2CY4A

Crystal structure of phosphotyrosine binding (ptb) domain of epidermal growth factor receptor pathway substrate-8 (eps8) related protein 1 from mus musculus (form-1 crystal)
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
129
structure length
129
Chain Sequence
ADVSQYHVNHLVTFCLGEEDGVHTVEDASRKLAVMDSQGRVWAQEMLLRVSPSQVTLLDPVSKEELESYPLDAIVRCDAVMPRGRSRSLLLLVCQEPERAQPDVHFFQGLLLGAELIREDIQGALQNYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of phosphotyrosine binding (PTB) domain of epidermal growth factor receptor pathway substrate-8 (EPS8) related protein 1 from Mus musculus (form-1 crystal)
rcsb
source organism Mus musculus
molecule tags Signaling protein
molecule keywords epidermal growth factor receptor pathway substrate 8-like pr
total genus 27
structure length 129
sequence length 129
ec nomenclature
pdb deposition date 2005-07-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08416 PTB Phosphotyrosine-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2cy4A00
3WYFB 3DXDA 5D3VA 1W1GA 2DTCA 3ODOA 3TW1A 1DDMA 2D9WA 1E5WA 4KHBB 2IFSA 2YF0A 1UNPA 2RSGA 5C5BB 2ROVA 2YT1A 3PSCA 3HK0A 4DXAB 3BINA 4IOYX 2MDXA 1WJ1A 2Q13A 2YS5A 3SNHA 5L81A 4Y94A 1M7EA 2NMBA 4HHVA 3PP2A 4MK0A 1BTKA 2N23A 2CODA 1B55A 2UVMA 4DX8A 1UNQA 1QQGA 4EJNA 2EMSA 4GMXB 2LOXA 4NSWA 3SV1A 2YS3A 1GG3A 1TQZA 2YSZA 5GOWB 4HAWB 2EMTA 2I1KA 5C6RA 2Y8FA 1FOEA 1X05A 3MDBC 1V89A 2COAA 1WGQA 3IVFA 3KRWA 1NTVA 1EF1A 4TYZA 2DHJA 5HE3A 1MIXA 3TCAA 3T06A 1ISNA 4XWXA 2P0HA 3TO1A 4KVGB 1FHOA 1NTYA 1OY2A 2R0DA 3G9WA 3DXCA 3QWMA 3A8PA 2K2UA 3D8FA 4CYEA 3M1IB 3DXEA 3A8QA 3GYPA 4CHJA 1ZM0A 2D10A 4HAUB 1OMWA 1RJ2A 2D4QA 1U2BA 4HAZB 3AU5A 3MPXA 5KQ4A 2KUPA 1MKEA 2ADZA 1DROA 2HTHB 1UNRA 4GZUA 2DHKA 4YL8A 1DBHA 1KZ7A 1I2HA 4HAVB 4MT7A 4HATB 5C79A 2OTXA 4WSFA 4C0AA 1KZGA 1ZVRA 5DHFB 2DHIA 5DIFB 4H8SA 2J0KA 2VRWB 1XR0B 3PG7A 1X11A 2MFQA 4EKUA 2MWNB 3TFMA 5JHHA 4IFSA 1GC6A 3NSUA 2LG1A 3WA0A 2R09A 1V5MA 2XQNM 2OQBA 3N7CA 1UPRA 3KRXA 5CLLB 3SO6A 1SGHA 2CY4A 4IAPA 4PQ0A 1XCGA 1W1HA 4NY0A 2I5FA 1FAOA 1M7RA 2Y8GA 1KI1B 5FI0A 1XX0A 2LYDA 2DA0A 5HE2A 1WG7A 2YRYA 4KHAA 2VKIA 3KSYA 5KCVA 2V76A 1U27A 2I5CA 4D0NB 1WI1A 3U8ZA 2JP2A 3CXBB 3V5WA 2D2QA 4HB3B 3PEGA 2L2IA 4A6KA 2AL6A 1K5GB 2GCLA 2H7DA 2HE7A 1Z87A 4HB2B 4ZRIA 2VSZA 2DLWA 3D8EA 3ZVRA 2P0DA 2J0JA 2DN6A 2CAYA 2E2XA 2KCJA 4Z2NA 4A6FB 2YVCA 4WJ7A 1U5EA 1GC7A 3PVLA 2P0FA 2GS0A 4HDOA 2Z0OA 5DHAB 2COFA 4K81A 4K2OA 3P6AA 1V5PA 3VIAA 4WVFB 3ULCA 4YONA 1P6SA 3HW2B 2YT0A 5JP4A 2RLOA 5DI9B 4ZRJA 4A6HA 2KGXB 4BBKA 1U29A 2J0MA 3OANA 3X23A 1WGUA 2QKMA 2EC1A 2DYQA 5D3XA 2CRFA 4HAXB 2IYBA 2W2XC 1BAKA 2D9XA 3U7DA 4F7HA 5D3WA 2Y7BA 1U5FA 3D8DA 4CHMA 3VOQA 3HQCA 1FHXA 2K2JA 3QBVB 2EJ8A 3BJIA 4GMVA 1DDWA 1X1FA 2P8VA 1TJ6A 4A5KA 1K5DB 2AEHA 3ULBA 1ZC4B 4GN1A 2J59M 5KQ1A 4L6EA 1RRPB 4P7IA 1IRSA 4HAYB 1WVHA 4ZRKA 2COCA 3PVUA 3GYOA 2RGNB 2ELBA 4Z2MB 2MKRA 3KZ1A 5D3YA 2DKPA 5D27A 3F0WA 1X1GA 5C16A 5HE0A 2ROZB 1XODA 