4GPTB

Crystal structure of kpt251 in complex with crm1-ran-ranbp1
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
123
structure length
123
Chain Sequence
TAEEDEEVLYKVRAKLFRFDKDAKEWKERGTGDCKFLKNKKTNKVRILMRRDKTLKICANHIIAPEYTLKPNVGSDRSWVYACTADIAEGEAEAFTFAIRFGSKENADKFKEEFEKAQEINKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Antileukemic activity of nuclear export inhibitors that spare normal hematopoietic cells.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport/inhibitor
molecule keywords GTP-binding nuclear protein Ran
total genus 31
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2012-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00638 Ran_BP1 RanBP1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4gptB00
5CLLB 1PFJA 3TFMA 1J0WA 1V5PA 2CODA 2E2XA 2J0JA 2ADZA 2I1JA 5HE3A 4A6HA 5JHGA 5D3WA 3LJUX 2AEHA 3QWMA 5JLJB 3HQCA 3T06A 2H7EA 2I5CA 1ZC4B 1SGHA 3KRWA 2W2WA 2IFSA 4WSFA 4BBKA 1XX0A 4HDOA 4MT7A 2YSZA 1DDMA 2DYQA 3U8ZA 1WG7A 3ZDTA 4K2OA 1AQCA 1FHOA 4DXAB 4K81A 3SNHA 3M1IB 1UNPA 4HDQA 1GC7A 1ZM0A 1FB8A 1AWEA 3PVUA 2YT0A 4KHOA 1IRSA 4GXBA 4HB2B 2DX5A 1NTYA 1ZSQA 4HAVB 4TKNA 1FAOA 1KZ7A 5D3VA 1X86A 5D3YA 3KY9A 2N23A 3BJIA 3WYFB 3VIAA 2VKIA 1U5EA 3TO1A 1XKEA 2CAYA 2H7DA 3A8QA 1W1HA 1I7AA 2D4QA 4KHAA 4F7UP 1UNQA 2DTCA 3ULCA 4L6EA 2KGXB 3ODOA 2K00A 5C5BB 4PQ0A 1DYNA 1FOEA 3ML4A 1B55A 3U7DA 4NY0A 2D9WA 1V89A 4DX8A 2V76A 1H4RA 2DHIA 2YVCA 3PP2A 2GCJA 3G9WA 2EMTA 4HAUB 2Z0OA 2NZ8B 2RVBB 2P0DA 2M14A 1K5GB 2HTHB 2RSGA 1LB1A 1X05A 2JP2A 3DXDA 2DHJA 2BCJA 4HAYB 4A5KA 1P3RA 4EKUA 1MIXA 3KRXA 4XWXA 5J3TA 3DXEA 5LOPB 1OY2A 5KCVA 5KQ4A 2W2XD 3SO6A 3QBVB 1U5GA 1XCGA 1Y5OA 1MKEA 2VSZA 5JHHA 1MPHA 2GCLA 5FI0A 3FM8C 2MDXA 4GMVA 3IVFA 1W1GA 4GN1A 5D3XA 2N0YA 1X1GA 