2MFQA 4DBBA 3ODWA 2ROVA 2JP2A 4KHOA 3GYOA 2K2UA 4L6EA 1ZC3B 1WJMA 5DIFB 1ZM0A 2XQNM 1PFJA 4CHMA 2G35A 1EGXA 1DDWA 3ML4A 2DTCA 1UPQA 4PQ0A 1Q67A 4K81A 4WJ7A 4XWXA 1ZC4B 4A6HA 3UZTA 4HAXB 1UPRA 1WG7A 1M7EA 1PMSA 2YRYA 2MWNB 1RJ2A 1KZGA 2CY5A 4K2OA 1LB1A 4GZUA 4PNKA 5CLLB 2NZ8B 3KRXA 2Z0OA 1X86A 2P0HA 2COAA 1K5DB 1W1GA 2KUPA 2N0YA 1P6SA 5JHGA 2DX5A 4MK0A 3QIJA 2I5FA 3NSUA 4YL8A 3PVWA 3O96A 1SHCA 4EMOA 2D10A 4HAZB 1RRPB 2RVBB 1NU2A 2D9ZA 5J3TA 1NTVA 4HB4B 4KVGB 3DXDA 1EAZA 3BINA 4KAXB 3P7ZA 2YS5A 4A6FB 1MAIA 5LOPB 3AU5A 5FI1A 2Q13A 1I2HA 2BCJA 3LJUX 4GMVA 3FM8C 3G9WA 2AL6A 1P5TA 2DHKA 1FGZA 2ELAA 2H7EA 2J59M 2QKMA 2I1JA 3ODOA 1DDVA 2Z0PA 3AJ4A 1QQGA 1XD4A 1Y19B 2GCLA 5JP4A 1Y5OA 1X05A 1XR0B 3PVUA 1MIZB 1MIXA 1FGYA 5C5BB 2EMSA 1GC6A 4F7GA 5KQ1A 5FI0A 5D3XA 2J0MA 2R0DA 3SV1A 2OQBA 2Y7BA 1V89A 2CODA 1K5GB 3PVLA 3D8DA 2DHIA 4GN1A 5D3YA 3MPXA 2DHJA 4HAWB 5DH9B 2EJ8A 2Y8FA 2DKPA 3DXCA 2N23A 2D9XA 2DFKA 1PLSA 5C5BA 2CRFA 1TJ6A 4B6HA 2IYBA 4F7UP 2LYDA 4KHAA 4C0AA 5J3YA 4KHBB 4HAVB 4WSFA 1KZ7A 3KSYA 3QWMA 2DX1A 1OY2A 2W2XC 3TO1A 4HAYB 1EF1A 3HW2B 1MK9B 3PZDA 1U29A 4D0NB 1Z87A 2D2QA 5LONB 1UNPA 1XX0A 5C16A 2LKOA 2EMTA 2L1CA 3IVFA 2J0JA 2D11A 3T06A 2YS1A 2GS0A 1FHOA 1DROA 2ROZB 1X1FA 3F5RA 3SNHA 2KCJA 2K00A 3ZVRA 3GYPA 3QBVB 1NTYA 2D4QA 1XKEA 2VRWB 2YT0A 1KI1B 4MY6A 3OANA 1J0WA 1H10A 3KRWA 3X23A 2RUKB 4HATB 1SGHA 5HE1A 1E5WA 1U5EA 3HQCA 1AWEA 1DYNA 5DHAB 2MKRA 1M7RA 2YVCA 1P3RA 4GPTB 4DXAB 1I7AA 1EVHA 3FSSA 4HB0B 5L81A 2DN6A 2IFSA 4NY0A 4A6FA 4A5KA 1U2BA 2YT1A 2FJLA 3KZ1A 3BJIA 2V76A 2LOXA 3TVVA 3A98B 1UEFA 4DX8A 4Z2NA 1WVHA 5D3VA 2DLWA 5HE2A 1XODA 2LG1A 4CYEA 1WJ1A 3SUZA 1FB8A 3PEGA 1WGQA 2NMBA 5HE3A 4HB2B 3ODXA 2Z0QA 4ZRKA 1U27A 1FHWA 4K17A 2UZRA 1BTNA 1X11A 1U5GA 1BAKA 3ULBA 1QC6A 2H7DA 5D3WA 2COFA 3SO6A 1FOEA 1GC7A 1UNRA 2MDXA 4K2PA 2LOZA 2D9YA 1DDMA 2P8VA 2PZ1A 1TQZA 1TXDA 3D8FA 3WYFB 1ISNA 3V5WA 4HB3B 2YF0A 1IRSA 2P0DA 1W1HA 2OTXA 4P7IA 5KQ4A 1FAOA 1NI2A 4CHJA 1MKEA 4BBKA 1V5PA 2LULA 3U8ZA 5D27A 