2CY4A

Crystal structure of phosphotyrosine binding (ptb) domain of epidermal growth factor receptor pathway substrate-8 (eps8) related protein 1 from mus musculus (form-1 crystal)
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
129
structure length
129
Chain Sequence
b'ADVSQYHVNHLVTFCLGEEDGVHTVEDASRKLAVMDSQGRVWAQEMLLRVSPSQVTLLDPVSKEELESYPLDAIVRCDAVMPRGRSRSLLLLVCQEPERAQPDVHFFQGLLLGAELIREDIQGALQNYR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords epidermal growth factor receptor pathway substrate 8-like pr
publication title Crystal structure of phosphotyrosine binding (PTB) domain of epidermal growth factor receptor pathway substrate-8 (EPS8) related protein 1 from Mus musculus (form-1 crystal)
rcsb
source organism Mus musculus
molecule tags Signaling protein
total genus 27
structure length 129
sequence length 129
ec nomenclature
pdb deposition date 2005-07-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08416 PTB Phosphotyrosine-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2cy4A00
1V88A 3D8EA 3HK0A 2COFA 2LOXA 3A8QA 2Y8GA 5FI1A 1NU2A 1U29A 5DH9B 1FGZA 2CY5A 1FHOA 4A6HA 4KVGB 4CHMA 2AEHA 4IAPA 4CYEA 1XR0B 1AQCA 3LJUX 2QKLA 3KSYA 5DIFB 1WJMA 4HAWB 2Z0PA 2R0DA 1MAIA 1WI1A 4ZRKA 2DX1A 3SYXA 1X1FA 3A98B 5J3TA 4NSWA 3U8ZA 2GCJA 3DXDA 4Y94A 1E5WA 5D3VA 1N3HA 2D9YA 5D3YA 1FGYA 2J0JA 2RVBB 3MPXA 3PEGA 1EVHA 4K2PA 2IYBA 4Z2MB 1U5DA 2CAYA 4HB3B 1U5FA 4GMVA 5J3YA 2YT1A 2W2WA 3M1IB 1RRPB 4HAUB 3SUZA 4KAXB 4HB0B 1W1GA 1DROA 3PVLA 3PP2A 1OY2A 2P0HA 1X11A 4BBKA 3DXEA 4HDQA 4DXAB 2Q13A 3GYPA 3HQCA 5D3WA 3QBVB 2YF0A 4GZUA 3U7DA 3HW2B 1RJ2A 2DYNA 4Z2NA 2HE7A 1TQZA 3ZDTA 1KI1B 2ELBA 1V5UA 1MKEA 2MDXA 1QC6A 3SO6A 2DFKA 5EFXA 1NI2A 1XKEA 3GYOA 1Z87A 3FSSA 2QKMA 2FJLA 4A5KA 1LW3A 2K2UA 1Q67A 4GPTB 5C5BA 1KZ7A 1X05A 3P6AA 4K17A 3SV1A 2IFSA 3PZDA 1M7RA 2MKRA 3AU4A 2OTXA 1I7AA 1DBHA 2DN6A 3ML4A 2DHJA 4HHVA 1WGUA 4YONA 4B6HA 4F7HA 2YRYA 3G9WA 2OQBA 3IVFA 4F7GA 2EMSA 1MK7B 1OMWA 2J59M 2P8VA 4HATB 1FB8A 2CRFA 4EJNA 2CY4A 5HE0A 3FEHA 2P0DA 3PSCA 2L2IA 2DHKA 3N7CA 4MK0A 4DX8A 4F7UP 5L81A 5KCVA 2RLOA 4P7IA 4DX90 1BAKA 2LULA 4D0NB 1V61A 2I1KA 2X18A 4EMOA 2YVCA 5JLJB 2DKQA 4GMXB 1DYNA 3QWMA 1XX0A 1M7EA 4WJ7A 3PVUA 4EKUA 4KHBB 2P0FA 3TFMA 3ULBA 3VOQA 2BCJA 2Z0OA 4K81A 5KQ1A 2MWNB 4CHJA 4DBBA 2GS0A 5D3XA 2W2XC 2VRWB 4HB4B 1BTNA 5CLQB 1MK9B 3UZTA 1NTVA 5DHAB 2AL6A 1ZC3B 2ADZA 2EMTA 4K2OA 2D4QA 2DA0A 1U5EA 1XD4A 1Y19B 4MY6A 3O96A 3PVWA 3AJ4A 2UVMA 4PQ0A 2DX5A 2D9WA 2D10A 5DI9B 4A6FB 2D9VA 3ODOA 2EJ8A 4KHAA 5D27A 2YS1A 1UPRA 2DYQA 1QQGA 3FM8C 1PMSA 1AWEA 3ULCA 1K5DB 3BJIA 3TO1A 3NSUA 1FHXA 3AU5A 3F5RA 2ROZB 3ZVRA 2L1CA 1GG3A 5C6RA 1PFJA 5DHFB 1H10A 1EF1A 1FOEA 3TCAA 1TJ6A 2ELAA 1MPHA 2GJYA 3VIAA 1DDWA 3D8DA 4TKNA 2RNRB 4YL8A 3ODXA 1XCGA 1U5GA 2MFQA 1H4RA 4HAVB 2G35A 3D8FA 2JP2A 4WSFA 3V5WA 5FI0A 3SNHA 1P5TA 2YT0A 2UZSA 2EC1A 2UZRA 3WA0A 5LONB 2D9XA 1ZM0A 4XWXA 1ZSQA 1WVHA 3F0WA 1J0WA 2ZPYA 1UNPA 4GN1A 2K2JA 