1MK7B 2Y7BA 4DBBA 4WJ7A 2DFKA 2DLWA 5C79A 1X11A 1TXDA 1M7RA 2IYBA 2YS1A 4Y94A 2EMSA 1WI1A 2UZSA 2DX1A 4ZRIA 4K17A 5HE0A 4HAZB 2P8VA 4HAXB 1I2HA 1KZGA 2ELAA 1XR0B 4CYEA 1V88A 5DH9B 4B6HA 1XODA 4HATB 4GMXB 2DHKA 1QQGA 2ZPYA 5EFXA 1MIZB 3CXBB 1FHXA 1Q67A 3KSYA 4A6FA 3HW2B 3KZ1A 1PMSA 1TQZA 3GYPA 1E5WA 2CY4A 4YONA 1DBHA 1TJ6A 1QC6A 1XD4A 3P6AA 3SUZA 1FGYA 1UPRA 5HE1A 1PLSA 3PG7A 4KAXB 3ZVRA 1M7EA 1U5DA 5LONB 3FSSA 1X1FA 1WVHA 2R0DA 2I1KA 1ISNA 2D11A 2COFA 2AL6A 2YS3A 4CHJA 3PSCA 5GOWB 5C6RA 3RCPA 1WJMA 2CRFA 4GPTB 1MK9B 1FHWA 2LOXA 2LULA 2QKMA 1RRPB 1U2BA 4C0AA 2MWNB 4NSWA 2XQNM 2Q13A 2DYNA 2Y8FA 3DXCA 2G35A 3WA0A 3F5RA 4A6FB 1BTNA 1BTKA 2VRWB 5L81A 1BWNA 2DA0A 1V61A 3TW1A 1U5FA 3AU5A 1U27A 2L2IA 2LKOA 5J3YA 3PEGA 3SYXA 2D9ZA 2MKRA 2YF0A 2OQBA 1ZVRA 5JP4A 2M38A 4HB4B 2YRYA 4CHMA 4GZUA 2COAA 4HB3B 1DDWA 4EJNA 4KHBB 2ELBA 3VOQA 3MPXA 4Z2MB 2LOZA 2P0HA 2KUPA 3X23A 4KVGB 4F7GA 1NI2A 5DIFB 2UZRA 2ROZB 2YS5A 3AJ4A 4DX90 2LG1A 2I5FA 2EJ8A 5HE2A 1NTVA 3GYOA 2Y8GA 1OMWA 2P0FA 3O96A 1U29A 2D9YA 4IOYX 2PZ1A 3NSUA 3FEHA 2DKPA 1Y19B 1SHCA 1MAIA 3QIJA 3A98B 2RLOA 5DHFB 2D9VA 2RNRB 2COCA 2HE7A 1UPQA 2Z0PA 4Z2NA 3CIKA 3F0WA 4A6KA 4D0NB 1UNRA 2Z0QA 5J3QA 1H10A 4ZRKA 4F7HA 2J0MA 3PVLA 1WJ1A 3D8DA 1P6SA 3V5WA 5C16A 1J19A 2ROVA 5DHAB 2QKLA 3HK0A 1FGZA 3D8EA 3P7ZA 4WVFB 1EGXA 1P5TA 1LW3A 3UZTA 2OTXA 4TYZA 1Z87A 2RUKB 4H8SA 4IAPA 2K2JA 4HB0B 5KQ1A 3ULBA 3TCAA 3BINA 3SV1A 1OQNA 3MDBC 2L1CA 2LYDA 2YT1A 1DDVA 3AU4A 1V5MA 2DN6A 1EAZA 2KCJA 2NMBA 5D27A 2W2XC 4HHVA 3A8PA 3N7CA 4EMOA 2D9XA 1K5DB 1NU2A 2GS0A 5FI1A 1N3HA 1WGUA 3ODXA 4K2PA 4YL8A 1EF1A 1DROA 2DKQA 1KI1B 1WGQA 4MK0A 5C5BA 2D2QA 1V5UA 2RGNB 2EC1A 2D10A 2X18A 1UEFA 5CLQB 4PNKA 2R09A 4ZRJA 1EVHA 3PVWA 2UVMA 1BAKA 4IFSA 2MFQA 1RJ2A 4HAWB 4P7IA 3OANA 5DI9B 3TVVA 1ZC3B 2K2UA 1GC6A 3PZDA 1GG3A 2J59M 3ODWA 2J0KA 2GJYA 2CY5A 2FJLA 4MY6A 1W1DA 3D8FA