1UNQA 2K2JA 2GJYA 2QKLA 2L2IA 5CLQB 1OQNA 2I1KA 4MT7A 2Y8GA 2UZSA 2AEHA 3MDBC 2KGXB 3U7DA 3WA0A 5C6RA 1ZSQA 4F7HA 5KCVA 2I5CA 4H8SA 3SYXA 4Z2MB 5J3QA 5EFXA 3ZDTA 2ZPYA 3AU4A 1LW3A 2R09A 2YS3A 3M1IB 2RGNB 5JLJB 1AQCA 2P0FA 1MK7B 1V61A 4A6KA 4HHVA 4EKUA 1OMWA 5DI9B 1DBHA 3TCAA 1BWNA 3TFMA 3A8PA 4IFSA 2DYNA 4ZRIA 2RLOA 5DHFB 4TKNA 2DYQA 4ZRJA 4Y94A 4HDOA 2RNRB 3PP2A 3F0WA 3FEHA 2E2XA 1BTKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ULC A;  4WVF B;  3N7C A;  3D8E A;  5GOW B;  4DX9 0;  4NSW A;  3P6A A;  5HE0 A;  2D9V A;  3KY9 A;  4EJN A;  3RCP A;  2CY4 A;  1GG3 A;  1N3H A;  4IOY X;  2W2W A;  1J19 A;  2RSG A;  1FHX A;  1H4R A;  1V5M A;  1ZVR A;  5C79 A;  2CAY A;  2EC1 A;  3TW1 A;  2GCJ A;  1WGU A;  1W1D A;  2ADZ A;  5JHH A;  3VOQ A;  4HAU B;  2DA0 A;  2ELB A;  4YON A;  2M14 A;  2M38 A;  2X18 A;  1WI1 A;  1V88 A;  4TYZ A;  3A8Q A;  2J0K A;  2DKQ A;  1U5F A;  2UVM A;  2YSZ A;  1XCG A;  2COC A;  3VIA A;  2HE7 A;  3HK0 A;  2VKI A;  1B55 A;  4GMX B;  4HDQ A;  1V5U A;  3CIK A;  4IAP A;  3PG7 A;  1U5D A;  1X1G A;  2W2X D;  3CXB B;  2D9W A;  3PSC A;  3DXE A;  2VSZ A;  2HTH B;  1MPH A;  4GXB A;  2MFQ A;  4DBB A;  3ODW A;  2ROV A;  2JP2 A;  4KHO A;  3GYO A;  2K2U A;  4L6E A;  1ZC3 B;  1WJM A;  5DIF B;  1ZM0 A;  2XQN M;  1PFJ A;  4CHM A;  2G35 A;  1EGX A;  1DDW A;  3ML4 A;  2DTC A;  1UPQ A;  4PQ0 A;  1Q67 A;  4K81 A;  4WJ7 A;  4XWX A;  1ZC4 B;  4A6H A;  3UZT A;  4HAX B;  1UPR A;  1WG7 A;  1M7E A;  1PMS A;  2YRY A;  2MWN B;  1RJ2 A;  1KZG A;  2CY5 A;  4K2O A;  1LB1 A;  4GZU A;  4PNK A;  5CLL B;  2NZ8 B;  3KRX A;  2Z0O A;  1X86 A;  2P0H A;  2COA A;  1K5D B;  1W1G A;  2KUP A;  2N0Y A;  1P6S A;  5JHG A;  2DX5 A;  4MK0 A;  3QIJ A;  2I5F A;  3NSU A;  4YL8 A;  3PVW A;  3O96 A;  1SHC A;  4EMO A;  2D10 A;  4HAZ B;  1RRP B;  2RVB B;  1NU2 A;  2D9Z A;  5J3T A;  1NTV A;  4HB4 B;  4KVG B;  3DXD A;  1EAZ A;  3BIN A;  4KAX B;  3P7Z A;  2YS5 A;  4A6F B;  1MAI A;  5LOP B;  3AU5 A;  5FI1 A;  2Q13 A;  1I2H A;  2BCJ A;  