1FB8A 2DYNA 1XKEA 2DKQA 5CLQB 1EGXA 2D9YA 1LB1A 1P5TA 3PVWA 1DYNA 2QKLA 4PNKA 1I7AA 3KY9A 1AWEA 5JHGA 2FJLA 1W1DA 3FM8C 3UZTA 1TXDA 2D11A 3ODXA 1BTNA 1QC6A 1Y19B 2GJYA 1P3RA 1V5UA 2RUKB 1MIZB 1NI2A 2M14A 3AU4A 2BCJA 2W2WA 4F7UP 1FGZA 1Q67A 1PFJA 4HB0B 1WJMA 5J3QA 5J3TA 2Z0QA 2NZ8B 2K00A 1EAZA 1FHWA 2N0YA 2X18A 1Y5OA 4HDQA 3FEHA 3P7ZA 5JLJB 1FGYA 2DFKA 3RCPA 1DDVA 1PMSA 1UEFA 1BWNA 1AQCA 2UZSA 1ZSQA 3ODWA 2DX5A 1UPQA 5LONB 2RVBB 2L1CA 5DH9B 1X86A 2LKOA 2M38A 3F5RA 1J19A 3PZDA 1V88A 4K2PA 1V61A 1MK7B 1EVHA 2G35A 1PLSA 4MY6A 2ZPYA 2D9ZA 4KHOA 2W2XD 2ELAA 3FSSA 4KAXB 1N3HA 1U5GA 2Z0PA 1H10A 3SYXA 3A98B 1J0WA 1LW3A 1ZC3B 2LOZA 2RNRB 5HE1A 1MK9B 1OQNA 2DX1A 3TVVA 2PZ1A 1MPHA 4B6HA 5C5BA 3O96A 5J3YA 2GCJA 4K17A 3CIKA 2LULA 4TKNA 1XD4A 2D9VA 5EFXA 4DX90 3AJ4A 4GXBA 4F7GA 3ZDTA 3QIJA 1NU2A 4EMOA 3SUZA 4DBBA 2UZRA 2CY5A 1SHCA 3ML4A 2H7EA 4HB4B 3LJUX 4A6FA 2YS1A 1U5DA 2I1JA 5FI1A 1H4RA 5LOPB 1MAIA 4GPTB
chains in the Genus database with same CATH superfamily
3WYFB 3DXDA 3OHMB 5D3VA 1W1GA 2DTCA 3ODOA 3TW1A 1DDMA 1MI1A 2D9WA 1E5WA 4KHBB 2IFSA 2YF0A 1UNPA 2RSGA 5C5BB 2ROVA 2YT1A 3PSCA 3HK0A 4KHBA 4DXAB 3BINA 4IOYX 2MDXA 1WJ1A 2Q13A 2YS5A 3SNHA 5L81A 3B77A 4Y94A 1M7EA 2NMBA 2RRFA 4HHVA 3PP2A 2GUMA 1BTKA 2N23A 2CODA 4MK0A 1B55A 2UVMA 4DX8A 1UNQA 1QQGA 2KUQA 4EJNA 2EMSA 4GMXB 2LOXA 4NSWA 3SV1A 2YS3A 1GG3A 4DIXA 1TQZA 2YSZA 5GOWB 4HAWB 2EMTA 2I1KA 5C6RA 2Y8FA 1FOEA 1X05A 3MDBC 1V89A 2COAA 1WGQA 3IVFA 3KRWA 1NTVA 1EF1A 4TYZA 2DHJA 5HE3A 1MIXA 3TCAA 3NWDA 3T06A 1ISNA 4XWXA 2P0HA 3TO1A 4KVGB 4L1RA 1FHOA 1NTYA 1OY2A 2R0DA 3G9WA 3DXCA 3QWMA 3FVCA 3A8PA 2K2UA 3D8FA 4CYEA 3M1IB 3DXEA 3A8QA 3GYPA 4CHJA 1ZM0A 2D10A 4HAUB 1OMWA 1RJ2A 2D4QA 1U2BA 4HAZB 3AU5A 3MPXA 5KQ4A 2KUPA 1MKEA 3NWAA 2ADZA 1DROA 2HTHB 1UNRA 4GZUA 2DHKA 4YL8A 1DBHA 1KZ7A 1I2HA 4HAVB 4MT7A 4HATB 5C79A 2OTXA 4WSFA 4C0AA 2NBVA 1KZGA 1ZVRA 5DHFB 5M4YB 2DHIA 4OT1A 5DIFB 4H8SA 2J0KA 2VRWB 1XR0B 3PG7A 1X11A 2MFQA 4EKUA 3NW8A 2MWNB 3TFMA 5JHHA 4IFSA 1GC6A 3NSUA 2LG1A 3WA0A 2R09A 1V5MA 2XQNM 2OQBA 3DCXA 3N7CA 2K49A 1UPRA 3KRXA 5CLLB 3SO6A 1SGHA 2CY4A 2ZKMX 4IAPA 4PQ0A 1XCGA 1W1HA 4NY0A 2I5FA 1FAOA 1M7RA 2Y8GA 1KI1B 5FI0A 1XX0A 2LYDA 2DA0A 5HE2A 1WG7A 2YRYA 4KHAA 2VKIA 3KSYA 5KCVA 2V76A 1U27A 2I5CA 4D0NB 1WI1A 5LG4B 3U8ZA 2JP2A 3CXBB 3V5WA 2D2QA 3PEGA 2L2IA 4HB3B 4HSIA 4A6KA 2AL6A 1K5GB 2GCLA 2H7DA 2HE7A 1Z87A 4HB2B 4ZRIA 2VSZA 2DLWA 3D8EA 4GOUA 3ZVRA 2P0DA 2J0JA 2DN6A 2CAYA 2E2XA 2KCJA 4Z2NA 4A6FB 2YVCA 4WJ7A 1U5EA 1GC7A 3PVLA 2P0FA 2GS0A 4HDOA 2Z0OA 5DHAB 4QJ4B 2COFA 4K81A 4K2OA 3P6AA 1V5PA 3VIAA 2KIEA 4WVFB 3ULCA 4YONA 1P6SA 3HW2B 2YT0A 5JP4A 2RLOA 5DI9B 4ZRJA 4A6HA 2KGXB 4BBKA 1U29A 2J0MA 3HSAA 3OANA 3X23A 2Z13A 1WGUA 2QKMA 2EC1A 2DYQA 5D3XA 2CRFA 4HAXB 2IYBA 2W2XC 2KIGA 2D9XA 1BAKA 3U7DA 4F7HA 5D3WA 2Y7BA 1U5FA 3D8DA 4CHMA 3VOQA 3HQCA 1FHXA 2K2JA 3QBVB 4CSQA 2EJ8A 3BJIA 4GMVA 1DDWA 1X1FA 3U12A 2P8VA 1TJ6A 4A5KA 1T77A 1K5DB 2AEHA 3ULBA 1ZC4B 4GN1A 2J59M 