chains in the Genus database with same CATH superfamily
5CLLB 1PFJA 2R2YA 3TFMA 1J0WA 1V5PA 2CODA 2E2XA 2J0JA 2ADZA 2I1JA 5HE3A 4A6HA 5JHGA 5D3WA 3LJUX 2AEHA 4GNKB 3QWMA 5JLJB 3HQCA 3T06A 2H7EA 2I5CA 1ZC4B 2NBVA 3A58A 1SGHA 3KRWA 2W2WA 2IFSA 4WSFA 4BBKA 1XX0A 4HDOA 4MT7A 2YSZA 1DDMA 2DYQA 3U8ZA 1WG7A 3ZDTA 4K2OA 1AQCA 1FHOA 4DXAB 4K81A 3SNHA 3M1IB 1UNPA 4HDQA 1GC7A 4QJ3B 1ZM0A 1FB8A 1AWEA 3PVUA 2YT0A 4KHOA 1IRSA 4GXBA 4HB2B 2DX5A 1NTYA 1ZSQA 4HAVB 4TKNA 1FAOA 1KZ7A 5D3VA 1X86A 5D3YA 3KY9A 2N23A 5IRSA 3NW8A 3BJIA 2KIEA 3WYFB 3VIAA 2VKIA 1U5EA 3TO1A 1XKEA 2CAYA 2H7DA 3A8QA 1W1HA 1I7AA 2D4QA 4KHAA 4F7UP 1UNQA 2DTCA 3ULCA 4L6EA 2KGXB 3ODOA 2K00A 3HIEA 5C5BB 4PQ0A 1DYNA 1FOEA 3ML4A 1B55A 3U7DA 4NY0A 2D9WA 1V89A 4DX8A 2V76A 1H4RA 2DHIA 3HSAA 2YVCA 3PP2A 2GCJA 3G9WA 2EMTA 4HAUB 2Z0OA 2NZ8B 2RVBB 2P0DA 2M14A 1K5GB 2HTHB 2RSGA 1LB1A 5I2SA 1X05A 2JP2A 3DXDA 2DHJA 2BCJA 4HAYB 4A5KA 2Z4DA 1P3RA 4EKUA 1MIXA 3KRXA 4XWXA 5J3TA 3DXEA 5LOPB 1OY2A 3DCXA 5KCVA 5KQ4A 2W2XD 3SO6A 3QBVB 1U5GA 1XCGA 1Y5OA 1MKEA 2VSZA 5JHHA 4L1RA 4OT1A 1MPHA 2GCLA 5FI0A 3FM8C 2MDXA 4GMVA 4DIXA 3IVFA 1W1GA 4GN1A 5D3XA 2N0YA 1X1GA 2Z14A 1MK7B 2Y7BA 2KUQA 4DBBA 4WJ7A 5M4YB 2DFKA 2DLWA 5C79A 1X11A 1TXDA 1M7RA 2IYBA 2YS1A 4Y94A 2EMSA 1WI1A 2UZSA 2DX1A 4ZRIA 4K17A 5HE0A 4HAZB 2P8VA 4GOUA 4HAXB 4QJ5B 2Z13A 1I2HA 1KZGA 2ELAA 1XR0B 4CYEA 2K8EA 1V88A 5DH9B 4B6HA 1XODA 4HATB 4GMXB 2DHKA 1QQGA 3NWFA 2ZPYA 5EFXA 5I2MA 1MIZB 3CXBB 1FHXA 1Q67A 3KSYA 4A6FA 3HW2B 3KZ1A 1PMSA 1TQZA 3GYPA 1E5WA 2CY4A 4YONA 1DBHA 1TJ6A 1QC6A 1XD4A 3P6AA 3SUZA 1FGYA 1UPRA 2FJUB 5HE1A 1PLSA 3PG7A 4KAXB 3ZVRA 1M7EA 1U5DA 5LONB 3FSSA 1X1FA 1WVHA 2R0DA 2I1KA 1ISNA 