3LJU X;  4GMV A;  3FM8 C;  3G9W A;  2AL6 A;  1P5T A;  2DHK A;  1FGZ A;  2ELA A;  2H7E A;  2J59 M;  2QKM A;  2I1J A;  3ODO A;  1DDV A;  2Z0P A;  3AJ4 A;  1QQG A;  1XD4 A;  1Y19 B;  2GCL A;  5JP4 A;  1Y5O A;  1X05 A;  1XR0 B;  3PVU A;  1MIZ B;  1MIX A;  1FGY A;  5C5B B;  2EMS A;  1GC6 A;  4F7G A;  5KQ1 A;  5FI0 A;  5D3X A;  2J0M A;  2R0D A;  3SV1 A;  2OQB A;  2Y7B A;  1V89 A;  2COD A;  1K5G B;  3PVL A;  3D8D A;  2DHI A;  4GN1 A;  5D3Y A;  3MPX A;  2DHJ A;  4HAW B;  5DH9 B;  2EJ8 A;  2Y8F A;  2DKP A;  3DXC A;  2N23 A;  2D9X A;  2DFK A;  1PLS A;  5C5B A;  2CRF A;  1TJ6 A;  4B6H A;  2IYB A;  4F7U P;  2LYD A;  4KHA A;  4C0A A;  5J3Y A;  4KHB B;  4HAV B;  4WSF A;  1KZ7 A;  3KSY A;  3QWM A;  2DX1 A;  1OY2 A;  2W2X C;  3TO1 A;  4HAY B;  1EF1 A;  3HW2 B;  1MK9 B;  3PZD A;  1U29 A;  4D0N B;  1Z87 A;  2D2Q A;  5LON B;  1UNP A;  1XX0 A;  5C16 A;  2LKO A;  2EMT A;  2L1C A;  3IVF A;  2J0J A;  2D11 A;  3T06 A;  2YS1 A;  2GS0 A;  1FHO A;  1DRO A;  2ROZ B;  1X1F A;  3F5R A;  3SNH A;  2KCJ A;  2K00 A;  3ZVR A;  3GYP A;  3QBV B;  1NTY A;  2D4Q A;  1XKE A;  2VRW B;  2YT0 A;  1KI1 B;  4MY6 A;  3OAN A;  1J0W A;  1H10 A;  3KRW A;  3X23 A;  2RUK B;  4HAT B;  1SGH A;  5HE1 A;  1E5W A;  1U5E A;  3HQC A;  1AWE A;  1DYN A;  5DHA B;  2MKR A;  1M7R A;  2YVC A;  1P3R A;  4GPT B;  4DXA B;  1I7A A;  1EVH A;  3FSS A;  4HB0 B;  5L81 A;  2DN6 A;  2IFS A;  4NY0 A;  4A6F A;  4A5K A;  1U2B A;  2YT1 A;  2FJL A;  3KZ1 A;  3BJI A;  2V76 A;  2LOX A;  3TVV A;  3A98 B;  1UEF A;  4DX8 A;  4Z2N A;  1WVH A;  5D3V A;  2DLW A;  5HE2 A;  1XOD A;  2LG1 A;  4CYE A;  1WJ1 A;  3SUZ A;  1FB8 A;  3PEG A;  1WGQ A;  2NMB A;  5HE3 A;  4HB2 B;  3ODX A;  2Z0Q A;  4ZRK A;  1U27 A;  1FHW A;  4K17 A;  2UZR A;  1BTN A;  1X11 A;  1U5G A;  1BAK A;  3ULB A;  1QC6 A;  2H7D A;  5D3W A;  2COF A;  3SO6 A;  1FOE A;  1GC7 A;  1UNR A;  2MDX A;  4K2P A;  2LOZ A;  2D9Y A;  1DDM A;  2P8V A;  2PZ1 A;  1TQZ A;  1TXD A;  3D8F A;  3WYF B;  1ISN A;  3V5W A;  4HB3 B;  2YF0 