5GOWB 2I5FA 1PLSA 5C79A 1LB1A 3CIKA 1EGXA 3P7ZA 1W1HA 2J0MA 2NMBA 2YS3A 2RGNB 2VSZA 3X23A 4HAZB 1FHWA 1ZVRA 2Y7BA 2YS5A 2J0KA 2R09A 1GC7A 2NZ8B 1X1GA 1UPQA 5C16A 5CLLB 3TW1A 1WJ1A 2N0YA 2N23A 1MIXA 2D11A 1EAZA 1BWNA 2H7EA 3T06A 1KZGA 2XQNM 2HTHB 2M38A 2DTCA 1P3RA 2KCJA 1U2BA 3A8PA 4L6EA 2RUKB 2LYDA 4GXBA 2D9ZA 5JP4A 2KUPA 1U27A 1UNRA 3TVVA 2H7DA 1OQNA 4HB2B 1MIZB 2CODA 2E2XA 1DDVA 3CXBB 3PG7A 2RSGA 4HAYB 1ZC4B 2KGXB 4MT7A 3DXCA 5HE3A 4IOYX 1XODA 2GCLA 4KHOA 2V76A 5JHGA 1SGHA 1UEFA 1V89A 2LG1A 5C5BB 2COCA 2DLWA 4NY0A 3QIJA 4HAXB 4ZRJA 2D2QA 1I2HA 5J3QA 2PZ1A 2W2XD 1WG7A 4TYZA 1W1DA 3BINA 4IFSA 5HE1A 1GC6A 1WGQA 4A6KA 4C0AA 3MDBC 1V5PA 2LKOA 1B55A 1NTYA 1J19A 1UNQA 3KRXA 3KZ1A 3KRWA 2COAA 2Y8FA 2I5CA 5KQ4A 1K5GB 1DDMA 2K00A 1IRSA 5HE2A 1BTKA 1ISNA 3RCPA 2LOZA 3WYFB 4PNKA 1X86A 1TXDA 2DHIA 3KY9A 2ROVA 1FAOA 4H8SA 2VKIA 2M14A 4HDOA 1Y5OA 3ODWA 3OANA 4ZRIA 4WVFB 1P6SA 5JHHA 2Z0QA 4A6FA 2YSZA 5LOPB 2I1JA 1V5MA 2DKPA 1SHCA
chains in the Genus database with same CATH superfamily
1V88A 3D8EA 4CSQA 1T77A 3HK0A 4QJ4B 2COFA 2LOXA 3A8QA 2Y8GA 5FI1A 3HSAA 1NU2A 1U29A 5DH9B 1FGZA 2CY5A 1FHOA 4A6HA 4KVGB 4CHMA 2AEHA 4IAPA 2Z59A 4CYEA 1XR0B 1AQCA 3LJUX 2QKLA 3KSYA 5DIFB 1WJMA 4HAWB 2K49A 2Z0PA 2R2YA 2R0DA 1MAIA 1WI1A 4QJ5B 4ZRKA 2DX1A 3SYXA 1X1FA 3A98B 5J3TA 4NSWA 3U8ZA 2GCJA 3DXDA 4Y94A 1E5WA 5D3VA 1N3HA 2D9YA 5D3YA 1FGYA 2J0JA 2RVBB 3MPXA 3PEGA 1EVHA 4K2PA 2IYBA 4Z2MB 1U5DA 4DIXA 2CAYA 4HB3B 1U5FA 4GMVA 5J3YA 2YT1A 2W2WA 3M1IB 3NWFA 1RRPB 4HAUB 3SUZA 4KAXB 4HB0B 1W1GA 1DROA 4GOUA 3PVLA 3PP2A 1OY2A 2P0HA 1X11A 4BBKA 3DXEA 4HDQA 4DXAB 2Q13A 3GYPA 3HQCA 5D3WA 3NW8A 2YF0A 3QBVB 4GZUA 3U7DA 3FVCA 3HW2B 1RJ2A 2DYNA 4Z2NA 2HE7A 1TQZA 3ZDTA 1KI1B 2ELBA 1V5UA 1MKEA 2MDXA 1QC6A 3SO6A 2DFKA 5EFXA 1NI2A 1XKEA 3GYOA 4L1RA 1Z87A 3FSSA 2QKMA 2FJLA 4A5KA 1LW3A 2ZKMX 2K2UA 2KIGA 1Q67A 4GPTB 5C5BA 1KZ7A 1X05A 2GUMA 3P6AA 4K17A 2IFSA 3OHMB 3SV1A 3PZDA 1M7RA 5IRSA 2MKRA 3AU4A 2NBVA 2OTXA 1I7AA 1DBHA 2DN6A 3ML4A 2DHJA 4HHVA 1WGUA 2K8EA 4YONA 4B6HA 4F7HA 2YRYA 3G9WA 3B77A 2OQBA 3IVFA 4F7GA 2EMSA 1MK7B 1OMWA 2J59M 2P8VA 3NWDA 4HATB 1FB8A 2CRFA 3A58A 4EJNA 5I2MA 2CY4A 5LG4B 5HE0A 3FEHA 2P0DA 3PSCA 2L2IA 2DHKA 3N7CA 4MK0A 4DX8A 4F7UP 5L81A 5KCVA 2RLOA 4P7IA 4DX90 1BAKA 2LULA 4D0NB 1V61A 2I1KA 2X18A 4EMOA 3U12A 2YVCA 5JLJB 2DKQA 4GMXB 1DYNA 3QWMA 1XX0A 1M7EA 2Z4DA 4WJ7A 3PVUA 4EKUA 3HIEA 4KHBB 2P0FA 3TFMA 3ULBA 3VOQA 1ZYIA 2BCJA 2Z0OA 4K81A 4D6WA 5KQ1A 2MWNB 4CHJA 4DBBA 2GS0A 5D3XA 2W2XC 2VRWB 4HB4B 1BTNA 5CLQB 1MK9B 3UZTA 1NTVA 5DHAB 2AL6A 1ZC3B 2ADZA 2EMTA 4K2OA 2D4QA 2DA0A 1U5EA 1XD4A 1Y19B 4MY6A 3O96A 3PVWA 3AJ4A 2UVMA 4PQ0A 2DX5A 2D9WA 2D10A 5DI9B 4A6FB 2D9VA 3ODOA 2EJ8A 4KHAA 5D27A 2YS1A 1UPRA 2DYQA 1QQGA 3FM8C 1PMSA 1AWEA 3ULCA 1K5DB 3BJIA 3TO1A 3NSUA 1FHXA 3AU5A 3F5RA 2ROZB 3ZVRA 2L1CA 1GG3A 5C6RA 1PFJA 5DHFB 1H10A 1EF1A 1FOEA 3TCAA 1TJ6A 2ELAA 1MPHA 2GJYA 3VIAA 1DDWA 3D8DA 4TKNA 2RNRB 4YL8A 3ODXA 1XCGA 1U5GA 2MFQA 1H4RA 4HAVB 