2D11A 2COFA 2AL6A 2K49A 2YS3A 4CHJA 3PSCA 5GOWB 5C6RA 3RCPA 1WJMA 2CRFA 4GPTB 1MK9B 1FHWA 2LOXA 2LULA 4CSQA 2QKMA 1RRPB 1U2BA 4C0AA 2MWNB 4NSWA 2XQNM 2Q13A 2DYNA 2Y8FA 3DXCA 2G35A 3WA0A 3F5RA 4A6FB 1BTNA 3FVCA 1BTKA 2VRWB 5L81A 1BWNA 2DA0A 1V61A 3NWDA 3TW1A 1U5FA 3AU5A 1U27A 2L2IA 2LKOA 5J3YA 3PEGA 3SYXA 2D9ZA 2MKRA 2YF0A 2OQBA 4OSNA 1ZVRA 5JP4A 2M38A 4HB4B 2KIGA 2YRYA 4CHMA 4GZUA 2COAA 4HB3B 1DDWA 4EJNA 4KHBB 3OHMB 2ELBA 3VOQA 3MPXA 4Z2MB 2LOZA 2P0HA 2KUPA 3X23A 4KVGB 1T77A 4F7GA 3U12A 2RRFA 2ZKMX 1NI2A 5DIFB 2UZRA 2ROZB 3NWAA 2YS5A 3AJ4A 4DX90 2LG1A 2I5FA 2EJ8A 5HE2A 1NTVA 3GYOA 2Y8GA 1OMWA 2P0FA 3O96A 1U29A 2D9YA 4IOYX 2PZ1A 3NSUA 3FEHA 2DKPA 1Y19B 1SHCA 1MAIA 3QIJA 3A98B 2RLOA 5DHFB 2D9VA 2RNRB 2COCA 2HE7A 1UPQA 2Z0PA 4Z2NA 3CIKA 3F0WA 3B77A 4A6KA 4D0NB 1UNRA 2Z0QA 5J3QA 1H10A 4ZRKA 4F7HA 2J0MA 3PVLA 1WJ1A 3D8DA 1P6SA 3V5WA 5C16A 1J19A 1ZYIA 2ROVA 5DHAB 2QKLA 3HK0A 1FGZA 3D8EA 3P7ZA 4WVFB 1EGXA 1P5TA 1MI1A 4QXAB 1LW3A 3UZTA 2OTXA 4TYZA 1Z87A 2RUKB 4H8SA 4IAPA 2K2JA 4HB0B 5KQ1A 3ULBA 3TCAA 3BINA 4D6WA 2KR0A 3SV1A 1OQNA 3MDBC 2L1CA 2LYDA 2YT1A 1DDVA 3AU4A 1V5MA 5LG4B 2DN6A 1EAZA 2KCJA 2NMBA 5D27A 2W2XC 4HHVA 3A8PA 3N7CA 4EMOA 2D9XA 1K5DB 1NU2A 2GS0A 5FI1A 1N3HA 1WGUA 3ODXA 2YT2A 4K2PA 4YL8A 1EF1A 4QJ4B 1DROA 2GUMA 2DKQA 1KI1B 1WGQA 4MK0A 5C5BA 4KHBA 2D2QA 1V5UA 2RGNB 2EC1A 2D10A 2X18A 1UEFA 2Z59A 5CLQB 4PNKA 2R09A 4ZRJA 1EVHA 3PVWA 2UVMA 1BAKA 4IFSA 2MFQA 1RJ2A 4HAWB 4P7IA 3OANA 5DI9B 3TVVA 1ZC3B 2K2UA 1GC6A 3PZDA 1GG3A 2J59M 3ODWA 2J0KA 2GJYA 2CY5A 2FJLA 4MY6A 4HSIA 1W1DA 3D8FA
chains in the Genus database with same CATH topology