A;  1IRS A;  2P0D A;  1W1H A;  2OTX A;  4P7I A;  5KQ4 A;  1FAO A;  1NI2 A;  4CHJ A;  1MKE A;  4BBK A;  1V5P A;  2LUL A;  3U8Z A;  5D27 A;  1UNQ A;  2K2J A;  2GJY A;  2QKL A;  2L2I A;  5CLQ B;  1OQN A;  2I1K A;  4MT7 A;  2Y8G A;  2UZS A;  2AEH A;  3MDB C;  2KGX B;  3U7D A;  3WA0 A;  5C6R A;  1ZSQ A;  4F7H A;  5KCV A;  2I5C A;  4H8S A;  3SYX A;  4Z2M B;  5J3Q A;  5EFX A;  3ZDT A;  2ZPY A;  3AU4 A;  1LW3 A;  2R09 A;  2YS3 A;  3M1I B;  2RGN B;  5JLJ B;  1AQC A;  2P0F A;  1MK7 B;  1V61 A;  4A6K A;  4HHV A;  4EKU A;  1OMW A;  5DI9 B;  1DBH A;  3TCA A;  1BWN A;  3TFM A;  3A8P A;  4IFS A;  2DYN A;  4ZRI A;  2RLO A;  5DHF B;  4TKN A;  2DYQ A;  4ZRJ A;  4Y94 A;  4HDO A;  2RNR B;  3PP2 A;  3F0W A;  3FEH A;  2E2X A;  1BTK A; 
#chains in the Genus database with same CATH topology
 3ULC A;  4WVF B;  3N7C A;  3D8E A;  3NWA A;  5I2S A;  2RRF A;  5GOW B;  4DX9 0;  4NSW A;  3P6A A;  5HE0 A;  2D9V A;  3KY9 A;  4EJN A;  3RCP A;  2CY4 A;  1GG3 A;  1N3H A;  4IOY X;  2W2W A;  1J19 A;  5LG4 B;  2RSG A;  1FHX A;  1H4R A;  1MI1 A;  1V5M A;  1ZVR A;  5C79 A;  2CAY A;  2EC1 A;  3TW1 A;  2GCJ A;  1WGU A;  5IRS A;  1W1D A;  2YT2 A;  2ADZ A;  5JHH A;  3VOQ A;  4HAU B;  2DA0 A;  2ELB A;  4YON A;  2M14 A;  2M38 A;  2X18 A;  1WI1 A;  1V88 A;  4TYZ A;  3A8Q A;  2J0K A;  2DKQ A;  1U5F A;  1T77 A;  2UVM A;  2Z13 A;  2YSZ A;  4GOU A;  1XCG A;  2COC A;  3DCX A;  3B77 A;  3VIA A;  2HE7 A;  3HK0 A;  2VKI A;  1B55 A;  4DIX A;  4GMX B;  4HDQ A;  1V5U A;  3CIK A;  4IAP A;  3PG7 A;  1U5D A;  1X1G A;  2W2X D;  3CXB B;  2D9W A;  3PSC A;  3DXE A;  2VSZ A;  2HTH B;  1MPH A;  4GXB A;  2MFQ A;  4DBB A;  3ODW A;  2ROV A;  2JP2 A;  4KHO A;  3OHM B;  3GYO A;  2K2U A;  4L6E A;  1ZC3 B;  1WJM A;  5DIF B;  1ZM0 A;  2XQN M;  1PFJ A;  4CHM A;  2G35 A;  1EGX A;  1DDW A;  3ML4 A;  2DTC A;  1UPQ A;  4PQ0 A;  4QJ4 B;  1Q67 A;  4K81 A;  4WJ7 A;  4XWX A;  1ZC4 B;  4A6H A;  3UZT A;  4HAX B;  1UPR A;  1WG7 A;  1M7E A;  1PMS A;  2YRY A;  1ZYI A;  2MWN