5KQ1A 4L6EA 1RRPB 4P7IA 1IRSA 4HAYB 1WVHA 5I2MA 4ZRKA 2COCA 3HIEA 3GYOA 2FJUB 3PVUA 4GNKB 2RGNB 2ELBA 4Z2MB 2MKRA 3KZ1A 5D3YA 2DKPA 5D27A 3F0WA 1X1GA 5IRSA 5C16A 5HE0A 2ROZB 1XODA 1FB8A 3A58A 2DYNA 1XKEA 2DKQA 2KR0A 5CLQB 1EGXA 2D9YA 1LB1A 1P5TA 3PVWA 1DYNA 2QKLA 4D6WA 4PNKA 1I7AA 3KY9A 1AWEA 5JHGA 2FJLA 1W1DA 3FM8C 3UZTA 1TXDA 2D11A 3ODXA 1BTNA 1QC6A 1ZYIA 1Y19B 2GJYA 1P3RA 1V5UA 2RUKB 1MIZB 1NI2A 2M14A 3AU4A 2BCJA 2W2WA 4F7UP 1FGZA 1Q67A 1PFJA 4HB0B 1WJMA 5J3QA 5J3TA 2Z0QA 2NZ8B 2K8EA 2K00A 1EAZA 1FHWA 2N0YA 2Z14A 2X18A 1Y5OA 4HDQA 3FEHA 3P7ZA 4QXAB 5JLJB 1FGYA 2DFKA 3RCPA 1DDVA 1PMSA 1UEFA 5I2SA 1BWNA 1AQCA 2UZSA 1ZSQA 3ODWA 2DX5A 1UPQA 5LONB 2RVBB 2L1CA 5DH9B 1X86A 2LKOA 2M38A 3F5RA 1J19A 3PZDA 1V88A 4K2PA 1V61A 1MK7B 1EVHA 2G35A 1PLSA 4MY6A 2ZPYA 2D9ZA 4KHOA 2W2XD 2ELAA 3FSSA 4KAXB 1N3HA 2Z4DA 1U5GA 2Z0PA 1H10A 3SYXA 3A98B 1J0WA 2Z59A 1LW3A 1ZC3B 2LOZA 2RNRB 5HE1A 1MK9B 4QJ5B 1OQNA 2DX1A 3TVVA 2PZ1A 1MPHA 2R2YA 4B6HA 5C5BA 3O96A 5J3YA 2GCJA 4K17A 3CIKA 2LULA 4TKNA 1XD4A 2D9VA 5EFXA 4DX90 3AJ4A 4GXBA 4F7GA 3ZDTA 3QIJA 1NU2A 4EMOA 3NWFA 3SUZA 4DBBA 2UZRA 2CY5A 1SHCA 3ML4A 4OSNA 2H7EA 4HB4B 3LJUX 4A6FA 4QJ3B 2YS1A 1U5DA 2I1JA 5FI1A 1H4RA 5LOPB 1MAIA 4GPTB 2YT2A
chains in the Genus database with same CATH topology
3WYFB 3DXDA 5D3VA 1W1GA 2DTCA 3ODOA 3TW1A 1DDMA 2D9WA 1E5WA 4KHBB 2IFSA 2YF0A 1UNPA 2RSGA 5C5BB 2ROVA 2YT1A 3PSCA 3HK0A 4DXAB 3BINA 4IOYX 2MDXA 1WJ1A 2Q13A 2YS5A 3SNHA 5L81A 4Y94A 1M7EA 2NMBA 4HHVA 3PP2A 4MK0A 1BTKA 2N23A 2CODA 1B55A 2UVMA 4DX8A 1UNQA 1QQGA 4EJNA 2EMSA 4GMXB 2LOXA 4NSWA 3SV1A 2YS3A 1GG3A 1TQZA 2YSZA 5GOWB 4HAWB 2EMTA 2I1KA 5C6RA 2Y8FA 1FOEA 1X05A 3MDBC 1V89A 2COAA 1WGQA 3IVFA 3KRWA 1NTVA 1EF1A 4TYZA 2DHJA 5HE3A 1MIXA 3TCAA 3T06A 1ISNA 4XWXA 2P0HA 3TO1A 4KVGB 1FHOA 1NTYA 1OY2A 2R0DA 3G9WA 3DXCA 3QWMA 3A8PA 2K2UA 3D8FA 4CYEA 3M1IB 3DXEA 3A8QA 3GYPA 4CHJA 1ZM0A 2D10A 4HAUB 1OMWA 1RJ2A 2D4QA 1U2BA 4HAZB 3AU5A 3MPXA 5KQ4A 2KUPA 1MKEA 2ADZA 1DROA 2HTHB 1UNRA 4GZUA 2DHKA 4YL8A 1DBHA 1KZ7A 1I2HA 4HAVB 4MT7A 4HATB 5C79A 2OTXA 4WSFA 4C0AA 1KZGA 1ZVRA 5DHFB 2DHIA 5DIFB 4H8SA 2J0KA 2VRWB 1XR0B 3PG7A 1X11A 2MFQA 4EKUA 2MWNB 3TFMA 5JHHA 4IFSA 1GC6A 3NSUA 2LG1A 3WA0A 2R09A 1V5MA 2XQNM 2OQBA 3N7CA 1UPRA 3KRXA 5CLLB 3SO6A 1SGHA 2CY4A 4IAPA 4PQ0A 1XCGA 1W1HA 4NY0A 2I5FA 1FAOA 1M7RA 2Y8GA 1KI1B 5FI0A 1XX0A 2LYDA 2DA0A 5HE2A 1WG7A 2YRYA 4KHAA 2VKIA 3KSYA 5KCVA 2V76A 1U27A 2I5CA 4D0NB 1WI1A 3U8ZA 2JP2A 3CXBB 3V5WA 2D2QA 4HB3B 3PEGA 2L2IA 4A6KA 2AL6A 1K5GB 2GCLA 2H7DA 2HE7A 1Z87A 4HB2B 4ZRIA 2VSZA 2DLWA 3D8EA 3ZVRA 2P0DA 2J0JA 2DN6A 2CAYA 2E2XA 2KCJA 4Z2NA 4A6FB 2YVCA 4WJ7A 1U5EA 1GC7A 3PVLA 2P0FA 2GS0A 4HDOA 2Z0OA 5DHAB 2COFA 4K81A 4K2OA 3P6AA 1V5PA 3VIAA 4WVFB 3ULCA 4YONA 1P6SA 3HW2B 2YT0A 5JP4A 2RLOA 5DI9B 4ZRJA 4A6HA 2KGXB 4BBKA 1U29A 2J0MA 3OANA 3X23A 1WGUA 2QKMA 2EC1A 2DYQA 5D3XA 2CRFA 4HAXB 2IYBA 2W2XC 1BAKA 2D9XA 3U7DA 4F7HA 5D3WA 2Y7BA 1U5FA 3D8DA 4CHMA 3VOQA 3HQCA 1FHXA 2K2JA 