2CY4A

Crystal structure of phosphotyrosine binding (ptb) domain of epidermal growth factor receptor pathway substrate-8 (eps8) related protein 1 from mus musculus (form-1 crystal)
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
129
structure length
129
Chain Sequence
ADVSQYHVNHLVTFCLGEEDGVHTVEDASRKLAVMDSQGRVWAQEMLLRVSPSQVTLLDPVSKEELESYPLDAIVRCDAVMPRGRSRSLLLLVCQEPERAQPDVHFFQGLLLGAELIREDIQGALQNYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of phosphotyrosine binding (PTB) domain of epidermal growth factor receptor pathway substrate-8 (EPS8) related protein 1 from Mus musculus (form-1 crystal)
rcsb
molecule keywords epidermal growth factor receptor pathway substrate 8-like pr
molecule tags Signaling protein
source organism Mus musculus
total genus 27
structure length 129
sequence length 129
ec nomenclature
pdb deposition date 2005-07-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08416 PTB Phosphotyrosine-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2cy4A00
5D3XA 1WG7A 2R09A 2LOZA 1IRSA 1KI1B 3HW2B 1M7EA 1LB1A 2I1KA 3PVLA 2CY4A 3D8FA 5D27A 5DI9B 5KQ1A 4YONA 5CLLB 4ZRKA 2I5FA 1XX0A 3G9WA 5HE0A 2Z0OA 2YS3A 1MKEA 3F5RA 3UZTA 4B6HA 1W1HA 5HE2A 4C0AA 2GCLA 1X1FA 1XODA 2DA0A 1N3HA 2RLOA 1AQCA 4F7HA 3F0WA 3TCAA 3PEGA 2YVCA 4EKUA 3ODOA 2H7EA 3PZDA 2HTHB 1DDVA 2Y7BA 2RVBB 4A6FB 3D8DA 1FB8A 4HB2B 1ZM0A 5HE1A 2FJLA 1FHXA 1QQGA 1RRPB 2ADZA 2K00A 2W2XC 4TKNA 1X86A 2IYBA 3TO1A 3LJUX 3GYOA 4MT7A 1KZGA 2ELBA 1WI1A 1OY2A 2D9XA 1U5FA 1P3RA 2DKQA 3QIJA 4WJ7A 5CLQB 2Y8GA 3V5WA 3CIKA 1Z87A 5GOWB 2KGXB 2L2IA 1FOEA 1Y19B 1U5GA 3P6AA 1BWNA 5EFXA 2XQNM 1P6SA 2D4QA 4HAWB 1AWEA 1K5DB 1GC7A 2N23A 1UPQA 1X11A 3QWMA 5JHHA 2ELAA 2GJYA 4KHOA 2UVMA 4H8SA 3HK0A 1U29A 1U5DA 4CHMA 2Z0QA 4ZRJA 4PNKA 1H4RA 2Y8FA 1TQZA 1ZSQA 4IFSA 4TYZA 2HE7A 2K2JA 1EGXA 1FAOA 1E5WA 2P8VA 3FM8C 5DHFB 3PVUA 4GN1A 3WYFB 3ZVRA 3AJ4A 2RSGA 1ISNA 4HAYB 3PG7A 1DBHA 2EJ8A 1V88A 1UNPA 5D3YA 3ZDTA 1J0WA 2D9WA 5D3VA 3VIAA 2UZSA 1PMSA 2EC1A 2D9YA 2JP2A 4GMXB 1SGHA 2E2XA 3SUZA 4IOYX 1ZVRA 5HE3A 4HAXB 2DHJA 4NY0A 2EMTA 2P0FA 2BCJA 5FI0A 1NTYA 3ODWA 1WGQA 2VSZA 2ZPYA 2W2XD 5C5BA 2YRYA 4HAUB 3MPXA 5J3YA 1BTNA 2AL6A 2DHKA 1TXDA 4GXBA 3GYPA 2COCA 2YF0A 3DXCA 2M38A 2RNRB 3PSCA 1U5EA 2QKLA 2VKIA 3A8QA 3BINA 4K2PA 3X23A 1V89A 1XD4A 3SYXA 4MK0A 2DX5A 2RUKB 2X18A 2GCJA 2J0KA 4KVGB 1DROA 3IVFA 2YS5A 1UNRA 1FGZA 2ROVA 4GPTB 2DLWA 1WVHA 3O96A 4DX8A 4PQ0A 2D10A 2AEHA 4CHJA 1V61A 1ZC4B 3KRWA 1BTKA 2IFSA 1Q67A 5DH9B 1LW3A 3NSUA 2NZ8B 5FI1A 1PFJA 2LOXA 1U2BA 5C5BB 2DN6A 3KSYA 3U7DA 1EVHA 4BBKA 1FHWA 2D9VA 2I1JA 3PVWA 4K17A 4A6HA 5DHAB 1B55A 2EMSA 3MDBC 4HDQA 5DIFB 4EJNA 4YL8A 2W2WA 2J0MA 3PP2A 1WGUA 1XCGA 1MIXA 1UPRA 5JP4A 1Y5OA 2MDXA 4HB3B 3TW1A 4WSFA 3A98B 2H7DA 2QKMA 3TVVA 4KHBB 4EMOA 2YS1A 3QBVB 3RCPA 3DXEA 2D2QA 3AU4A 3A8PA 5J3TA 2J0JA 4A5KA 3KY9A 1J19A 4CYEA 1FHOA 4KHAA 3ML4A 2KCJA 1I2HA 2YT1A 2P0DA 1XR0B 2D9ZA 3FEHA 2YSZA 5L81A 2VRWB 2GS0A 3D8EA 