B;  1RJ2 A;  1KZG A;  2CY5 A;  4K2O A;  1LB1 A;  4GZU A;  4PNK A;  5CLL B;  2NZ8 B;  3KRX A;  2Z0O A;  1X86 A;  2P0H A;  2COA A;  1K5D B;  3NW8 A;  1W1G A;  2KUP A;  2N0Y A;  1P6S A;  5JHG A;  2DX5 A;  4MK0 A;  2Z14 A;  4L1R A;  3QIJ A;  2I5F A;  3NSU A;  4YL8 A;  3PVW A;  3O96 A;  1SHC A;  2Z4D A;  4EMO A;  2D10 A;  4HAZ B;  1RRP B;  2RVB B;  1NU2 A;  2D9Z A;  5J3T A;  1NTV A;  4HB4 B;  4KVG B;  3DXD A;  1EAZ A;  4KHB A;  3BIN A;  4GNK B;  3P7Z A;  4KAX B;  2YS5 A;  4A6F B;  1MAI A;  5LOP B;  3AU5 A;  5FI1 A;  2Q13 A;  4HSI A;  1I2H A;  2BCJ A;  2GUM A;  3LJU X;  4GMV A;  3FM8 C;  3G9W A;  2AL6 A;  1P5T A;  2DHK A;  1FGZ A;  2ELA A;  2H7E A;  2J59 M;  2QKM A;  2I1J A;  3ODO A;  1DDV A;  2Z0P A;  3AJ4 A;  1QQG A;  1XD4 A;  1Y19 B;  3HSA A;  2GCL A;  5JP4 A;  1Y5O A;  1X05 A;  1XR0 B;  3PVU A;  1MIZ B;  1MIX A;  1FGY A;  5C5B B;  2EMS A;  1GC6 A;  4F7G A;  5KQ1 A;  5FI0 A;  5D3X A;  2J0M A;  2R0D A;  3SV1 A;  2OQB A;  2Y7B A;  3FVC A;  1V89 A;  2COD A;  1K5G B;  3PVL A;  3D8D A;  2DHI A;  4GN1 A;  5D3Y A;  3MPX A;  2DHJ A;  4HAW B;  5DH9 B;  2EJ8 A;  2Y8F A;  2DKP A;  3DXC A;  2N23 A;  2D9X A;  2DFK A;  1PLS A;  5C5B A;  2CRF A;  1TJ6 A;  4B6H A;  2IYB A;  4F7U P;  2LYD A;  4KHA A;  4C0A A;  5J3Y A;  2K49 A;  4KHB B;  4HAV B;  4WSF A;  1KZ7 A;  3KSY A;  3QWM A;  2DX1 A;  1OY2 A;  2W2X C;  3TO1 A;  4HAY B;  1EF1 A;  3HW2 B;  1MK9 B;  3PZD A;  1U29 A;  4D0N B;  1Z87 A;  2D2Q A;  5LON B;  1UNP A;  2FJU B;  1XX0 A;  2ZKM X;  5C16 A;  2LKO A;  2EMT A;  2L1C A;  3IVF A;  2J0J A;  2D11 A;  3T06 A;  2YS1 A;  2KUQ A;  2GS0 A;  1FHO A;  1DRO A;  2ROZ B;  1X1F A;  3F5R A;  3SNH A;  2KCJ A;  2K00 A;  3ZVR A;  3GYP A;  3QBV B;  4D6W A;  2Z59 A;  1NTY A;  2D4Q A;  1XKE A;  2VRW B;  4OT1 A;  2YT0 A;  1KI1 B;  4MY6 A;  3OAN A;  1J0W A;  1H10 A;  3KRW A;  3X23 A;  2RUK B;  4HAT B;  4CSQ A;  1SGH A;  5HE1 A;  1E5W A;  1U5E A;  3HQC A;  1AWE A;  3A58 A;  4QJ3 B;  1DYN A;  5DHA B;  2MKR A;  1M7R A;  2YVC A;  