3QBVB 2EJ8A 3BJIA 4GMVA 1DDWA 1X1FA 2P8VA 1TJ6A 4A5KA 1K5DB 2AEHA 3ULBA 1ZC4B 4GN1A 2J59M 5KQ1A 4L6EA 1RRPB 4P7IA 1IRSA 4HAYB 1WVHA 4ZRKA 2COCA 3PVUA 3GYOA 2RGNB 2ELBA 4Z2MB 2MKRA 3KZ1A 5D3YA 2DKPA 5D27A 3F0WA 1X1GA 5C16A 5HE0A 2ROZB 1XODA 1FB8A 2DYNA 1XKEA 2DKQA 5CLQB 1EGXA 2D9YA 1LB1A 1P5TA 3PVWA 1DYNA 2QKLA 4PNKA 1I7AA 3KY9A 1AWEA 5JHGA 2FJLA 1W1DA 3FM8C 3UZTA 1TXDA 2D11A 3ODXA 1BTNA 1QC6A 1Y19B 2GJYA 1P3RA 1V5UA 2RUKB 1MIZB 1NI2A 2M14A 3AU4A 2BCJA 2W2WA 4F7UP 1FGZA 1Q67A 1PFJA 4HB0B 1WJMA 5J3QA 5J3TA 2Z0QA 2NZ8B 2K00A 1EAZA 1FHWA 2N0YA 2X18A 1Y5OA 4HDQA 3FEHA 3P7ZA 5JLJB 1FGYA 2DFKA 3RCPA 1DDVA 1PMSA 1UEFA 1BWNA 1AQCA 2UZSA 1ZSQA 3ODWA 2DX5A 1UPQA 5LONB 2RVBB 2L1CA 5DH9B 1X86A 2LKOA 2M38A 3F5RA 1J19A 3PZDA 1V88A 4K2PA 1V61A 1MK7B 1EVHA 2G35A 1PLSA 4MY6A 2ZPYA 2D9ZA 4KHOA 2W2XD 2ELAA 3FSSA 4KAXB 1N3HA 1U5GA 2Z0PA 1H10A 3SYXA 3A98B 1J0WA 1LW3A 1ZC3B 2LOZA 2RNRB 5HE1A 1MK9B 1OQNA 2DX1A 3TVVA 2PZ1A 1MPHA 4B6HA 5C5BA 3O96A 5J3YA 2GCJA 4K17A 3CIKA 2LULA 4TKNA 1XD4A 2D9VA 5EFXA 4DX90 3AJ4A 4GXBA 4F7GA 3ZDTA 3QIJA 1NU2A 4EMOA 3SUZA 4DBBA 2UZRA 2CY5A 1SHCA 3ML4A 2H7EA 4HB4B 3LJUX 4A6FA 2YS1A 1U5DA 2I1JA 5FI1A 1H4RA 5LOPB 1MAIA 4GPTB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WYF B;  3DXD A;  5D3V A;  1W1G A;  2DTC A;  3ODO A;  3TW1 A;  1DDM A;  2D9W A;  1E5W A;  4KHB B;  2IFS A;  2YF0 A;  1UNP A;  2RSG A;  5C5B B;  2ROV A;  2YT1 A;  3PSC A;  3HK0 A;  4DXA B;  3BIN A;  4IOY X;  2MDX A;  1WJ1 A;  2Q13 A;  2YS5 A;  3SNH A;  5L81 A;  4Y94 A;  1M7E A;  2NMB A;  4HHV A;  3PP2 A;  4MK0 A;  1BTK A;  2N23 A;  2COD A;  1B55 A;  2UVM A;  4DX8 A;  1UNQ A;  1QQG A;  4EJN A;  2EMS A;  4GMX B;  2LOX A;  4NSW A;  3SV1 A;  2YS3 A;  1GG3 A;  1TQZ A;  2YSZ A;  5GOW B;  4HAW B;  2EMT A;  2I1K A;  5C6R A;  2Y8F A;  1FOE A;  1X05 A;  3MDB C;  1V89 A;  2COA A;  1WGQ A;  3IVF A;  3KRW A;  1NTV A;  1EF1 A;  4TYZ A;  2DHJ A;  5HE3 A;  1MIX A;  3TCA A;  3T06 A;  1ISN A;  4XWX A;  2P0H A;  3TO1 A;  4KVG B;  1FHO A;  1NTY A;  1OY2 A;  2R0D A;  3G9W A;  3DXC A;  3QWM A;  3A8P A;  2K2U A;  3D8F A;  4CYE A;  3M1I B;  3DXE A;  3A8Q A;  3GYP A;  4CHJ A;  1ZM0 A;  2D10 A;  4HAU B;  1OMW A;  1RJ2 A;  2D4Q A;  1U2B A;  4HAZ B;  3AU5 A;  3MPX A;  5KQ4 A;  2KUP A;  1MKE A;  2ADZ A;  1DRO A;  2HTH B;  1UNR A;  4GZU A;  2DHK A;  4YL8 A;  1DBH A;  1KZ7 A;  1I2H A;  4HAV B;  4MT7 A;  4HAT B;  5C79 A;  2OTX A;  4WSF A;  4C0A A;  1KZG A;  1ZVR A;  5DHF B;  2DHI A;  5DIF B;  4H8S A;  2J0K A;  2VRW B;  1XR0 B;  3PG7 A;  1X11 A;  2MFQ A;  4EKU A;  2MWN B;  3TFM A;  5JHH A;  4IFS A;  1GC6 A;  3NSU A;  2LG1 A;  3WA0 A;  2R09 A;  1V5M A;  2XQN M;  2OQB A;  3N7C A;  1UPR A;  3KRX A;  5CLL B;  3SO6 A;  1SGH A;  2CY4 A;  4IAP A;  4PQ0 A;  1XCG A;  1W1H A;  4NY0 A;  2I5F A;  1FAO A;  1M7R A;  2Y8G A;  1KI1 B;  5FI0 A;  1XX0 A;  2LYD A;  2DA0 A;  5HE2 A;  1WG7 A;  2YRY A;  4KHA A;  2VKI A;  3KSY A;  5KCV A;  2V76 A;  1U27 A;  2I5C A;  4D0N