2G35A 3D8FA 2JP2A 4WSFA 3V5WA 5FI0A 3SNHA 1P5TA 2YT0A 2UZSA 2EC1A 2UZRA 4OSNA 3WA0A 5LONB 2D9XA 1ZM0A 4XWXA 1ZSQA 1WVHA 3F0WA 1J0WA 2ZPYA 1UNPA 4GN1A 2K2JA 5GOWB 2I5FA 1PLSA 5C79A 1LB1A 3CIKA 1EGXA 4QJ3B 3P7ZA 1W1HA 1MI1A 2J0MA 2NMBA 2YS3A 2RGNB 2VSZA 3X23A 4HAZB 1FHWA 1ZVRA 2Y7BA 2YS5A 2J0KA 2R09A 5I2SA 1GC7A 2NZ8B 1X1GA 1UPQA 2Z14A 2KR0A 5C16A 5CLLB 3TW1A 1WJ1A 2N0YA 2N23A 1MIXA 2D11A 1EAZA 1BWNA 2H7EA 3T06A 2RRFA 1KZGA 2XQNM 2HTHB 2M38A 2DTCA 1P3RA 2KCJA 1U2BA 3A8PA 4L6EA 2RUKB 2LYDA 4GNKB 4GXBA 5M4YB 2D9ZA 5JP4A 2KUPA 1U27A 1UNRA 3TVVA 2H7DA 1OQNA 4HB2B 1MIZB 2CODA 2E2XA 1DDVA 3CXBB 3PG7A 2RSGA 4HAYB 1ZC4B 2KGXB 4MT7A 3DXCA 5HE3A 4IOYX 2YT2A 1XODA 2GCLA 4KHOA 2V76A 2KIEA 5JHGA 1SGHA 1UEFA 1V89A 3NWAA 2LG1A 2Z13A 5C5BB 2COCA 2DLWA 4NY0A 3QIJA 4HAXB 4ZRJA 2D2QA 1I2HA 5J3QA 2PZ1A 2W2XD 1WG7A 4HSIA 4TYZA 1W1DA 3BINA 4IFSA 5HE1A 1GC6A 1WGQA 4A6KA 4C0AA 2KUQA 3MDBC 1V5PA 2LKOA 1B55A 1NTYA 1J19A 1UNQA 3KRXA 4KHBA 2FJUB 3KZ1A 3KRWA 2COAA 2Y8FA 2I5CA 5KQ4A 1K5GB 1DDMA 2K00A 1IRSA 5HE2A 1BTKA 1ISNA 3RCPA 2LOZA 3WYFB 4PNKA 1X86A 1TXDA 2DHIA 3KY9A 2ROVA 1FAOA 4H8SA 2VKIA 2M14A 4HDOA 3DCXA 1Y5OA 3ODWA 3OANA 4ZRIA 4WVFB 1P6SA 5JHHA 2Z0QA 4A6FA 2YSZA 5LOPB 4OT1A 2I1JA 1V5MA 4QXAB 2DKPA 1SHCA
chains in the Genus database with same CATH topology
1V88A 3D8EA 3HK0A 2COFA 2LOXA 3A8QA 2Y8GA 5FI1A 1NU2A 1U29A 5DH9B 1FGZA 2CY5A 1FHOA 4A6HA 4KVGB 4CHMA 2AEHA 4IAPA 4CYEA 1XR0B 1AQCA 3LJUX 2QKLA 3KSYA 5DIFB 1WJMA 4HAWB 2Z0PA 2R0DA 1MAIA 1WI1A 4ZRKA 2DX1A 3SYXA 1X1FA 3A98B 5J3TA 4NSWA 3U8ZA 2GCJA 3DXDA 4Y94A 1E5WA 5D3VA 1N3HA 2D9YA 5D3YA 1FGYA 2J0JA 2RVBB 3MPXA 3PEGA 1EVHA 4K2PA 2IYBA 4Z2MB 1U5DA 2CAYA 4HB3B 1U5FA 4GMVA 5J3YA 2YT1A 2W2WA 3M1IB 1RRPB 4HAUB 3SUZA 4KAXB 4HB0B 1W1GA 1DROA 3PVLA 3PP2A 1OY2A 2P0HA 1X11A 4BBKA 3DXEA 4HDQA 4DXAB 2Q13A 3GYPA 3HQCA 5D3WA 3QBVB 2YF0A 4GZUA 3U7DA 3HW2B 1RJ2A 2DYNA 4Z2NA 2HE7A 1TQZA 3ZDTA 1KI1B 2ELBA 1V5UA 1MKEA 2MDXA 1QC6A 3SO6A 2DFKA 5EFXA 1NI2A 1XKEA 3GYOA 1Z87A 3FSSA 2QKMA 2FJLA 4A5KA 1LW3A 2K2UA 1Q67A 4GPTB 5C5BA 1KZ7A 1X05A 3P6AA 4K17A 3SV1A 2IFSA 3PZDA 1M7RA 2MKRA 3AU4A 2OTXA 1I7AA 1DBHA 2DN6A 3ML4A 2DHJA 4HHVA 1WGUA 4YONA 4B6HA 4F7HA 2YRYA 3G9WA 2OQBA 3IVFA 4F7GA 2EMSA 1MK7B 1OMWA 2J59M 2P8VA 4HATB 1FB8A 2CRFA 4EJNA 2CY4A 5HE0A 3FEHA 2P0DA 3PSCA 2L2IA 2DHKA 3N7CA 4MK0A 4DX8A 4F7UP 5L81A 5KCVA 2RLOA 4P7IA 4DX90 1BAKA 2LULA 4D0NB 1V61A 2I1KA 2X18A 4EMOA 2YVCA 5JLJB 2DKQA 4GMXB 1DYNA 3QWMA 1XX0A 1M7EA 4WJ7A 3PVUA 4EKUA 4KHBB 2P0FA 3TFMA 3ULBA 3VOQA 2BCJA 2Z0OA 4K81A 5KQ1A 2MWNB 4CHJA 4DBBA 2GS0A 5D3XA 2W2XC 2VRWB 4HB4B 1BTNA 5CLQB 1MK9B 3UZTA 1NTVA 5DHAB 2AL6A 1ZC3B 2ADZA 2EMTA 4K2OA 2D4QA 2DA0A 1U5EA 1XD4A 1Y19B 4MY6A 3O96A 3PVWA 3AJ4A 2UVMA 4PQ0A 2DX5A 2D9WA 2D10A 5DI9B 4A6FB 2D9VA 3ODOA 2EJ8A 4KHAA 5D27A 2YS1A 1UPRA 2DYQA 1QQGA 3FM8C 1PMSA 1AWEA 3ULCA 1K5DB 3BJIA 3TO1A 3NSUA 1FHXA 3AU5A 3F5RA 2ROZB 3ZVRA 2L1CA 1GG3A 5C6RA 1PFJA 5DHFB 1H10A 1EF1A 1FOEA 3TCAA 1TJ6A 2ELAA 