2NBV A;  1P3R A;  4GPT B;  4DXA B;  1I7A A;  1EVH A;  3FSS A;  4HB0 B;  5L81 A;  2DN6 A;  2IFS A;  4NY0 A;  4A6F A;  4A5K A;  1U2B A;  2YT1 A;  2FJL A;  3KZ1 A;  3BJI A;  2V76 A;  2LOX A;  3TVV A;  3A98 B;  1UEF A;  4DX8 A;  4Z2N A;  1WVH A;  5D3V A;  2DLW A;  5HE2 A;  1XOD A;  2LG1 A;  4CYE A;  1WJ1 A;  3SUZ A;  1FB8 A;  3PEG A;  1WGQ A;  2NMB A;  5HE3 A;  4QJ5 B;  4HB2 B;  3ODX A;  2Z0Q A;  4ZRK A;  1U27 A;  1FHW A;  4K17 A;  2UZR A;  1BTN A;  1X11 A;  1U5G A;  1BAK A;  3ULB A;  1QC6 A;  2H7D A;  5D3W A;  5I2M A;  2COF A;  3SO6 A;  1FOE A;  1GC7 A;  1UNR A;  2MDX A;  3NWD A;  4K2P A;  4OSN A;  2LOZ A;  2D9Y A;  3U12 A;  2P8V A;  1DDM A;  2PZ1 A;  2KIG A;  1TQZ A;  1TXD A;  3D8F A;  3WYF B;  1ISN A;  3V5W A;  4HB3 B;  2YF0 A;  4QXA B;  1IRS A;  5M4Y B;  2P0D A;  1W1H A;  2OTX A;  4P7I A;  2K8E A;  5KQ4 A;  1FAO A;  1NI2 A;  4CHJ A;  1MKE A;  4BBK A;  1V5P A;  2LUL A;  3U8Z A;  5D27 A;  1UNQ A;  2K2J A;  2GJY A;  2QKL A;  3NWF A;  2L2I A;  5CLQ B;  1OQN A;  2I1K A;  4MT7 A;  2Y8G A;  2UZS A;  2AEH A;  3MDB C;  2KGX B;  3U7D A;  3WA0 A;  5C6R A;  1ZSQ A;  4F7H A;  5KCV A;  2I5C A;  4H8S A;  3SYX A;  4Z2M B;  5J3Q A;  5EFX A;  3ZDT A;  2ZPY A;  3AU4 A;  1LW3 A;  2R09 A;  2YS3 A;  3M1I B;  2RGN B;  2KIE A;  5JLJ B;  1AQC A;  2P0F A;  1MK7 B;  1V61 A;  4A6K A;  4HHV A;  4EKU A;  1OMW A;  5DI9 B;  1DBH A;  3TCA A;  1BWN A;  3TFM A;  3A8P A;  4IFS A;  2R2Y A;  2DYN A;  4ZRI A;  2RLO A;  5DHF B;  4TKN A;  2DYQ A;  3HIE A;  4ZRJ A;  4Y94 A;  4HDO A;  2RNR B;  2KR0 A;  3PP2 A;  3F0W A;  3FEH A;  2E2X A;  1BTK A; 
#chains in the Genus database with same CATH homology
 3ULC A;  4WVF B;  3N7C A;  3D8E A;  5GOW B;  4DX9 0;  4NSW A;  3P6A A;  5HE0 A;  2D9V A;  3KY9 A;  4EJN A;  3RCP A;  2CY4 A;  1GG3 A;  1N3H A;  4IOY X;  2W2W A;  1J19 A;  2RSG A;  1FHX A;  1H4R A;  1V5M A;  1ZVR A;  5C79 A;  2CAY A;  2EC1 A;  3TW1 A;  2GCJ A;  1WGU A;  1W1D A;  2ADZ A;  5JHH A;  3VOQ A;  4HAU B;  2DA0 A;  2ELB A;  4YON