B;  1WI1 A;  3U8Z A;  2JP2 A;  3CXB B;  3V5W A;  2D2Q A;  4HB3 B;  3PEG A;  2L2I A;  4A6K A;  2AL6 A;  1K5G B;  2GCL A;  2H7D A;  2HE7 A;  1Z87 A;  4HB2 B;  4ZRI A;  2VSZ A;  2DLW A;  3D8E A;  3ZVR A;  2P0D A;  2J0J A;  2DN6 A;  2CAY A;  2E2X A;  2KCJ A;  4Z2N A;  4A6F B;  2YVC A;  4WJ7 A;  1U5E A;  1GC7 A;  3PVL A;  2P0F A;  2GS0 A;  4HDO A;  2Z0O A;  5DHA B;  2COF A;  4K81 A;  4K2O A;  3P6A A;  1V5P A;  3VIA A;  4WVF B;  3ULC A;  4YON A;  1P6S A;  3HW2 B;  2YT0 A;  5JP4 A;  2RLO A;  5DI9 B;  4ZRJ A;  4A6H A;  2KGX B;  4BBK A;  1U29 A;  2J0M A;  3OAN A;  3X23 A;  1WGU A;  2QKM A;  2EC1 A;  2DYQ A;  5D3X A;  2CRF A;  4HAX B;  2IYB A;  2W2X C;  1BAK A;  2D9X A;  3U7D A;  4F7H A;  5D3W A;  2Y7B A;  1U5F A;  3D8D A;  4CHM A;  3VOQ A;  3HQC A;  1FHX A;  2K2J A;  3QBV B;  2EJ8 A;  3BJI A;  4GMV A;  1DDW A;  1X1F A;  2P8V A;  1TJ6 A;  4A5K A;  1K5D B;  2AEH A;  3ULB A;  1ZC4 B;  4GN1 A;  2J59 M;  5KQ1 A;  4L6E A;  1RRP B;  4P7I A;  1IRS A;  4HAY B;  1WVH A;  4ZRK A;  2COC A;  3PVU A;  3GYO A;  2RGN B;  2ELB A;  4Z2M B;  2MKR A;  3KZ1 A;  5D3Y A;  2DKP A;  5D27 A;  3F0W A;  1X1G A;  5C16 A;  5HE0 A;  2ROZ B;  1XOD A;  1FB8 A;  2DYN A;  1XKE A;  2DKQ A;  5CLQ B;  1EGX A;  2D9Y A;  1LB1 A;  1P5T A;  3PVW A;  1DYN A;  2QKL A;  4PNK A;  1I7A A;  3KY9 A;  1AWE A;  5JHG A;  2FJL A;  1W1D A;  3FM8 C;  3UZT A;  1TXD A;  2D11 A;  3ODX A;  1BTN A;  1QC6 A;  1Y19 B;  2GJY A;  1P3R A;  1V5U A;  2RUK B;  1MIZ B;  1NI2 A;  2M14 A;  3AU4 A;  2BCJ A;  2W2W A;  4F7U P;  1FGZ A;  1Q67 A;  1PFJ A;  4HB0 B;  1WJM A;  5J3Q A;  5J3T A;  2Z0Q A;  2NZ8 B;  2K00 A;  1EAZ A;  1FHW A;  2N0Y A;  2X18 A;  1Y5O A;  4HDQ A;  3FEH A;  3P7Z A;  5JLJ B;  1FGY A;  2DFK A;  3RCP A;  1DDV A;  1PMS A;  1UEF A;  1BWN A;  1AQC A;  2UZS A;  1ZSQ A;  3ODW A;  2DX5 A;  1UPQ A;  5LON B;  2RVB B;  2L1C A;  5DH9 B;  1X86 A;  2LKO A;  2M38 A;  3F5R A;  1J19 A;  3PZD A;  1V88 A;  4K2P A;  1V61 A;  1MK7 B;  1EVH A;  2G35 A;  1PLS A;  4MY6 A;  2ZPY A;  2D9Z A;  4KHO A;  2W2X D;  2ELA A;  3FSS A;  4KAX B;  1N3H A;  1U5G A;  2Z0P A;  1H10 A;  3SYX A;  3A98 B;  1J0W A;  1LW3 A;  1ZC3 B;  2LOZ A;  2RNR B;  5HE1 A;  1MK9 B;  1OQN A;  2DX1 A;  3TVV A;  2PZ1 A;  1MPH A;  4B6H A;  5C5B A;  3O96 A;  5J3Y A;  2GCJ A;  4K17 A;  3CIK A;  2LUL A;  4TKN A;  1XD4 A;  2D9V A;  5EFX A;  4DX9 0;  3AJ4 A;  4GXB A;  4F7G A;  3ZDT A;  3QIJ A;  1NU2 A;  4EMO A;  3SUZ A;  4DBB A;  2UZR A;  2CY5 A;  1SHC A;  3ML4 A;  2H7E A;  4HB4 B;  3LJU X;  4A6F A;  2YS1 A;  1U5D A;  2I1J A;  5FI1 A;  1H4R A;  5LOP B;  1MAI A;  4GPT B; 
#chains in the Genus database with same CATH topology