1MPHA 2GJYA 3VIAA 1DDWA 3D8DA 4TKNA 2RNRB 4YL8A 3ODXA 1XCGA 1U5GA 2MFQA 1H4RA 4HAVB 2G35A 3D8FA 2JP2A 4WSFA 3V5WA 5FI0A 3SNHA 1P5TA 2YT0A 2UZSA 2EC1A 2UZRA 3WA0A 5LONB 2D9XA 1ZM0A 4XWXA 1ZSQA 1WVHA 3F0WA 1J0WA 2ZPYA 1UNPA 4GN1A 2K2JA 5GOWB 2I5FA 1PLSA 5C79A 1LB1A 3CIKA 1EGXA 3P7ZA 1W1HA 2J0MA 2NMBA 2YS3A 2RGNB 2VSZA 3X23A 4HAZB 1FHWA 1ZVRA 2Y7BA 2YS5A 2J0KA 2R09A 1GC7A 2NZ8B 1X1GA 1UPQA 5C16A 5CLLB 3TW1A 1WJ1A 2N0YA 2N23A 1MIXA 2D11A 1EAZA 1BWNA 2H7EA 3T06A 1KZGA 2XQNM 2HTHB 2M38A 2DTCA 1P3RA 2KCJA 1U2BA 3A8PA 4L6EA 2RUKB 2LYDA 4GXBA 2D9ZA 5JP4A 2KUPA 1U27A 1UNRA 3TVVA 2H7DA 1OQNA 4HB2B 1MIZB 2CODA 2E2XA 1DDVA 3CXBB 3PG7A 2RSGA 4HAYB 1ZC4B 2KGXB 4MT7A 3DXCA 5HE3A 4IOYX 1XODA 2GCLA 4KHOA 2V76A 5JHGA 1SGHA 1UEFA 1V89A 2LG1A 5C5BB 2COCA 2DLWA 4NY0A 3QIJA 4HAXB 4ZRJA 2D2QA 1I2HA 5J3QA 2PZ1A 2W2XD 1WG7A 4TYZA 1W1DA 3BINA 4IFSA 5HE1A 1GC6A 1WGQA 4A6KA 4C0AA 3MDBC 1V5PA 2LKOA 1B55A 1NTYA 1J19A 1UNQA 3KRXA 3KZ1A 3KRWA 2COAA 2Y8FA 2I5CA 5KQ4A 1K5GB 1DDMA 2K00A 1IRSA 5HE2A 1BTKA 1ISNA 3RCPA 2LOZA 3WYFB 4PNKA 1X86A 1TXDA 2DHIA 3KY9A 2ROVA 1FAOA 4H8SA 2VKIA 2M14A 4HDOA 1Y5OA 3ODWA 3OANA 4ZRIA 4WVFB 1P6SA 5JHHA 2Z0QA 4A6FA 2YSZA 5LOPB 2I1JA 1V5MA 2DKPA 1SHCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1V88 A;  3D8E A;  3HK0 A;  2COF A;  2LOX A;  3A8Q A;  2Y8G A;  5FI1 A;  1NU2 A;  1U29 A;  5DH9 B;  1FGZ A;  2CY5 A;  1FHO A;  4A6H A;  4KVG B;  4CHM A;  2AEH A;  4IAP A;  4CYE A;  1XR0 B;  1AQC A;  3LJU X;  2QKL A;  3KSY A;  5DIF B;  1WJM A;  4HAW B;  2Z0P A;  2R0D A;  1MAI A;  1WI1 A;  4ZRK A;  2DX1 A;  3SYX A;  1X1F A;  3A98 B;  5J3T A;  4NSW A;  3U8Z A;  2GCJ A;  3DXD A;  4Y94 A;  1E5W A;  5D3V A;  1N3H A;  2D9Y A;  5D3Y A;  1FGY A;  2J0J A;  2RVB B;  3MPX A;  3PEG A;  1EVH A;  4K2P A;  2IYB A;  4Z2M B;  1U5D A;  2CAY A;  4HB3 B;  1U5F A;  4GMV A;  5J3Y A;  2YT1 A;  2W2W A;  3M1I B;  1RRP B;  4HAU B;  3SUZ A;  4KAX B;  4HB0 B;  1W1G A;  1DRO A;  3PVL A;  3PP2 A;  1OY2 A;  2P0H A;  1X11 A;  4BBK A;  3DXE A;  4HDQ A;  4DXA B;  2Q13 A;  3GYP A;  3HQC A;  5D3W A;  3QBV B;  2YF0 A;  4GZU A;  3U7D A;  3HW2 B;  1RJ2 A;  2DYN A;  4Z2N A;  2HE7 A;  1TQZ A;  3ZDT A;  1KI1 B;  2ELB A;  1V5U A;  1MKE A;  2MDX A;  1QC6 A;  3SO6 A;  2DFK A;  5EFX A;  1NI2 A;  1XKE A;  3GYO A;  1Z87 A;  3FSS A;  2QKM A;  2FJL A;  4A5K A;  1LW3 A;  2K2U A;  1Q67 A;  4GPT B;  5C5B A;  1KZ7 A;  1X05 A;  3P6A A;  4K17 A;  3SV1 A;  2IFS A;  3PZD A;  1M7R A;  2MKR A;  3AU4 A;  2OTX A;  1I7A A;  1DBH A;  2DN6 A;  3ML4 A;  2DHJ A;  4HHV A;  1WGU A;  4YON A;  4B6H A;  4F7H A;  2YRY A;  3G9W A;  2OQB A;  3IVF A;  4F7G A;  2EMS A;  1MK7 B;  1OMW A;  2J59 M;  2P8V A;  4HAT B;  1FB8 A;  2CRF A;  4EJN A;  2CY4 A;  5HE0 A;  3FEH A;  2P0D A;  3PSC A;  2L2I A;  2DHK A;  3N7C A;  4MK0 A;  4DX8 A;  4F7U P;  5L81 A;  5KCV A;  2RLO A;  4P7I A;  4DX9 0;  1BAK A;  2LUL A;  4D0N B;  1V61 A;  2I1K A;  2X18 A;  4EMO A;  2YVC A;  5JLJ B;  2DKQ A;  4GMX B;  