A;  2M14 A;  2M38 A;  2X18 A;  1WI1 A;  1V88 A;  4TYZ A;  3A8Q A;  2J0K A;  2DKQ A;  1U5F A;  2UVM A;  2YSZ A;  1XCG A;  2COC A;  3VIA A;  2HE7 A;  3HK0 A;  2VKI A;  1B55 A;  4GMX B;  4HDQ A;  1V5U A;  3CIK A;  4IAP A;  3PG7 A;  1U5D A;  1X1G A;  2W2X D;  3CXB B;  2D9W A;  3PSC A;  3DXE A;  2VSZ A;  2HTH B;  1MPH A;  4GXB A;  2MFQ A;  4DBB A;  3ODW A;  2ROV A;  2JP2 A;  4KHO A;  3GYO A;  2K2U A;  4L6E A;  1ZC3 B;  1WJM A;  5DIF B;  1ZM0 A;  2XQN M;  1PFJ A;  4CHM A;  2G35 A;  1EGX A;  1DDW A;  3ML4 A;  2DTC A;  1UPQ A;  4PQ0 A;  1Q67 A;  4K81 A;  4WJ7 A;  4XWX A;  1ZC4 B;  4A6H A;  3UZT A;  4HAX B;  1UPR A;  1WG7 A;  1M7E A;  1PMS A;  2YRY A;  2MWN B;  1RJ2 A;  1KZG A;  2CY5 A;  4K2O A;  1LB1 A;  4GZU A;  4PNK A;  5CLL B;  2NZ8 B;  3KRX A;  2Z0O A;  1X86 A;  2P0H A;  2COA A;  1K5D B;  1W1G A;  2KUP A;  2N0Y A;  1P6S A;  5JHG A;  2DX5 A;  4MK0 A;  3QIJ A;  2I5F A;  3NSU A;  4YL8 A;  3PVW A;  3O96 A;  1SHC A;  4EMO A;  2D10 A;  4HAZ B;  1RRP B;  2RVB B;  1NU2 A;  2D9Z A;  5J3T A;  1NTV A;  4HB4 B;  4KVG B;  3DXD A;  1EAZ A;  3BIN A;  4KAX B;  3P7Z A;  2YS5 A;  4A6F B;  1MAI A;  5LOP B;  3AU5 A;  5FI1 A;  2Q13 A;  1I2H A;  2BCJ A;  3LJU X;  4GMV A;  3FM8 C;  3G9W A;  2AL6 A;  1P5T A;  2DHK A;  1FGZ A;  2ELA A;  2H7E A;  2J59 M;  2QKM A;  2I1J A;  3ODO A;  1DDV A;  2Z0P A;  3AJ4 A;  1QQG A;  1XD4 A;  1Y19 B;  2GCL A;  5JP4 A;  1Y5O A;  1X05 A;  1XR0 B;  3PVU A;  1MIZ B;  1MIX A;  1FGY A;  5C5B B;  2EMS A;  1GC6 A;  4F7G A;  5KQ1 A;  5FI0 A;  5D3X A;  2J0M A;  2R0D A;  3SV1 A;  2OQB A;  2Y7B A;  1V89 A;  2COD A;  1K5G B;  3PVL A;  3D8D A;  2DHI A;  4GN1 A;  5D3Y A;  3MPX A;  2DHJ A;  4HAW B;  5DH9 B;  2EJ8 A;  2Y8F A;  2DKP A;  3DXC A;  2N23 A;  2D9X A;  2DFK A;  1PLS A;  5C5B A;  2CRF A;  1TJ6 A;  4B6H A;  2IYB A;  4F7U P;  2LYD A;  4KHA A;  4C0A A;  5J3Y A;  4KHB B;  4HAV B;  4WSF A;  1KZ7 A;  3KSY A;  3QWM A;  2DX1 A;  1OY2 A;  2W2X C;  3TO1 A;  4HAY B;  1EF1 A;  3HW2 B;  1MK9 B;  3PZD A;  