 3WYF B;  3DXD A;  3OHM B;  5D3V A;  1W1G A;  2DTC A;  3ODO A;  3TW1 A;  1DDM A;  1MI1 A;  2D9W A;  1E5W A;  4KHB B;  2IFS A;  2YF0 A;  1UNP A;  2RSG A;  5C5B B;  2ROV A;  2YT1 A;  3PSC A;  3HK0 A;  4KHB A;  4DXA B;  3BIN A;  4IOY X;  2MDX A;  1WJ1 A;  2Q13 A;  2YS5 A;  3SNH A;  5L81 A;  3B77 A;  4Y94 A;  1M7E A;  2NMB A;  2RRF A;  4HHV A;  3PP2 A;  2GUM A;  1BTK A;  2N23 A;  2COD A;  4MK0 A;  1B55 A;  2UVM A;  4DX8 A;  1UNQ A;  1QQG A;  2KUQ A;  4EJN A;  2EMS A;  4GMX B;  2LOX A;  4NSW A;  3SV1 A;  2YS3 A;  1GG3 A;  4DIX A;  1TQZ A;  2YSZ A;  5GOW B;  4HAW B;  2EMT A;  2I1K A;  5C6R A;  2Y8F A;  1FOE A;  1X05 A;  3MDB C;  1V89 A;  2COA A;  1WGQ A;  3IVF A;  3KRW A;  1NTV A;  1EF1 A;  4TYZ A;  2DHJ A;  5HE3 A;  1MIX A;  3TCA A;  3NWD A;  3T06 A;  1ISN A;  4XWX A;  2P0H A;  3TO1 A;  4KVG B;  4L1R A;  1FHO A;  1NTY A;  1OY2 A;  2R0D A;  3G9W A;  3DXC A;  3QWM A;  3FVC A;  3A8P A;  2K2U A;  3D8F A;  4CYE A;  3M1I B;  3DXE A;  3A8Q A;  3GYP A;  4CHJ A;  1ZM0 A;  2D10 A;  4HAU B;  1OMW A;  1RJ2 A;  2D4Q A;  1U2B A;  4HAZ B;  3AU5 A;  3MPX A;  5KQ4 A;  2KUP A;  1MKE A;  3NWA A;  2ADZ A;  1DRO A;  2HTH B;  1UNR A;  4GZU A;  2DHK A;  4YL8 A;  1DBH A;  1KZ7 A;  1I2H A;  4HAV B;  4MT7 A;  4HAT B;  5C79 A;  2OTX A;  4WSF A;  4C0A A;  2NBV A;  1KZG A;  1ZVR A;  5DHF B;  5M4Y B;  2DHI A;  4OT1 A;  5DIF B;  4H8S A;  2J0K A;  2VRW B;  1XR0 B;  3PG7 A;  1X11 A;  2MFQ A;  4EKU A;  3NW8 A;  2MWN B;  3TFM A;  5JHH A;  4IFS A;  1GC6 A;  3NSU A;  2LG1 A;  3WA0 A;  2R09 A;  1V5M A;  2XQN M;  2OQB A;  3DCX A;  3N7C A;  2K49 A;  1UPR A;  3KRX A;  5CLL B;  3SO6 A;  1SGH A;  2CY4 A;  2ZKM X;  4IAP A;  4PQ0 A;  1XCG A;  1W1H A;  4NY0 A;  2I5F A;  1FAO A;  1M7R A;  2Y8G A;  1KI1 B;  5FI0 A;  1XX0 A;  2LYD A;  2DA0 A;  5HE2 A;  1WG7 A;  2YRY A;  4KHA A;  2VKI A;  3KSY A;  5KCV A;  2V76 A;  1U27 A;  2I5C A;  4D0N B;  1WI1 A;  5LG4 B;  3U8Z A;  2JP2 A;  3CXB B;  3V5W A;  2D2Q A;  3PEG A;  2L2I A;  4HB3 B;  4HSI A;  4A6K A;  2AL6 A;  1K5G B;  2GCL A;  2H7D A;  2HE7 A;  1Z87 A;  4HB2 B;  4ZRI A;  2VSZ A;  2DLW A;  3D8E A;  4GOU A;  3ZVR A;  2P0D A;  2J0J A;  2DN6 A;  2CAY A;  2E2X A;  2KCJ A;  4Z2N A;  4A6F B;  2YVC A;  4WJ7 A;  1U5E A;  1GC7 A;  3PVL A;  2P0F A;  2GS0 A;  4HDO A;  2Z0O A;  5DHA B;  4QJ4 B;  2COF A;  4K81 A;  4K2O A;  3P6A A;  1V5P A;  3VIA A;  2KIE A;  4WVF B;  3ULC A;  4YON A;  1P6S A;  3HW2 B;  2YT0 A;  5JP4 A;  2RLO A;  5DI9 B;  4ZRJ A;  4A6H A;  2KGX B;  4BBK A;  1U29 A;  2J0M A;  3HSA A;  3OAN A;  3X23 A;  2Z13 A;  1WGU A;  2QKM A;  2EC1 A;  2DYQ A;  5D3X A;  2CRF A;  4HAX B;  2IYB A;  2W2X C;  2KIG A;  2D9X A;  1BAK A;  3U7D A;  4F7H A;  5D3W A;  2Y7B A;  1U5F A;  3D8D A;  4CHM A;  3VOQ A;  3HQC A;  1FHX A;  2K2J A;  3QBV B;  4CSQ A;  2EJ8 A;  3BJI A;  4GMV A;  1DDW A;  1X1F A;  3U12 A;  2P8V A;  1TJ6 A;  4A5K A;  1T77 A;  1K5D B;  2AEH A;  3ULB A;  1ZC4 B;  4GN1 A;  2J59 M;  5KQ1 A;  4L6E A;  1RRP B;  4P7I A;  1IRS A;  4HAY B;  1WVH A;  5I2M A;  4ZRK A;  2COC A;  3HIE A;  3GYO A;  2FJU B;  3PVU A;  4GNK B;  2RGN B;  2ELB A;  4Z2M B;  2MKR A;  3KZ1 A;  5D3Y A;  2DKP A;  5D27 A;  3F0W A;  1X1G A;  5IRS A;  5C16 A;  5HE0 A;  2ROZ B;  1XOD A;  1FB8 A;  3A58 A;  2DYN A;  1XKE A;  2DKQ A;  2KR0 A;  5CLQ B;  1EGX A;  2D9Y A;  1LB1 A;  1P5T A;  3PVW A;  1DYN A;  2QKL A;  4D6W A;  4PNK A;  1I7A A;  3KY9 A;  1AWE A;  5JHG A;  2FJL A;  1W1D A;  3FM8 C;  3UZT A;  1TXD A;  2D11 A;  3ODX A;  1BTN A;  1QC6 A;  1ZYI A;  1Y19 B;  2GJY A;  1P3R A;  1V5U A;  2RUK B;  1MIZ B;  1NI2 A;  2M14 A;  3AU4 A;  2BCJ A;  2W2W A;  4F7U P;  1FGZ A;  1Q67 A;  1PFJ A;  4HB0 B;  1WJM A;  5J3Q A;  5J3T A;  2Z0Q A;  2NZ8 B;  2K8E A;  2K00 A;  1EAZ A;  1FHW A;  2N0Y A;  2Z14 A;  2X18 A;  1Y5O A;  4HDQ A;  3FEH A;  3P7Z A;  4QXA B;  5JLJ B;  1FGY A;  2DFK A;  3RCP A;  1DDV A;  1PMS A;  1UEF A;  5I2S A;  1BWN A;  1AQC A;  2UZS A;  1ZSQ A;  3ODW A;  2DX5 A;  1UPQ A;  5LON B;  2RVB B;  2L1C A;  5DH9 B;  1X86 A;  2LKO A;  2M38 A;  3F5R A;  1J19 A;  3PZD A;  1V88 A;  4K2P A;  1V61 A;  1MK7 B;  1EVH A;  2G35 A;  1PLS A;  4MY6 A;  2ZPY A;  2D9Z A;  4KHO A;  2W2X D;  2ELA A;  3FSS A;  4KAX B;  1N3H A;  2Z4D A;  1U5G A;  2Z0P A;  1H10 A;  3SYX A;  3A98 B;  1J0W A;  2Z59 A;  1LW3 A;  1ZC3 B;  2LOZ A;  2RNR B;  5HE1 A;  1MK9 B;  4QJ5 B;  1OQN A;  2DX1 A;  3TVV A;  2PZ1 A;  1MPH A;  2R2Y A;  4B6H A;  5C5B A;  3O96 A;  5J3Y A;  2GCJ A;  4K17 A;  3CIK A;  2LUL A;  4TKN A;  1XD4 A;  2D9V A;  5EFX A;  4DX9 0;  3AJ4 A;  4GXB A;  4F7G A;  3ZDT A;  3QIJ A;  1NU2 A;  4EMO A;  3NWF A;  3SUZ A;  4DBB A;  2UZR A;  2CY5 A;  1SHC A;  3ML4 A;  4OSN A;  2H7E A;  4HB4 B;  3LJU X;  4A6F A;  4QJ3 B;  2YS1 A;  1U5D A;  2I1J A;  5FI1 A;  1H4R A;  5LOP B;  1MAI A;  4GPT B;  2YT2 A; 
#chains in the Genus database with same CATH homology
 3WYF B;  3DXD A;  5D3V A;  1W1G A;  2DTC A;  3ODO A;  3TW1 A;  1DDM A;  2D9W A;  1E5W A;  4KHB B;  2IFS A;  2YF0 A;  1UNP A;  2RSG A;  5C5B B;  2ROV A;  2YT1 A;  3PSC A;  3HK0 A;  4DXA B;  3BIN A;  4IOY X;  2MDX A;  1WJ1 A;  2Q13 A;  2YS5 A;  3SNH A;  5L81 A;  4Y94 A;  1M7E A;  2NMB A;  4HHV A;  3PP2 A;  4MK0 A;  1BTK A;  2N23 A;  2COD A;  1B55 A;  2UVM A;  4DX8 A;  1UNQ A;  1QQG A;  4EJN A;  2EMS A;  4GMX B;  2LOX A;  4NSW A;  3SV1 A;  2YS3 A;  1GG3 A;  1TQZ A;  2YSZ A;  5GOW B;  4HAW B;  2EMT A;  2I1K A;  5C6R A;  2Y8F A;  1FOE A;  1X05 A;  3MDB C;  1V89 A;  2COA A;  1WGQ A;  3IVF A;  3KRW A;  1NTV A;  1EF1 A;  4TYZ A;  2DHJ A;  5HE3 A;  1MIX A;  3TCA A;  3T06 A;  1ISN A;  4XWX A;  2P0H A;  3TO1 A;  4KVG B;  1FHO A;  1NTY A;  1OY2 A;  2R0D A;  3G9W A;  3DXC A;  3QWM A;  3A8P A;  2K2U A;  3D8F A;  4CYE A;  3M1I B;  3DXE A;  3A8Q A;  3GYP A;  4CHJ A;  1ZM0 A;  2D10 A;  4HAU B;  1OMW A;  1RJ2 A;  2D4Q A;  1U2B A;  4HAZ B;  3AU5 A;  3MPX A;  5KQ4 A;  2KUP A;  1MKE A;  2ADZ A;  1DRO A;  2HTH B;  1UNR A;  4GZU A;  2DHK A;  4YL8 A;  1DBH A;  1KZ7 A;  1I2H A;  4HAV B;  4MT7 A;  4HAT B;  5C79 A;  2OTX A;  4WSF A;  4C0A A;  1KZG A;  1ZVR A;  5DHF B;  2DHI A;  5DIF B;  4H8S A;  2J0K A;  2VRW B;  1XR0 B;  3PG7 A;  1X11 A;  2MFQ A;  4EKU A;  2MWN B;  3TFM A;  5JHH A;  4IFS A;  1GC6 A;  3NSU A;  2LG1 A;  3WA0 A;  2R09 A;  1V5M A;  