4L6EA 2UZRA 3HQCA 1RJ2A 3N7CA 1W1DA 4F7GA 4HATB 3BJIA 1W1GA 2DYNA 2OTXA 4HB4B 3SO6A 4DXAB 2RGNB 4Z2NA 1MPHA 5KCVA 1UEFA 4KAXB 5C79A 4Z2MB 4HAVB 2Q13A 4D0NB 4P7IA 4HB0B 1X1GA 1WJMA 2PZ1A 3ULCA 2MKRA 1H10A 3M1IB 1KZ7A 2CAYA 2L1CA 1NU2A 3FSSA 4IAPA 1UNQA 2COFA 1MK9B 1DDMA 1WJ1A 1PLSA 3ULBA 1V5UA 4GMVA 5C6RA 2CRFA 2DTCA 2DHIA 1U27A 4K81A 5D3WA 1TJ6A 1ZC3B 2NMBA 3TFMA 2MWNB 1NTVA 4HHVA 2DFKA 2R0DA 2K2UA 2M14A 3OANA 4Y94A 2DKPA 2ROZB 2LG1A 1M7RA 4HDOA 1OMWA 1BAKA 1DDWA 1V5PA 2COAA 4A6KA 1X05A 1MK7B 4WVFB 2V76A 3AU5A 2KUPA 1NI2A 4DX90 3KRXA 1SHCA 3ODXA 4NSWA 4HAZB 2CODA 2P0HA 3T06A 1GC6A 2N0YA 4XWXA 2MFQA 3DXDA 2DX1A 3P7ZA 2DYQA 2OQBA 4MY6A 3CXBB 5J3QA 3KZ1A 1XKEA 4GZUA 1GG3A 3WA0A 1MAIA 1OQNA 1V5MA 4K2OA 3U8ZA 5JHGA 4A6FA 5JLJB 5C16A 1K5GB 1FGYA 2Z0PA 2D11A 2YT0A 1I7AA 4ZRIA 2LYDA 3SNHA 4F7UP 5LOPB 2CY5A 1EAZA 1MIZB 2J59M 1QC6A 5LONB 2LULA 3VOQA 3SV1A 4DBBA 1EF1A 1P5TA 2I5CA 2LKOA 1DYNA 2G35A 5KQ4A
chains in the Genus database with same CATH superfamily
5D3XA 1WG7A 2R09A 2KUQA 2LOZA 1IRSA 1KI1B 3HW2B 1M7EA 1LB1A 2I1KA 3PVLA 2CY4A 3D8FA 5D27A 5DI9B 5KQ1A 4QXAB 4YONA 5CLLB 4ZRKA 2I5FA 1XX0A 3G9WA 5HE0A 2Z0OA 2YS3A 1MKEA 3F5RA 3DCXA 3UZTA 2R2YA 2K49A 4B6HA 1W1HA 5HE2A 4C0AA 2GCLA 1X1FA 1XODA 2DA0A 1N3HA 2RLOA 2FJUB 1AQCA 4F7HA 3F0WA 3TCAA 4QJ4B 3PEGA 2YVCA 2RRFA 4EKUA 3ODOA 2H7EA 3PZDA 2HTHB 1DDVA 2Y7BA 2KIGA 2RVBB 4A6FB 3D8DA 1FB8A 4HB2B 1ZM0A 5HE1A 4QJ3B 2FJLA 1FHXA 1QQGA 1RRPB 2ADZA 2K00A 2W2XC 4TKNA 1X86A 2IYBA 3TO1A 3LJUX 3GYOA 4MT7A 1KZGA 2ELBA 1WI1A 1OY2A 2D9XA 2KIEA 1U5FA 1P3RA 2DKQA 3QIJA 4WJ7A 5CLQB 2Y8GA 3V5WA 3CIKA 1Z87A 5GOWB 2KGXB 2L2IA 1FOEA 1Y19B 1U5GA 3P6AA 1BWNA 5EFXA 2XQNM 1P6SA 2D4QA 3HIEA 4HAWB 1AWEA 1K5DB 1GC7A 2N23A 1UPQA 1X11A 3QWMA 5JHHA 2ELAA 2GJYA 4KHOA 2UVMA 4H8SA 3HK0A 1U29A 1U5DA 4CHMA 2Z0QA 4ZRJA 4PNKA 5LG4B 1H4RA 2Y8FA 1TQZA 1ZSQA 4IFSA 4TYZA 2HE7A 2K2JA 1EGXA 1FAOA 1E5WA 2P8VA 2YT2A 3FM8C 5DHFB 4L1RA 3PVUA 4GN1A 3WYFB 3ZVRA 3AJ4A 2RSGA 1ISNA 4QJ5B 4HAYB 3PG7A 1DBHA 2EJ8A 1V88A 1UNPA 5D3YA 3ZDTA 1J0WA 2D9WA 5D3VA 3VIAA 2UZSA 1PMSA 2EC1A 2D9YA 2JP2A 4GMXB 1SGHA 3NWDA 2E2XA 2Z13A 3SUZA 4IOYX 1ZVRA 5HE3A 4HAXB 2DHJA 4NY0A 2EMTA 2P0FA 2BCJA 5FI0A 1NTYA 3ODWA 1WGQA 2VSZA 2ZPYA 2W2XD 5C5BA 2YRYA 4HAUB 1MI1A 3MPXA 5J3YA 1BTNA 2AL6A 2DHKA 1TXDA 5I2SA 4GXBA 3GYPA 4CSQA 2COCA 2YF0A 3DXCA 2M38A 2RNRB 5M4YB 1ZYIA 3PSCA 1U5EA 2QKLA 2VKIA 3A8QA 3BINA 4K2PA 3X23A 1V89A 1XD4A 3SYXA 4MK0A 3A58A 2DX5A 2RUKB 2X18A 2GCJA 2KR0A 2J0KA 4KVGB 1DROA 3IVFA 2YS5A 1UNRA 1FGZA 2ROVA 4GPTB 4KHBA 2DLWA 1WVHA 3O96A 4DX8A 4PQ0A 2D10A 2AEHA 4CHJA 1V61A 1ZC4B 3KRWA 1BTKA 2IFSA 1Q67A 3OHMB 5DH9B 1LW3A 5IRSA 3NSUA 2NZ8B 5FI1A 1PFJA 2LOXA 1U2BA 5C5BB 2DN6A 3KSYA 3U7DA 1EVHA 4BBKA 1FHWA 2D9VA 2I1JA 3PVWA 4K17A 4A6HA 5DHAB 1B55A 2EMSA 3MDBC 4HDQA 5DIFB 4EJNA 3NWFA 4YL8A 4D6WA 2W2WA 2J0MA 3PP2A 1WGUA 2Z14A 1XCGA 1MIXA 1UPRA 5JP4A 1Y5OA 2MDXA 4HB3B 3TW1A 4WSFA 3A98B 3NW8A 2H7DA 2QKMA 2GUMA 3TVVA 4KHBB 4EMOA 