1U29 A;  4D0N B;  1Z87 A;  2D2Q A;  5LON B;  1UNP A;  1XX0 A;  5C16 A;  2LKO A;  2EMT A;  2L1C A;  3IVF A;  2J0J A;  2D11 A;  3T06 A;  2YS1 A;  2GS0 A;  1FHO A;  1DRO A;  2ROZ B;  1X1F A;  3F5R A;  3SNH A;  2KCJ A;  2K00 A;  3ZVR A;  3GYP A;  3QBV B;  1NTY A;  2D4Q A;  1XKE A;  2VRW B;  2YT0 A;  1KI1 B;  4MY6 A;  3OAN A;  1J0W A;  1H10 A;  3KRW A;  3X23 A;  2RUK B;  4HAT B;  1SGH A;  5HE1 A;  1E5W A;  1U5E A;  3HQC A;  1AWE A;  1DYN A;  5DHA B;  2MKR A;  1M7R A;  2YVC A;  1P3R A;  4GPT B;  4DXA B;  1I7A A;  1EVH A;  3FSS A;  4HB0 B;  5L81 A;  2DN6 A;  2IFS A;  4NY0 A;  4A6F A;  4A5K A;  1U2B A;  2YT1 A;  2FJL A;  3KZ1 A;  3BJI A;  2V76 A;  2LOX A;  3TVV A;  3A98 B;  1UEF A;  4DX8 A;  4Z2N A;  1WVH A;  5D3V A;  2DLW A;  5HE2 A;  1XOD A;  2LG1 A;  4CYE A;  1WJ1 A;  3SUZ A;  1FB8 A;  3PEG A;  1WGQ A;  2NMB A;  5HE3 A;  4HB2 B;  3ODX A;  2Z0Q A;  4ZRK A;  1U27 A;  1FHW A;  4K17 A;  2UZR A;  1BTN A;  1X11 A;  1U5G A;  1BAK A;  3ULB A;  1QC6 A;  2H7D A;  5D3W A;  2COF A;  3SO6 A;  1FOE A;  1GC7 A;  1UNR A;  2MDX A;  4K2P A;  2LOZ A;  2D9Y A;  1DDM A;  2P8V A;  2PZ1 A;  1TQZ A;  1TXD A;  3D8F A;  3WYF B;  1ISN A;  3V5W A;  4HB3 B;  2YF0 A;  1IRS A;  2P0D A;  1W1H A;  2OTX A;  4P7I A;  5KQ4 A;  1FAO A;  1NI2 A;  4CHJ A;  1MKE A;  4BBK A;  1V5P A;  2LUL A;  3U8Z A;  5D27 A;  1UNQ A;  2K2J A;  2GJY A;  2QKL A;  2L2I A;  5CLQ B;  1OQN A;  2I1K A;  4MT7 A;  2Y8G A;  2UZS A;  2AEH A;  3MDB C;  2KGX B;  3U7D A;  3WA0 A;  5C6R A;  1ZSQ A;  4F7H A;  5KCV A;  2I5C A;  4H8S A;  3SYX A;  4Z2M B;  5J3Q A;  5EFX A;  3ZDT A;  2ZPY A;  3AU4 A;  1LW3 A;  2R09 A;  2YS3 A;  3M1I B;  2RGN B;  5JLJ B;  1AQC A;  2P0F A;  1MK7 B;  1V61 A;  4A6K A;  4HHV A;  4EKU A;  1OMW A;  5DI9 B;  1DBH A;  3TCA A;  1BWN A;  3TFM A;  3A8P A;  4IFS A;  2DYN A;  4ZRI A;  2RLO A;  5DHF B;  4TKN A;  2DYQ A;  4ZRJ A;  4Y94 A;  4HDO A;  2RNR B;  3PP2 A;  3F0W A;  3FEH A;  2E2X A;  1BTK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...