1DYN A;  3QWM A;  1XX0 A;  1M7E A;  4WJ7 A;  3PVU A;  4EKU A;  4KHB B;  2P0F A;  3TFM A;  3ULB A;  3VOQ A;  2BCJ A;  2Z0O A;  4K81 A;  5KQ1 A;  2MWN B;  4CHJ A;  4DBB A;  2GS0 A;  5D3X A;  2W2X C;  2VRW B;  4HB4 B;  1BTN A;  5CLQ B;  1MK9 B;  3UZT A;  1NTV A;  5DHA B;  2AL6 A;  1ZC3 B;  2ADZ A;  2EMT A;  4K2O A;  2D4Q A;  2DA0 A;  1U5E A;  1XD4 A;  1Y19 B;  4MY6 A;  3O96 A;  3PVW A;  3AJ4 A;  2UVM A;  4PQ0 A;  2DX5 A;  2D9W A;  2D10 A;  5DI9 B;  4A6F B;  2D9V A;  3ODO A;  2EJ8 A;  4KHA A;  5D27 A;  2YS1 A;  1UPR A;  2DYQ A;  1QQG A;  3FM8 C;  1PMS A;  1AWE A;  3ULC A;  1K5D B;  3BJI A;  3TO1 A;  3NSU A;  1FHX A;  3AU5 A;  3F5R A;  2ROZ B;  3ZVR A;  2L1C A;  1GG3 A;  5C6R A;  1PFJ A;  5DHF B;  1H10 A;  1EF1 A;  1FOE A;  3TCA A;  1TJ6 A;  2ELA A;  1MPH A;  2GJY A;  3VIA A;  1DDW A;  3D8D A;  4TKN A;  2RNR B;  4YL8 A;  3ODX A;  1XCG A;  1U5G A;  2MFQ A;  1H4R A;  4HAV B;  2G35 A;  3D8F A;  2JP2 A;  4WSF A;  3V5W A;  5FI0 A;  3SNH A;  1P5T A;  2YT0 A;  2UZS A;  2EC1 A;  2UZR A;  3WA0 A;  5LON B;  2D9X A;  1ZM0 A;  4XWX A;  1ZSQ A;  1WVH A;  3F0W A;  1J0W A;  2ZPY A;  1UNP A;  4GN1 A;  2K2J A;  5GOW B;  2I5F A;  1PLS A;  5C79 A;  1LB1 A;  3CIK A;  1EGX A;  3P7Z A;  1W1H A;  2J0M A;  2NMB A;  2YS3 A;  2RGN B;  2VSZ A;  3X23 A;  4HAZ B;  1FHW A;  1ZVR A;  2Y7B A;  2YS5 A;  2J0K A;  2R09 A;  1GC7 A;  2NZ8 B;  1X1G A;  1UPQ A;  5C16 A;  5CLL B;  3TW1 A;  1WJ1 A;  2N0Y A;  2N23 A;  1MIX A;  2D11 A;  1EAZ A;  1BWN A;  2H7E A;  3T06 A;  1KZG A;  2XQN M;  2HTH B;  2M38 A;  2DTC A;  1P3R A;  2KCJ A;  1U2B A;  3A8P A;  4L6E A;  2RUK B;  2LYD A;  4GXB A;  2D9Z A;  5JP4 A;  2KUP A;  1U27 A;  1UNR A;  3TVV A;  2H7D A;  1OQN A;  4HB2 B;  1MIZ B;  2COD A;  2E2X A;  1DDV A;  3CXB B;  3PG7 A;  2RSG A;  4HAY B;  1ZC4 B;  2KGX B;  4MT7 A;  3DXC A;  5HE3 A;  4IOY X;  1XOD A;  2GCL A;  4KHO A;  2V76 A;  5JHG A;  1SGH A;  1UEF A;  1V89 A;  2LG1 A;  5C5B B;  2COC A;  2DLW A;  4NY0 A;  3QIJ A;  4HAX B;  4ZRJ A;  2D2Q A;  1I2H A;  5J3Q A;  2PZ1 A;  2W2X D;  1WG7 A;  4TYZ A;  1W1D A;  3BIN A;  4IFS A;  5HE1 A;  1GC6 A;  1WGQ A;  4A6K A;  4C0A A;  3MDB C;  1V5P A;  2LKO A;  1B55 A;  1NTY A;  1J19 A;  1UNQ A;  3KRX A;  3KZ1 A;  3KRW A;  2COA A;  2Y8F A;  2I5C A;  5KQ4 A;  1K5G B;  1DDM A;  2K00 A;  1IRS A;  5HE2 A;  1BTK A;  1ISN A;  3RCP A;  2LOZ A;  3WYF B;  4PNK A;  1X86 A;  1TXD A;  2DHI A;  3KY9 A;  2ROV A;  1FAO A;  4H8S A;  2VKI A;  2M14 A;  4HDO A;  1Y5O A;  3ODW A;  3OAN A;  4ZRI A;  4WVF B;  1P6S A;  5JHH A;  2Z0Q A;  4A6F A;  2YSZ A;  5LOP B;  2I1J A;  1V5M A;  2DKP A;  1SHC A; 
#chains in the Genus database with same CATH topology