2YS1A 3QBVB 3RCPA 3DXEA 2D2QA 3AU4A 3A8PA 5J3TA 2J0JA 2Z59A 4A5KA 3KY9A 1J19A 4CYEA 1FHOA 4KHAA 3ML4A 2KCJA 1I2HA 2YT1A 2P0DA 1XR0B 2D9ZA 3FEHA 2YSZA 5L81A 2VRWB 2GS0A 3D8EA 4L6EA 3U12A 2UZRA 1T77A 3HQCA 1RJ2A 3N7CA 1W1DA 4F7GA 4HATB 3BJIA 4GNKB 1W1GA 3HSAA 2DYNA 2OTXA 4HB4B 3SO6A 4DXAB 2RGNB 4Z2NA 1MPHA 5KCVA 1UEFA 4KAXB 5C79A 4Z2MB 4HAVB 2Q13A 4D0NB 4P7IA 2K8EA 4HB0B 1X1GA 1WJMA 2PZ1A 3ULCA 2MKRA 1H10A 3M1IB 3B77A 1KZ7A 2CAYA 2L1CA 1NU2A 3FSSA 4IAPA 1UNQA 2COFA 1MK9B 1DDMA 1WJ1A 1PLSA 3ULBA 1V5UA 4GMVA 4DIXA 5C6RA 2CRFA 2DTCA 2DHIA 1U27A 4K81A 5D3WA 1TJ6A 1ZC3B 2NMBA 3TFMA 2MWNB 1NTVA 4HHVA 2DFKA 2R0DA 2K2UA 2M14A 3OANA 4Y94A 4GOUA 2DKPA 2ROZB 2LG1A 4HSIA 1M7RA 4HDOA 1OMWA 1BAKA 1DDWA 1V5PA 2COAA 4A6KA 4OSNA 1X05A 1MK7B 4WVFB 2V76A 3AU5A 2KUPA 1NI2A 4DX90 3KRXA 1SHCA 3ODXA 4NSWA 4HAZB 2CODA 2P0HA 3T06A 1GC6A 2N0YA 4XWXA 2ZKMX 2MFQA 3DXDA 2DX1A 3P7ZA 2DYQA 2OQBA 3FVCA 4MY6A 3CXBB 5J3QA 3NWAA 2NBVA 3KZ1A 1XKEA 4GZUA 5I2MA 1GG3A 3WA0A 1MAIA 1OQNA 1V5MA 4K2OA 3U8ZA 5JHGA 4A6FA 5JLJB 5C16A 1K5GB 1FGYA 2Z0PA 2D11A 2YT0A 2Z4DA 1I7AA 4ZRIA 2LYDA 3SNHA 4F7UP 5LOPB 2CY5A 1EAZA 1MIZB 4OT1A 2J59M 1QC6A 5LONB 2LULA 3VOQA 3SV1A 4DBBA 1EF1A 1P5TA 2I5CA 2LKOA 1DYNA 2G35A 5KQ4A
chains in the Genus database with same CATH topology
5D3XA 1WG7A 2R09A 2LOZA 1IRSA 1KI1B 3HW2B 1M7EA 1LB1A 2I1KA 3PVLA 2CY4A 3D8FA 5D27A 5DI9B 5KQ1A 4YONA 5CLLB 4ZRKA 2I5FA 1XX0A 3G9WA 5HE0A 2Z0OA 2YS3A 1MKEA 3F5RA 3UZTA 4B6HA 1W1HA 5HE2A 4C0AA 2GCLA 1X1FA 1XODA 2DA0A 1N3HA 2RLOA 1AQCA 4F7HA 3F0WA 3TCAA 3PEGA 2YVCA 4EKUA 3ODOA 2H7EA 3PZDA 2HTHB 1DDVA 2Y7BA 2RVBB 4A6FB 3D8DA 1FB8A 4HB2B 1ZM0A 5HE1A 2FJLA 1FHXA 1QQGA 1RRPB 2ADZA 2K00A 2W2XC 4TKNA 1X86A 2IYBA 3TO1A 3LJUX 3GYOA 4MT7A 1KZGA 2ELBA 1WI1A 1OY2A 2D9XA 1U5FA 1P3RA 2DKQA 3QIJA 4WJ7A 5CLQB 2Y8GA 3V5WA 3CIKA 1Z87A 5GOWB 2KGXB 2L2IA 1FOEA 1Y19B 1U5GA 3P6AA 1BWNA 5EFXA 2XQNM 1P6SA 2D4QA 4HAWB 1AWEA 1K5DB 1GC7A 2N23A 1UPQA 1X11A 3QWMA 5JHHA 2ELAA 2GJYA 4KHOA 2UVMA 4H8SA 3HK0A 1U29A 1U5DA 4CHMA 2Z0QA 4ZRJA 4PNKA 1H4RA 2Y8FA 1TQZA 1ZSQA 4IFSA 4TYZA 2HE7A 2K2JA 1EGXA 1FAOA 1E5WA 2P8VA 3FM8C 5DHFB 3PVUA 4GN1A 3WYFB 3ZVRA 3AJ4A 2RSGA 1ISNA 4HAYB 3PG7A 1DBHA 2EJ8A 1V88A 1UNPA 5D3YA 3ZDTA 1J0WA 2D9WA 5D3VA 3VIAA 2UZSA 1PMSA 2EC1A 2D9YA 2JP2A 4GMXB 1SGHA 2E2XA 3SUZA 4IOYX 1ZVRA 5HE3A 4HAXB 2DHJA 4NY0A 2EMTA 2P0FA 2BCJA 5FI0A 1NTYA 3ODWA 1WGQA 2VSZA 2ZPYA 2W2XD 5C5BA 2YRYA 4HAUB 3MPXA 5J3YA 1BTNA 2AL6A 2DHKA 1TXDA 4GXBA 3GYPA 2COCA 2YF0A 3DXCA 2M38A 2RNRB 3PSCA 1U5EA 2QKLA 2VKIA 3A8QA 3BINA 4K2PA 3X23A 1V89A 1XD4A 3SYXA 4MK0A 2DX5A 2RUKB 2X18A 2GCJA 2J0KA 4KVGB 1DROA 3IVFA 2YS5A 1UNRA 1FGZA 2ROVA 4GPTB 2DLWA 1WVHA 3O96A 4DX8A 4PQ0A 2D10A 2AEHA 4CHJA 1V61A 1ZC4B 3KRWA 1BTKA 2IFSA 1Q67A 5DH9B 1LW3A 3NSUA 2NZ8B 5FI1A 1PFJA 2LOXA 1U2BA 5C5BB 2DN6A 3KSYA 3U7DA 1EVHA 4BBKA 1FHWA 2D9VA 2I1JA 3PVWA 4K17A 4A6HA 5DHAB 1B55A 2EMSA 3MDBC 4HDQA 5DIFB 4EJNA 4YL8A 2W2WA 2J0MA 3PP2A 1WGUA 1XCGA 1MIXA 1UPRA 