2XQN M;  2OQB A;  3N7C A;  1UPR A;  3KRX A;  5CLL B;  3SO6 A;  1SGH A;  2CY4 A;  4IAP A;  4PQ0 A;  1XCG A;  1W1H A;  4NY0 A;  2I5F A;  1FAO A;  1M7R A;  2Y8G A;  1KI1 B;  5FI0 A;  1XX0 A;  2LYD A;  2DA0 A;  5HE2 A;  1WG7 A;  2YRY A;  4KHA A;  2VKI A;  3KSY A;  5KCV A;  2V76 A;  1U27 A;  2I5C A;  4D0N B;  1WI1 A;  3U8Z A;  2JP2 A;  3CXB B;  3V5W A;  2D2Q A;  4HB3 B;  3PEG A;  2L2I A;  4A6K A;  2AL6 A;  1K5G B;  2GCL A;  2H7D A;  2HE7 A;  1Z87 A;  4HB2 B;  4ZRI A;  2VSZ A;  2DLW A;  3D8E A;  3ZVR A;  2P0D A;  2J0J A;  2DN6 A;  2CAY A;  2E2X A;  2KCJ A;  4Z2N A;  4A6F B;  2YVC A;  4WJ7 A;  1U5E A;  1GC7 A;  3PVL A;  2P0F A;  2GS0 A;  4HDO A;  2Z0O A;  5DHA B;  2COF A;  4K81 A;  4K2O A;  3P6A A;  1V5P A;  3VIA A;  4WVF B;  3ULC A;  4YON A;  1P6S A;  3HW2 B;  2YT0 A;  5JP4 A;  2RLO A;  5DI9 B;  4ZRJ A;  4A6H A;  2KGX B;  4BBK A;  1U29 A;  2J0M A;  3OAN A;  3X23 A;  1WGU A;  2QKM A;  2EC1 A;  2DYQ A;  5D3X A;  2CRF A;  4HAX B;  2IYB A;  2W2X C;  1BAK A;  2D9X A;  3U7D A;  4F7H A;  5D3W A;  2Y7B A;  1U5F A;  3D8D A;  4CHM A;  3VOQ A;  3HQC A;  1FHX A;  2K2J A;  3QBV B;  2EJ8 A;  3BJI A;  4GMV A;  1DDW A;  1X1F A;  2P8V A;  1TJ6 A;  4A5K A;  1K5D B;  2AEH A;  3ULB A;  1ZC4 B;  4GN1 A;  2J59 M;  5KQ1 A;  4L6E A;  1RRP B;  4P7I A;  1IRS A;  4HAY B;  1WVH A;  4ZRK A;  2COC A;  3PVU A;  3GYO A;  2RGN B;  2ELB A;  4Z2M B;  2MKR A;  3KZ1 A;  5D3Y A;  2DKP A;  5D27 A;  3F0W A;  1X1G A;  5C16 A;  5HE0 A;  2ROZ B;  1XOD A;  1FB8 A;  2DYN A;  1XKE A;  2DKQ A;  5CLQ B;  1EGX A;  2D9Y A;  1LB1 A;  1P5T A;  3PVW A;  1DYN A;  2QKL A;  4PNK A;  1I7A A;  3KY9 A;  1AWE A;  5JHG A;  2FJL A;  1W1D A;  3FM8 C;  3UZT A;  1TXD A;  2D11 A;  3ODX A;  1BTN A;  1QC6 A;  1Y19 B;  2GJY A;  1P3R A;  1V5U A;  2RUK B;  1MIZ B;  1NI2 A;  2M14 A;  3AU4 A;  2BCJ A;  2W2W A;  4F7U P;  1FGZ A;  1Q67 A;  1PFJ A;  4HB0 B;  1WJM A;  5J3Q A;  5J3T A;  2Z0Q A;  2NZ8 B;  2K00 A;  1EAZ A;  1FHW A;  2N0Y A;  2X18 A;  1Y5O A;  4HDQ A;  3FEH A;  3P7Z A;  5JLJ B;  1FGY A;  2DFK A;  3RCP A;  1DDV A;  1PMS A;  1UEF A;  1BWN A;  1AQC A;  2UZS A;  1ZSQ A;  3ODW A;  2DX5 A;  1UPQ A;  5LON B;  2RVB B;  2L1C A;  5DH9 B;  1X86 A;  2LKO A;  2M38 A;  3F5R A;  1J19 A;  3PZD A;  1V88 A;  4K2P A;  1V61 A;  1MK7 B;  1EVH A;  2G35 A;  1PLS A;  4MY6 A;  2ZPY A;  2D9Z A;  4KHO A;  2W2X D;  2ELA A;  3FSS A;  4KAX B;  1N3H A;  1U5G A;  2Z0P A;  1H10 A;  3SYX A;  3A98 B;  1J0W A;  1LW3 A;  1ZC3 B;  2LOZ A;  2RNR B;  5HE1 A;  1MK9 B;  1OQN A;  2DX1 A;  3TVV A;  2PZ1 A;  1MPH A;  4B6H A;  5C5B A;  3O96 A;  5J3Y A;  2GCJ A;  4K17 A;  3CIK A;  2LUL A;  4TKN A;  1XD4 A;  2D9V A;  5EFX A;  4DX9 0;  3AJ4 A;  4GXB A;  4F7G A;  3ZDT A;  3QIJ A;  1NU2 A;  4EMO A;  3SUZ A;  4DBB A;  2UZR A;  2CY5 A;  1SHC A;  3ML4 A;  2H7E A;  4HB4 B;  3LJU X;  4A6F A;  2YS1 A;  1U5D A;  2I1J A;  5FI1 A;  1H4R A;  5LOP B;  1MAI A;  4GPT B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...