 1V88 A;  3D8E A;  4CSQ A;  1T77 A;  3HK0 A;  4QJ4 B;  2COF A;  2LOX A;  3A8Q A;  2Y8G A;  5FI1 A;  3HSA A;  1NU2 A;  1U29 A;  5DH9 B;  1FGZ A;  2CY5 A;  1FHO A;  4A6H A;  4KVG B;  4CHM A;  2AEH A;  4IAP A;  2Z59 A;  4CYE A;  1XR0 B;  1AQC A;  3LJU X;  2QKL A;  3KSY A;  5DIF B;  1WJM A;  4HAW B;  2K49 A;  2Z0P A;  2R2Y A;  2R0D A;  1MAI A;  1WI1 A;  4QJ5 B;  4ZRK A;  2DX1 A;  3SYX A;  1X1F A;  3A98 B;  5J3T A;  4NSW A;  3U8Z A;  2GCJ A;  3DXD A;  4Y94 A;  1E5W A;  5D3V A;  1N3H A;  2D9Y A;  5D3Y A;  1FGY A;  2J0J A;  2RVB B;  3MPX A;  3PEG A;  1EVH A;  4K2P A;  2IYB A;  4Z2M B;  1U5D A;  4DIX A;  2CAY A;  4HB3 B;  1U5F A;  4GMV A;  5J3Y A;  2YT1 A;  2W2W A;  3M1I B;  3NWF A;  1RRP B;  4HAU B;  3SUZ A;  4KAX B;  4HB0 B;  1W1G A;  1DRO A;  4GOU A;  3PVL A;  3PP2 A;  1OY2 A;  2P0H A;  1X11 A;  4BBK A;  3DXE A;  4HDQ A;  4DXA B;  2Q13 A;  3GYP A;  3HQC A;  5D3W A;  3NW8 A;  2YF0 A;  3QBV B;  4GZU A;  3U7D A;  3FVC A;  3HW2 B;  1RJ2 A;  2DYN A;  4Z2N A;  2HE7 A;  1TQZ A;  3ZDT A;  1KI1 B;  2ELB A;  1V5U A;  1MKE A;  2MDX A;  1QC6 A;  3SO6 A;  2DFK A;  5EFX A;  1NI2 A;  1XKE A;  3GYO A;  4L1R A;  1Z87 A;  3FSS A;  2QKM A;  2FJL A;  4A5K A;  1LW3 A;  2ZKM X;  2K2U A;  2KIG A;  1Q67 A;  4GPT B;  5C5B A;  1KZ7 A;  1X05 A;  2GUM A;  3P6A A;  4K17 A;  2IFS A;  3OHM B;  3SV1 A;  3PZD A;  1M7R A;  5IRS A;  2MKR A;  3AU4 A;  2NBV A;  2OTX A;  1I7A A;  1DBH A;  2DN6 A;  3ML4 A;  2DHJ A;  4HHV A;  1WGU A;  2K8E A;  4YON A;  4B6H A;  4F7H A;  2YRY A;  3G9W A;  3B77 A;  2OQB A;  3IVF A;  4F7G A;  2EMS A;  1MK7 B;  1OMW A;  2J59 M;  2P8V A;  3NWD A;  4HAT B;  1FB8 A;  2CRF A;  3A58 A;  4EJN A;  5I2M A;  2CY4 A;  5LG4 B;  5HE0 A;  3FEH A;  2P0D A;  3PSC A;  2L2I A;  2DHK A;  3N7C A;  4MK0 A;  4DX8 A;  4F7U P;  5L81 A;  5KCV A;  2RLO A;  4P7I A;  4DX9 0;  1BAK A;  2LUL A;  4D0N B;  1V61 A;  2I1K A;  2X18 A;  4EMO A;  3U12 A;  2YVC A;  5JLJ B;  2DKQ A;  4GMX B;  1DYN A;  3QWM A;  1XX0 A;  1M7E A;  2Z4D A;  4WJ7 A;  3PVU A;  4EKU A;  3HIE A;  4KHB B;  2P0F A;  3TFM A;  3ULB A;  3VOQ A;  1ZYI A;  2BCJ A;  2Z0O A;  4K81 A;  4D6W A;  5KQ1 A;  2MWN B;  4CHJ A;  4DBB A;  2GS0 A;  5D3X A;  2W2X C;  2VRW B;  4HB4 B;  1BTN A;  5CLQ B;  1MK9 B;  3UZT A;  1NTV A;  5DHA B;  2AL6 A;  1ZC3 B;  2ADZ A;  2EMT A;  4K2O A;  2D4Q A;  2DA0 A;  1U5E A;  1XD4 A;  1Y19 B;  4MY6 A;  3O96 A;  3PVW A;  3AJ4 A;  2UVM A;  4PQ0 A;  2DX5 A;  2D9W A;  2D10 A;  5DI9 B;  4A6F B;  2D9V A;  3ODO A;  2EJ8 A;  4KHA A;  5D27 A;  2YS1 A;  1UPR A;  2DYQ A;  1QQG A;  3FM8 C;  1PMS A;  1AWE A;  3ULC A;  1K5D B;  3BJI A;  3TO1 A;  3NSU A;  1FHX A;  3AU5 A;  3F5R A;  2ROZ B;  3ZVR A;  2L1C A;  1GG3 A;  5C6R A;  1PFJ A;  5DHF B;  1H10 A;  1EF1 A;  1FOE A;  3TCA A;  1TJ6 A;  2ELA A;  1MPH A;  2GJY A;  3VIA A;  1DDW A;  3D8D A;  4TKN A;  2RNR B;  4YL8 A;  3ODX A;  1XCG A;  1U5G A;  2MFQ A;  1H4R A;  4HAV B;  2G35 A;  3D8F A;  2JP2 A;  4WSF A;  3V5W A;  5FI0 A;  3SNH A;  1P5T A;  2YT0 A;  2UZS A;  2EC1 A;  2UZR A;  4OSN A;  3WA0 A;  5LON B;  2D9X A;  1ZM0 A;  4XWX A;  1ZSQ A;  1WVH A;  3F0W A;  1J0W A;  2ZPY A;  1UNP A;  4GN1 A;  2K2J A;  5GOW B;  2I5F A;  1PLS A;  5C79 A;  1LB1 A;  3CIK A;  1EGX A;  4QJ3 B;  3P7Z A;  1W1H A;  1MI1 A;  2J0M A;  2NMB A;  2YS3 A;  2RGN B;  2VSZ A;  3X23 A;  4HAZ B;  1FHW A;  1ZVR A;  2Y7B A;  2YS5 A;  2J0K A;  2R09 A;  5I2S A;  1GC7 A;  2NZ8 B;  1X1G A;  1UPQ A;  2Z14 A;  2KR0 A;  5C16 A;  5CLL B;  3TW1 A;  1WJ1 A;  2N0Y A;  2N23 A;  1MIX A;  2D11 A;  1EAZ A;  1BWN A;  2H7E A;  3T06 A;  2RRF A;  1KZG A;  2XQN M;  2HTH B;  2M38 A;  2DTC A;  1P3R A;  2KCJ A;  1U2B A;  3A8P A;  4L6E A;  2RUK B;  2LYD A;  4GNK B;  4GXB A;  5M4Y B;  2D9Z A;  5JP4 A;  2KUP A;  1U27 A;  1UNR A;  3TVV A;  2H7D A;  1OQN A;  4HB2 B;  1MIZ B;  2COD A;  2E2X A;  1DDV A;  3CXB B;  3PG7 A;  2RSG A;  4HAY B;  1ZC4 B;  2KGX B;  4MT7 A;  3DXC A;  5HE3 A;  4IOY X;  2YT2 A;  1XOD A;  2GCL A;  4KHO A;  2V76 A;  2KIE A;  5JHG A;  1SGH A;  1UEF A;  1V89 A;  3NWA A;  2LG1 A;  2Z13 A;  5C5B B;  2COC A;  2DLW A;  4NY0 A;  3QIJ A;  4HAX B;  4ZRJ A;  2D2Q A;  1I2H A;  5J3Q A;  2PZ1 A;  2W2X D;  1WG7 A;  4HSI A;  4TYZ A;  1W1D A;  3BIN A;  4IFS A;  5HE1 A;  1GC6 A;  1WGQ A;  4A6K A;  4C0A A;  2KUQ A;  3MDB C;  1V5P A;  2LKO A;  1B55 A;  1NTY A;  1J19 A;  1UNQ A;  3KRX A;  4KHB A;  2FJU B;  3KZ1 A;  3KRW A;  2COA A;  2Y8F A;  2I5C A;  5KQ4 A;  1K5G B;  1DDM A;  2K00 A;  1IRS A;  5HE2 A;  1BTK A;  1ISN A;  3RCP A;  2LOZ A;  3WYF B;  4PNK A;  1X86 A;  1TXD A;  2DHI A;  3KY9 A;  2ROV A;  1FAO A;  4H8S A;  2VKI A;  2M14 A;  4HDO A;  3DCX A;  1Y5O A;  3ODW A;  3OAN A;  4ZRI A;  4WVF B;  1P6S A;  5JHH A;  2Z0Q A;  4A6F A;  2YSZ A;  5LOP B;  4OT1 A;  2I1J A;  1V5M A;  4QXA B;  2DKP A;  1SHC A; 
#chains in the Genus database with same CATH homology
 1V88 A;  3D8E A;  3HK0 A;  2COF A;  2LOX A;  3A8Q A;  2Y8G A;  5FI1 A;  1NU2 A;  1U29 A;  5DH9 B;  1FGZ A;  2CY5 A;  1FHO A;  4A6H A;  4KVG B;  4CHM A;  2AEH A;  4IAP A;  4CYE A;  1XR0 B;  1AQC A;  3LJU X;  2QKL A;  3KSY A;  5DIF B;  1WJM A;  4HAW B;  2Z0P A;  2R0D A;  1MAI A;  1WI1 A;  4ZRK A;  2DX1 A;  3SYX A;  1X1F A;  3A98 B;  5J3T A;  4NSW A;  3U8Z A;  2GCJ A;  3DXD A;  4Y94 A;  1E5W A;  5D3V A;  1N3H A;  2D9Y A;  5D3Y A;  1FGY A;  2J0J A;  2RVB B;  3MPX A;  3PEG A;  1EVH A;  4K2P A;  2IYB A;  4Z2M B;  1U5D A;  2CAY A;  4HB3 B;  1U5F A;  4GMV A;  5J3Y A;  2YT1 A;  2W2W A;  3M1I B;  1RRP B;  4HAU B;  3SUZ A;  4KAX B;  4HB0 B;  1W1G A;  1DRO A;  3PVL A;  3PP2 A;  1OY2 A;  2P0H A;  1X11 A;  4BBK A;  3DXE A;  4HDQ A;  4DXA B;  2Q13 A;  3GYP A;  3HQC A;  5D3W A;  3QBV B;  2YF0 A;  4GZU A;  3U7D A;  3HW2 B;  1RJ2 A;  2DYN A;  4Z2N A;  2HE7 A;  1TQZ A;  3ZDT A;  1KI1 B;  2ELB A;  1V5U A;  1MKE A;  2MDX A;  1QC6 A;  3SO6 A;  2DFK A;  5EFX A;  1NI2 A;  1XKE A;  3GYO A;  1Z87 A;  3FSS A;  2QKM A;  2FJL A;  4A5K A;  1LW3 A;  2K2U A;  1Q67 A;  4GPT B;  5C5B A;  1KZ7 A;  1X05 A;  3P6A A;  4K17 A;  3SV1 A;  2IFS A;  3PZD A;  1M7R A;  2MKR A;  3AU4 A;  2OTX A;  1I7A A;  1DBH A;  2DN6 A;  3ML4 A;  2DHJ A;  4HHV A;  1WGU A;  4YON A;  4B6H A;  4F7H A;  2YRY A;  3G9W A;  2OQB A;  3IVF A;  4F7G A;  2EMS A;  1MK7 B;  1OMW A;  2J59 