5JP4A 1Y5OA 2MDXA 4HB3B 3TW1A 4WSFA 3A98B 2H7DA 2QKMA 3TVVA 4KHBB 4EMOA 2YS1A 3QBVB 3RCPA 3DXEA 2D2QA 3AU4A 3A8PA 5J3TA 2J0JA 4A5KA 3KY9A 1J19A 4CYEA 1FHOA 4KHAA 3ML4A 2KCJA 1I2HA 2YT1A 2P0DA 1XR0B 2D9ZA 3FEHA 2YSZA 5L81A 2VRWB 2GS0A 3D8EA 4L6EA 2UZRA 3HQCA 1RJ2A 3N7CA 1W1DA 4F7GA 4HATB 3BJIA 1W1GA 2DYNA 2OTXA 4HB4B 3SO6A 4DXAB 2RGNB 4Z2NA 1MPHA 5KCVA 1UEFA 4KAXB 5C79A 4Z2MB 4HAVB 2Q13A 4D0NB 4P7IA 4HB0B 1X1GA 1WJMA 2PZ1A 3ULCA 2MKRA 1H10A 3M1IB 1KZ7A 2CAYA 2L1CA 1NU2A 3FSSA 4IAPA 1UNQA 2COFA 1MK9B 1DDMA 1WJ1A 1PLSA 3ULBA 1V5UA 4GMVA 5C6RA 2CRFA 2DTCA 2DHIA 1U27A 4K81A 5D3WA 1TJ6A 1ZC3B 2NMBA 3TFMA 2MWNB 1NTVA 4HHVA 2DFKA 2R0DA 2K2UA 2M14A 3OANA 4Y94A 2DKPA 2ROZB 2LG1A 1M7RA 4HDOA 1OMWA 1BAKA 1DDWA 1V5PA 2COAA 4A6KA 1X05A 1MK7B 4WVFB 2V76A 3AU5A 2KUPA 1NI2A 4DX90 3KRXA 1SHCA 3ODXA 4NSWA 4HAZB 2CODA 2P0HA 3T06A 1GC6A 2N0YA 4XWXA 2MFQA 3DXDA 2DX1A 3P7ZA 2DYQA 2OQBA 4MY6A 3CXBB 5J3QA 3KZ1A 1XKEA 4GZUA 1GG3A 3WA0A 1MAIA 1OQNA 1V5MA 4K2OA 3U8ZA 5JHGA 4A6FA 5JLJB 5C16A 1K5GB 1FGYA 2Z0PA 2D11A 2YT0A 1I7AA 4ZRIA 2LYDA 3SNHA 4F7UP 5LOPB 2CY5A 1EAZA 1MIZB 2J59M 1QC6A 5LONB 2LULA 3VOQA 3SV1A 4DBBA 1EF1A 1P5TA 2I5CA 2LKOA 1DYNA 2G35A 5KQ4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5D3X A;  1WG7 A;  2R09 A;  2LOZ A;  1IRS A;  1KI1 B;  3HW2 B;  1M7E A;  1LB1 A;  2I1K A;  3PVL A;  2CY4 A;  3D8F A;  5D27 A;  5DI9 B;  5KQ1 A;  4YON A;  5CLL B;  4ZRK A;  2I5F A;  1XX0 A;  3G9W A;  5HE0 A;  2Z0O A;  2YS3 A;  1MKE A;  3F5R A;  3UZT A;  4B6H A;  1W1H A;  5HE2 A;  4C0A A;  2GCL A;  1X1F A;  1XOD A;  2DA0 A;  1N3H A;  2RLO A;  1AQC A;  4F7H A;  3F0W A;  3TCA A;  3PEG A;  2YVC A;  4EKU A;  3ODO A;  2H7E A;  3PZD A;  2HTH B;  1DDV A;  2Y7B A;  2RVB B;  4A6F B;  3D8D A;  1FB8 A;  4HB2 B;  1ZM0 A;  5HE1 A;  2FJL A;  1FHX A;  1QQG A;  1RRP B;  2ADZ A;  2K00 A;  2W2X C;  4TKN A;  1X86 A;  2IYB A;  3TO1 A;  3LJU X;  3GYO A;  4MT7 A;  1KZG A;  2ELB A;  1WI1 A;  1OY2 A;  2D9X A;  1U5F A;  1P3R A;  2DKQ A;  3QIJ A;  4WJ7 A;  5CLQ B;  2Y8G A;  3V5W A;  3CIK A;  1Z87 A;  5GOW B;  2KGX B;  2L2I A;  1FOE A;  1Y19 B;  1U5G A;  3P6A A;  1BWN A;  5EFX A;  2XQN M;  1P6S A;  2D4Q A;  4HAW B;  1AWE A;  1K5D B;  1GC7 A;  2N23 A;  1UPQ A;  1X11 A;  3QWM A;  5JHH A;  2ELA A;  2GJY A;  4KHO A;  2UVM A;  4H8S A;  3HK0 A;  1U29 A;  1U5D A;  4CHM A;  2Z0Q A;  4ZRJ A;  4PNK A;  1H4R A;  2Y8F A;  1TQZ A;  1ZSQ A;  4IFS A;  4TYZ A;  2HE7 A;  2K2J A;  1EGX A;  1FAO A;  1E5W A;  2P8V A;  3FM8 C;  5DHF B;  3PVU A;  4GN1 A;  3WYF B;  3ZVR A;  3AJ4 A;  2RSG A;  1ISN A;  4HAY B;  3PG7 A;  1DBH A;  2EJ8 A;  1V88 A;  1UNP A;  5D3Y A;  3ZDT A;  1J0W A;  2D9W A;  5D3V A;  3VIA A;  2UZS A;  1PMS A;  2EC1 A;  2D9Y A;  2JP2 A;  4GMX B;  1SGH A;  2E2X A;  3SUZ A;  4IOY X;  1ZVR A;  5HE3 A;  4HAX B;  2DHJ A;  4NY0 A;  2EMT A;  2P0F A;  2BCJ A;  5FI0 A;  1NTY A;  3ODW A;  1WGQ A;  2VSZ A;  2ZPY A;  2W2X D;  5C5B A;  2YRY A;  4HAU B;  3MPX A;  5J3Y A;  1BTN A;  2AL6 A;  2DHK A;  1TXD A;  4GXB A;  3GYP A;  2COC A;  2YF0 A;  3DXC A;  2M38 A;  2RNR B;  3PSC A;  1U5E A;  2QKL A;  2VKI A;  3A8Q A;  3BIN A;  4K2P A;  3X23 A;  1V89 A;  1XD4 A;  3SYX A;  4MK0 A;  2DX5 A;  2RUK B;  2X18 A;  2GCJ A;  2J0K A;  4KVG B;  1DRO A;  3IVF A;  2YS5 A;  1UNR A;  1FGZ A;  2ROV A;  4GPT B;  2DLW A;  1WVH A;  3O96 A;  4DX8 A;  4PQ0 A;  2D10 A;  2AEH A;  4CHJ A;  1V61 A;  1ZC4 B;  3KRW A;  1BTK A;  2IFS A;  1Q67 A;  5DH9 B;  1LW3 A;  3NSU A;  2NZ8 B;  5FI1 A;  1PFJ A;  2LOX A;  1U2B A;  5C5B B;  2DN6 A;  3KSY A;  3U7D A;  1EVH A;  4BBK A;  1FHW A;  2D9V A;  2I1J A;  3PVW A;  4K17 A;  4A6H A;  5DHA B;  1B55 A;  2EMS A;  3MDB C;  4HDQ A;  5DIF B;  4EJN A;  4YL8 A;  2W2W A;  2J0M A;  3PP2 A;  1WGU A;  1XCG A;  1MIX A;  1UPR A;  5JP4 A;  1Y5O A;  2MDX A;  4HB3 B;  3TW1 A;  4WSF A;  3A98 B;  2H7D A;  2QKM A;  3TVV A;  4KHB B;  4EMO A;  2YS1 A;  3QBV B;  3RCP A;  3DXE A;  2D2Q A;  3AU4 A;  3A8P A;  5J3T A;  2J0J A;  4A5K A;  3KY9 A;  1J19 A;  4CYE A;  1FHO A;  4KHA A;  3ML4 A;  2KCJ A;  1I2H A;  2YT1 A;  2P0D A;  1XR0 B;  2D9Z A;  3FEH A;  2YSZ A;  5L81 A;  2VRW B;  2GS0 A;  3D8E A;  4L6E A;  2UZR A;  3HQC A;  1RJ2 A;  3N7C A;  1W1D A;  4F7G A;  4HAT B;  3BJI A;  1W1G A;  2DYN A;  2OTX A;  4HB4 B;  3SO6 A;  4DXA B;  2RGN B;  4Z2N A;  1MPH A;  5KCV A;  1UEF A;  4KAX B;  5C79 A;  4Z2M B;  4HAV B;  2Q13 A;  4D0N B;  4P7I A;  4HB0 B;  1X1G A;  1WJM A;  2PZ1 A;  3ULC A;  2MKR A;  1H10 A;  3M1I B;  1KZ7 A;  2CAY A;  2L1C A;  1NU2 A;  3FSS A;  4IAP A;  1UNQ A;  2COF A;  1MK9 B;  1DDM A;  1WJ1 A;  1PLS A;  3ULB A;  1V5U A;  4GMV A;  5C6R A;  2CRF A;  2DTC A;  2DHI A;  1U27 A;  4K81 A;  5D3W A;  1TJ6 A;  1ZC3 B;  2NMB A;  3TFM A;  2MWN B;  1NTV A;  4HHV A;  2DFK A;  2R0D A;  2K2U A;  2M14 A;  3OAN A;  4Y94 A;  2DKP A;  2ROZ B;  2LG1 A;  1M7R A;  4HDO A;  1OMW A;  1BAK A;  1DDW A;  1V5P A;  2COA A;  4A6K A;  1X05 A;  1MK7 B;  4WVF B;  2V76 A;  3AU5 A;  2KUP A;  1NI2 A;  4DX9 0;  3KRX A;  1SHC A;  3ODX A;  4NSW A;  4HAZ B;  2COD A;  2P0H A;  3T06 A;  1GC6 A;  2N0Y A;  4XWX A;  2MFQ A;  3DXD A;  2DX1 A;  3P7Z A;  2DYQ A;  2OQB A;  4MY6 A;  3CXB B;  5J3Q A;  3KZ1 A;  1XKE A;  4GZU A;  1GG3 A;  3WA0 A;  1MAI A;  1OQN A;  1V5M A;  4K2O A;  3U8Z A;  5JHG A;  4A6F A;  5JLJ B;  5C16 A;  1K5G B;  1FGY A;  2Z0P A;  2D11 A;  2YT0 A;  1I7A A;  4ZRI A;  2LYD A;  3SNH A;  4F7U P;  5LOP B;  2CY5 A;  1EAZ A;  1MIZ B;  2J59 M;  1QC6 A;  5LON B;  2LUL A;  3VOQ A;  3SV1 A;  4DBB A;  1EF1 A;  1P5T A;  2I5C A;  2LKO A;  1DYN A;  2G35 A;  5KQ4 A; 
#chains in the Genus database with same CATH topology