M;  2P8V A;  4HAT B;  1FB8 A;  2CRF A;  4EJN A;  2CY4 A;  5HE0 A;  3FEH A;  2P0D A;  3PSC A;  2L2I A;  2DHK A;  3N7C A;  4MK0 A;  4DX8 A;  4F7U P;  5L81 A;  5KCV A;  2RLO A;  4P7I A;  4DX9 0;  1BAK A;  2LUL A;  4D0N B;  1V61 A;  2I1K A;  2X18 A;  4EMO A;  2YVC A;  5JLJ B;  2DKQ A;  4GMX B;  1DYN A;  3QWM A;  1XX0 A;  1M7E A;  4WJ7 A;  3PVU A;  4EKU A;  4KHB B;  2P0F A;  3TFM A;  3ULB A;  3VOQ A;  2BCJ A;  2Z0O A;  4K81 A;  5KQ1 A;  2MWN B;  4CHJ A;  4DBB A;  2GS0 A;  5D3X A;  2W2X C;  2VRW B;  4HB4 B;  1BTN A;  5CLQ B;  1MK9 B;  3UZT A;  1NTV A;  5DHA B;  2AL6 A;  1ZC3 B;  2ADZ A;  2EMT A;  4K2O A;  2D4Q A;  2DA0 A;  1U5E A;  1XD4 A;  1Y19 B;  4MY6 A;  3O96 A;  3PVW A;  3AJ4 A;  2UVM A;  4PQ0 A;  2DX5 A;  2D9W A;  2D10 A;  5DI9 B;  4A6F B;  2D9V A;  3ODO A;  2EJ8 A;  4KHA A;  5D27 A;  2YS1 A;  1UPR A;  2DYQ A;  1QQG A;  3FM8 C;  1PMS A;  1AWE A;  3ULC A;  1K5D B;  3BJI A;  3TO1 A;  3NSU A;  1FHX A;  3AU5 A;  3F5R A;  2ROZ B;  3ZVR A;  2L1C A;  1GG3 A;  5C6R A;  1PFJ A;  5DHF B;  1H10 A;  1EF1 A;  1FOE A;  3TCA A;  1TJ6 A;  2ELA A;  1MPH A;  2GJY A;  3VIA A;  1DDW A;  3D8D A;  4TKN A;  2RNR B;  4YL8 A;  3ODX A;  1XCG A;  1U5G A;  2MFQ A;  1H4R A;  4HAV B;  2G35 A;  3D8F A;  2JP2 A;  4WSF A;  3V5W A;  5FI0 A;  3SNH A;  1P5T A;  2YT0 A;  2UZS A;  2EC1 A;  2UZR A;  3WA0 A;  5LON B;  2D9X A;  1ZM0 A;  4XWX A;  1ZSQ A;  1WVH A;  3F0W A;  1J0W A;  2ZPY A;  1UNP A;  4GN1 A;  2K2J A;  5GOW B;  2I5F A;  1PLS A;  5C79 A;  1LB1 A;  3CIK A;  1EGX A;  3P7Z A;  1W1H A;  2J0M A;  2NMB A;  2YS3 A;  2RGN B;  2VSZ A;  3X23 A;  4HAZ B;  1FHW A;  1ZVR A;  2Y7B A;  2YS5 A;  2J0K A;  2R09 A;  1GC7 A;  2NZ8 B;  1X1G A;  1UPQ A;  5C16 A;  5CLL B;  3TW1 A;  1WJ1 A;  2N0Y A;  2N23 A;  1MIX A;  2D11 A;  1EAZ A;  1BWN A;  2H7E A;  3T06 A;  1KZG A;  2XQN M;  2HTH B;  2M38 A;  2DTC A;  1P3R A;  2KCJ A;  1U2B A;  3A8P A;  4L6E A;  2RUK B;  2LYD A;  4GXB A;  2D9Z A;  5JP4 A;  2KUP A;  1U27 A;  1UNR A;  3TVV A;  2H7D A;  1OQN A;  4HB2 B;  1MIZ B;  2COD A;  2E2X A;  1DDV A;  3CXB B;  3PG7 A;  2RSG A;  4HAY B;  1ZC4 B;  2KGX B;  4MT7 A;  3DXC A;  5HE3 A;  4IOY X;  1XOD A;  2GCL A;  4KHO A;  2V76 A;  5JHG A;  1SGH A;  1UEF A;  1V89 A;  2LG1 A;  5C5B B;  2COC A;  2DLW A;  4NY0 A;  3QIJ A;  4HAX B;  4ZRJ A;  2D2Q A;  1I2H A;  5J3Q A;  2PZ1 A;  2W2X D;  1WG7 A;  4TYZ A;  1W1D A;  3BIN A;  4IFS A;  5HE1 A;  1GC6 A;  1WGQ A;  4A6K A;  4C0A A;  3MDB C;  1V5P A;  2LKO A;  1B55 A;  1NTY A;  1J19 A;  1UNQ A;  3KRX A;  3KZ1 A;  3KRW A;  2COA A;  2Y8F A;  2I5C A;  5KQ4 A;  1K5G B;  1DDM A;  2K00 A;  1IRS A;  5HE2 A;  1BTK A;  1ISN A;  3RCP A;  2LOZ A;  3WYF B;  4PNK A;  1X86 A;  1TXD A;  2DHI A;  3KY9 A;  2ROV A;  1FAO A;  4H8S A;  2VKI A;  2M14 A;  4HDO A;  1Y5O A;  3ODW A;  3OAN A;  4ZRI A;  4WVF B;  1P6S A;  5JHH A;  2Z0Q A;  4A6F A;  2YSZ A;  5LOP B;  2I1J A;  1V5M A;  2DKP A;  1SHC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...