 5D3X A;  1WG7 A;  2R09 A;  2KUQ A;  2LOZ A;  1IRS A;  1KI1 B;  3HW2 B;  1M7E A;  1LB1 A;  2I1K A;  3PVL A;  2CY4 A;  3D8F A;  5D27 A;  5DI9 B;  5KQ1 A;  4QXA B;  4YON A;  5CLL B;  4ZRK A;  2I5F A;  1XX0 A;  3G9W A;  5HE0 A;  2Z0O A;  2YS3 A;  1MKE A;  3F5R A;  3DCX A;  3UZT A;  2R2Y A;  2K49 A;  4B6H A;  1W1H A;  5HE2 A;  4C0A A;  2GCL A;  1X1F A;  1XOD A;  2DA0 A;  1N3H A;  2RLO A;  2FJU B;  1AQC A;  4F7H A;  3F0W A;  3TCA A;  4QJ4 B;  3PEG A;  2YVC A;  2RRF A;  4EKU A;  3ODO A;  2H7E A;  3PZD A;  2HTH B;  1DDV A;  2Y7B A;  2KIG A;  2RVB B;  4A6F B;  3D8D A;  1FB8 A;  4HB2 B;  1ZM0 A;  5HE1 A;  4QJ3 B;  2FJL A;  1FHX A;  1QQG A;  1RRP B;  2ADZ A;  2K00 A;  2W2X C;  4TKN A;  1X86 A;  2IYB A;  3TO1 A;  3LJU X;  3GYO A;  4MT7 A;  1KZG A;  2ELB A;  1WI1 A;  1OY2 A;  2D9X A;  2KIE A;  1U5F A;  1P3R A;  2DKQ A;  3QIJ A;  4WJ7 A;  5CLQ B;  2Y8G A;  3V5W A;  3CIK A;  1Z87 A;  5GOW B;  2KGX B;  2L2I A;  1FOE A;  1Y19 B;  1U5G A;  3P6A A;  1BWN A;  5EFX A;  2XQN M;  1P6S A;  2D4Q A;  3HIE A;  4HAW B;  1AWE A;  1K5D B;  1GC7 A;  2N23 A;  1UPQ A;  1X11 A;  3QWM A;  5JHH A;  2ELA A;  2GJY A;  4KHO A;  2UVM A;  4H8S A;  3HK0 A;  1U29 A;  1U5D A;  4CHM A;  2Z0Q A;  4ZRJ A;  4PNK A;  5LG4 B;  1H4R A;  2Y8F A;  1TQZ A;  1ZSQ A;  4IFS A;  4TYZ A;  2HE7 A;  2K2J A;  1EGX A;  1FAO A;  1E5W A;  2P8V A;  2YT2 A;  3FM8 C;  5DHF B;  4L1R A;  3PVU A;  4GN1 A;  3WYF B;  3ZVR A;  3AJ4 A;  2RSG A;  1ISN A;  4QJ5 B;  4HAY B;  3PG7 A;  1DBH A;  2EJ8 A;  1V88 A;  1UNP A;  5D3Y A;  3ZDT A;  1J0W A;  2D9W A;  5D3V A;  3VIA A;  2UZS A;  1PMS A;  2EC1 A;  2D9Y A;  2JP2 A;  4GMX B;  1SGH A;  3NWD A;  2E2X A;  2Z13 A;  3SUZ A;  4IOY X;  1ZVR A;  5HE3 A;  4HAX B;  2DHJ A;  4NY0 A;  2EMT A;  2P0F A;  2BCJ A;  5FI0 A;  1NTY A;  3ODW A;  1WGQ A;  2VSZ A;  2ZPY A;  2W2X D;  5C5B A;  2YRY A;  4HAU B;  1MI1 A;  3MPX A;  5J3Y A;  1BTN A;  2AL6 A;  2DHK A;  1TXD A;  5I2S A;  4GXB A;  3GYP A;  4CSQ A;  2COC A;  2YF0 A;  3DXC A;  2M38 A;  2RNR B;  5M4Y B;  1ZYI A;  3PSC A;  1U5E A;  2QKL A;  2VKI A;  3A8Q A;  3BIN A;  4K2P A;  3X23 A;  1V89 A;  1XD4 A;  3SYX A;  4MK0 A;  3A58 A;  2DX5 A;  2RUK B;  2X18 A;  2GCJ A;  2KR0 A;  2J0K A;  4KVG B;  1DRO A;  3IVF A;  2YS5 A;  1UNR A;  1FGZ A;  2ROV A;  4GPT B;  4KHB A;  2DLW A;  1WVH A;  3O96 A;  4DX8 A;  4PQ0 A;  2D10 A;  2AEH A;  4CHJ A;  1V61 A;  1ZC4 B;  3KRW A;  1BTK A;  2IFS A;  1Q67 A;  3OHM B;  5DH9 B;  1LW3 A;  5IRS A;  3NSU A;  2NZ8 B;  5FI1 A;  1PFJ A;  2LOX A;  1U2B A;  5C5B B;  2DN6 A;  3KSY A;  3U7D A;  1EVH A;  4BBK A;  1FHW A;  2D9V A;  2I1J A;  3PVW A;  4K17 A;  4A6H A;  5DHA B;  1B55 A;  2EMS A;  3MDB C;  4HDQ A;  5DIF B;  4EJN A;  3NWF A;  4YL8 A;  4D6W A;  2W2W A;  2J0M A;  3PP2 A;  1WGU A;  2Z14 A;  1XCG A;  1MIX A;  1UPR A;  5JP4 A;  1Y5O A;  2MDX A;  4HB3 B;  3TW1 A;  4WSF A;  3A98 B;  3NW8 A;  2H7D A;  2QKM A;  2GUM A;  3TVV A;  4KHB B;  4EMO A;  2YS1 A;  3QBV B;  3RCP A;  3DXE A;  2D2Q A;  3AU4 A;  3A8P A;  5J3T A;  2J0J A;  2Z59 A;  4A5K A;  3KY9 A;  1J19 A;  4CYE A;  1FHO A;  4KHA A;  3ML4 A;  2KCJ A;  1I2H A;  2YT1 A;  2P0D A;  1XR0 B;  2D9Z A;  3FEH A;  2YSZ A;  5L81 A;  2VRW B;  2GS0 A;  3D8E A;  4L6E A;  3U12 A;  2UZR A;  1T77 A;  3HQC A;  1RJ2 A;  3N7C A;  1W1D A;  4F7G A;  4HAT B;  3BJI A;  4GNK B;  1W1G A;  3HSA A;  2DYN A;  2OTX A;  4HB4 B;  3SO6 A;  4DXA B;  2RGN B;  4Z2N A;  1MPH A;  5KCV A;  1UEF A;  4KAX B;  5C79 A;  4Z2M B;  4HAV B;  2Q13 A;  4D0N B;  4P7I A;  2K8E A;  4HB0 B;  1X1G A;  1WJM A;  2PZ1 A;  3ULC A;  2MKR A;  1H10 A;  3M1I B;  3B77 A;  1KZ7 A;  2CAY A;  2L1C A;  1NU2 A;  3FSS A;  4IAP A;  1UNQ A;  2COF A;  1MK9 B;  1DDM A;  1WJ1 A;  1PLS A;  3ULB A;  1V5U A;  4GMV A;  4DIX A;  5C6R A;  2CRF A;  2DTC A;  2DHI A;  1U27 A;  4K81 A;  5D3W A;  1TJ6 A;  1ZC3 B;  2NMB A;  3TFM A;  2MWN B;  1NTV A;  4HHV A;  2DFK A;  2R0D A;  2K2U A;  2M14 A;  3OAN A;  4Y94 A;  4GOU A;  2DKP A;  2ROZ B;  2LG1 A;  4HSI A;  1M7R A;  4HDO A;  1OMW A;  1BAK A;  1DDW A;  1V5P A;  2COA A;  4A6K A;  4OSN A;  1X05 A;  1MK7 B;  4WVF B;  2V76 A;  3AU5 A;  2KUP A;  1NI2 A;  4DX9 0;  3KRX A;  1SHC A;  3ODX A;  4NSW A;  4HAZ B;  2COD A;  2P0H A;  3T06 A;  1GC6 A;  2N0Y A;  4XWX A;  2ZKM X;  2MFQ A;  3DXD A;  2DX1 A;  3P7Z A;  2DYQ A;  2OQB A;  3FVC A;  4MY6 A;  3CXB B;  5J3Q A;  3NWA A;  2NBV A;  3KZ1 A;  1XKE A;  4GZU A;  5I2M A;  1GG3 A;  3WA0 A;  1MAI A;  1OQN A;  1V5M A;  4K2O A;  3U8Z A;  5JHG A;  4A6F A;  5JLJ B;  5C16 A;  1K5G B;  1FGY A;  2Z0P A;  2D11 A;  2YT0 A;  2Z4D A;  1I7A A;  4ZRI A;  2LYD A;  3SNH A;  4F7U P;  5LOP B;  2CY5 A;  1EAZ A;  1MIZ B;  4OT1 A;  2J59 M;  1QC6 A;  5LON B;  2LUL A;  3VOQ A;  3SV1 A;  4DBB A;  1EF1 A;  1P5T A;  2I5C A;  2LKO A;  1DYN A;  2G35 A;  5KQ4 A; 
#chains in the Genus database with same CATH homology
 5D3X A;  1WG7 A;  2R09 A;  2LOZ A;  1IRS A;  1KI1 B;  3HW2 B;  1M7E A;  1LB1 A;  2I1K A;  3PVL A;  2CY4 A;  3D8F A;  5D27 A;  5DI9 B;  5KQ1 A;  4YON A;  5CLL B;  4ZRK A;  2I5F A;  1XX0 A;  3G9W A;  5HE0 A;  2Z0O A;  2YS3 A;  1MKE A;  3F5R A;  3UZT A;  4B6H A;  1W1H A;  5HE2 A;  4C0A A;  2GCL A;  1X1F A;  1XOD A;  2DA0 A;  1N3H A;  2RLO A;  1AQC A;  4F7H A;  3F0W A;  3TCA A;  3PEG A;  2YVC A;  4EKU A;  3ODO A;  2H7E A;  3PZD A;  2HTH B;  1DDV A;  2Y7B A;  2RVB B;  4A6F B;  3D8D A;  1FB8 A;  4HB2 B;  1ZM0 A;  5HE1 A;  2FJL A;  1FHX A;  1QQG A;  1RRP B;  2ADZ A;  2K00 A;  2W2X C;  4TKN A;  1X86 A;  2IYB A;  3TO1 A;  3LJU X;  3GYO A;  4MT7 A;  1KZG A;  2ELB A;  1WI1 A;  1OY2 A;  2D9X A;  1U5F A;  1P3R A;  2DKQ A;  3QIJ A;  4WJ7 A;  5CLQ B;  2Y8G A;  3V5W A;  3CIK A;  1Z87 A;  5GOW B;  2KGX B;  2L2I A;  1FOE A;  1Y19 B;  1U5G A;  3P6A A;  1BWN A;  5EFX A;  2XQN M;  1P6S A;  2D4Q A;  4HAW B;  1AWE A;  1K5D B;  1GC7 A;  2N23 A;  1UPQ A;  1X11 A;  3QWM A;  5JHH A;  2ELA A;  2GJY A;  4KHO A;  2UVM A;  4H8S A;  3HK0 A;  1U29 A;  1U5D A;  4CHM A;  2Z0Q A;  4ZRJ A;  4PNK A;  1H4R A;  2Y8F A;  1TQZ A;  1ZSQ A;  4IFS A;  4TYZ A;  2HE7 A;  2K2J A;  1EGX A;  1FAO A;  1E5W A;  2P8V A;  3FM8 C;  5DHF B;  3PVU A;  4GN1 A;  3WYF B;  3ZVR A;  3AJ4 A;  2RSG A;  1ISN A;  4HAY B;  3PG7 A;  1DBH A;  2EJ8 A;  1V88 A;  1UNP A;  5D3Y A;  3ZDT A;  1J0W A;  2D9W A;  5D3V A;  3VIA A;  2UZS A;  1PMS A;  2EC1 A;  2D9Y A;  2JP2 A;  4GMX B;  1SGH A;  2E2X A;  3SUZ A;  4IOY X;  1ZVR A;  5HE3 A;  4HAX B;  2DHJ A;  4NY0 A;  2EMT A;  2P0F A;  2BCJ A;  5FI0 A;  1NTY A;  3ODW A;  1WGQ A;  2VSZ A;  2ZPY A;  2W2X D;  5C5B A;  2YRY A;  4HAU B;  3MPX A;  5J3Y A;  1BTN A;  2AL6 A;  2DHK A;  1TXD A;  4GXB A;  3GYP A;  2COC A;  2YF0 A;  3DXC A;  2M38 A;  2RNR B;  3PSC A;  1U5E A;  2QKL A;  2VKI A;  3A8Q A;  3BIN A;  4K2P A;  3X23 A;  1V89 A;  1XD4 A;  3SYX A;  4MK0 A;  2DX5 A;  2RUK B;  2X18 A;  2GCJ A;  2J0K A;  4KVG B;  1DRO A;  3IVF A;  2YS5 A;  1UNR A;  1FGZ A;  2ROV A;  4GPT B;  2DLW A;  1WVH A;  3O96 A;  4DX8 A;  4PQ0 A;  2D10 A;  2AEH A;  4CHJ A;  1V61 A;  1ZC4 B;  3KRW A;  1BTK A;  2IFS A;  1Q67 A;  5DH9 B;  1LW3 A;  3NSU A;  2NZ8 B;  5FI1 A;  1PFJ A;  2LOX A;  1U2B A;  5C5B B;  2DN6 A;  3KSY A;  3U7D A;  1EVH A;  4BBK A;  1FHW A;  2D9V A;  2I1J A;  3PVW A;  4K17 A;  4A6H A;  5DHA B;  1B55 A;  2EMS A;  3MDB C;  4HDQ A;  5DIF B;  4EJN A;  4YL8 A;  2W2W A;  2J0M A;  3PP2 A;  1WGU A;  1XCG A;  1MIX A;  1UPR A;  5JP4 A;  1Y5O A;  2MDX A;  4HB3 B;  3TW1 A;  4WSF A;  3A98 B;  2H7D A;  2QKM A;  3TVV A;  4KHB B;  4EMO A;  2YS1 A;  3QBV B;  3RCP A;  3DXE A;  2D2Q A;  3AU4 A;  3A8P A;  5J3T A;  2J0J A;  4A5K A;  3KY9 A;  1J19 A;  4CYE A;  1FHO A;  4KHA A;  3ML4 A;  2KCJ A;  1I2H A;  2YT1 A;  2P0D A;  1XR0 B;  2D9Z A;  3FEH A;  2YSZ A;  5L81 A;  2VRW B;  2GS0 A;  3D8E A;  4L6E A;  2UZR A;  3HQC A;  1RJ2 A;  3N7C A;  1W1D A;  4F7G A;  4HAT B;  3BJI A;  1W1G A;  2DYN A;  2OTX A;  4HB4 B;  3SO6 A;  4DXA B;  2RGN B;  4Z2N A;  1MPH A;  5KCV A;  1UEF A;  4KAX B;  5C79 A;  4Z2M B;  4HAV B;  2Q13 A;  4D0N B;  4P7I A;  4HB0 B;  1X1G A;  1WJM A;  2PZ1 A;  3ULC A;  2MKR A;  1H10 A;  3M1I B;  1KZ7 A;  2CAY A;  2L1C A;  1NU2 A;  3FSS A;  4IAP A;  1UNQ A;  2COF A;  1MK9 B;  1DDM A;  1WJ1 A;  1PLS A;  3ULB A;  1V5U A;  4GMV A;  5C6R A;  2CRF A;  2DTC A;  2DHI A;  1U27 A;  4K81 A;  5D3W A;  1TJ6 A;  1ZC3 B;  2NMB A;  3TFM A;  2MWN B;  1NTV A;  4HHV A;  2DFK A;  2R0D A;  2K2U A;  2M14 A;  3OAN A;  4Y94 A;  2DKP A;  2ROZ B;  2LG1 A;  1M7R A;  4HDO A;  1OMW A;  1BAK A;  1DDW A;  1V5P A;  2COA A;  4A6K A;  1X05 A;  1MK7 B;  4WVF B;  2V76 A;  3AU5 A;  2KUP A;  1NI2 A;  4DX9 0;  3KRX A;  1SHC A;  3ODX A;  4NSW A;  4HAZ B;  2COD A;  2P0H A;  3T06 A;  1GC6 A;  2N0Y A;  4XWX A;  2MFQ A;  3DXD A;  2DX1 A;  3P7Z A;  2DYQ A;  2OQB A;  4MY6 A;  3CXB B;  5J3Q A;  3KZ1 A;  1XKE A;  4GZU A;  1GG3 A;  3WA0 A;  1MAI A;  1OQN A;  1V5M A;  4K2O A;  3U8Z A;  5JHG A;  4A6F A;  5JLJ B;  5C16 A;  1K5G B;  1FGY A;  2Z0P A;  2D11 A;  2YT0 A;  1I7A A;  4ZRI A;  2LYD A;  3SNH A;  4F7U P;  5LOP B;  2CY5 A;  1EAZ A;  1MIZ B;  2J59 M;  1QC6 A;  5LON B;  2LUL A;  3VOQ A;  3SV1 A;  4DBB A;  1EF1 A;  1P5T A;  2I5C A;  2LKO A;  1DYN A;  2G35 A;  5KQ4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...