5CLLB 1PFJA 3TFMA 1J0WA 1V5PA 2CODA 2E2XA 2J0JA 2ADZA 2I1JA 5HE3A 4A6HA 5JHGA 5D3WA 3LJUX 2AEHA 3QWMA 5JLJB 3HQCA 3T06A 2H7EA 2I5CA 1ZC4B 1SGHA 3KRWA 2W2WA 2IFSA 4WSFA 4BBKA 1XX0A 4HDOA 4MT7A 2YSZA 1DDMA 2DYQA 3U8ZA 1WG7A 3ZDTA 4K2OA 1AQCA 1FHOA 4DXAB 4K81A 3SNHA 3M1IB 1UNPA 4HDQA 1GC7A 1ZM0A 1FB8A 1AWEA 3PVUA 2YT0A 4KHOA 1IRSA 4GXBA 4HB2B 2DX5A 1NTYA 1ZSQA 4HAVB 4TKNA 1FAOA 1KZ7A 5D3VA 1X86A 5D3YA 3KY9A 2N23A 3BJIA 3WYFB 3VIAA 2VKIA 1U5EA 3TO1A 1XKEA 2CAYA 2H7DA 3A8QA 1W1HA 1I7AA 2D4QA 4KHAA 4F7UP 1UNQA 2DTCA 3ULCA 4L6EA 2KGXB 3ODOA 2K00A 5C5BB 4PQ0A 1DYNA 1FOEA 3ML4A 1B55A 3U7DA 4NY0A 2D9WA 1V89A 4DX8A 2V76A 1H4RA 2DHIA 2YVCA 3PP2A 2GCJA 3G9WA 2EMTA 4HAUB 2Z0OA 2NZ8B 2RVBB 2P0DA 2M14A 1K5GB 2HTHB 2RSGA 1LB1A 1X05A 2JP2A 3DXDA 2DHJA 2BCJA 4HAYB 4A5KA 1P3RA 4EKUA 1MIXA 3KRXA 4XWXA 5J3TA 3DXEA 5LOPB 1OY2A 5KCVA 5KQ4A 2W2XD 3SO6A 3QBVB 1U5GA 1XCGA 1Y5OA 1MKEA 2VSZA 5JHHA 1MPHA 2GCLA 5FI0A 3FM8C 2MDXA 4GMVA 3IVFA 1W1GA 4GN1A 5D3XA 2N0YA 1X1GA 1MK7B 2Y7BA 4DBBA 4WJ7A 2DFKA 2DLWA 5C79A 1X11A 1TXDA 1M7RA 2IYBA 2YS1A 4Y94A 2EMSA 1WI1A 2UZSA 2DX1A 4ZRIA 4K17A 5HE0A 4HAZB 2P8VA 4HAXB 1I2HA 1KZGA 2ELAA 1XR0B 4CYEA 1V88A 5DH9B 4B6HA 1XODA 4HATB 4GMXB 2DHKA 1QQGA 2ZPYA 5EFXA 1MIZB 3CXBB 1FHXA 1Q67A 3KSYA 4A6FA 3HW2B 3KZ1A 1PMSA 1TQZA 3GYPA 1E5WA 2CY4A 4YONA 1DBHA 1TJ6A 1QC6A 1XD4A 3P6AA 3SUZA 1FGYA 1UPRA 5HE1A 1PLSA 3PG7A 4KAXB 3ZVRA 1M7EA 1U5DA 5LONB 3FSSA 1X1FA 1WVHA 2R0DA 2I1KA 1ISNA 2D11A 2COFA 2AL6A 2YS3A 4CHJA 3PSCA 5GOWB 5C6RA 3RCPA 1WJMA 2CRFA 4GPTB 1MK9B 1FHWA 2LOXA 2LULA 2QKMA 1RRPB 1U2BA 4C0AA 2MWNB 4NSWA 2XQNM 2Q13A 2DYNA 2Y8FA 3DXCA 2G35A 3WA0A 3F5RA 4A6FB 1BTNA 1BTKA 2VRWB 5L81A 1BWNA 2DA0A 1V61A 3TW1A 1U5FA 3AU5A 1U27A 2L2IA 2LKOA 5J3YA 3PEGA 3SYXA 2D9ZA 2MKRA 2YF0A 2OQBA 1ZVRA 5JP4A 2M38A 4HB4B 2YRYA 4CHMA 4GZUA 2COAA 4HB3B 1DDWA 4EJNA 4KHBB 2ELBA 3VOQA 3MPXA 4Z2MB 2LOZA 2P0HA 2KUPA 3X23A 4KVGB 4F7GA 1NI2A 5DIFB 2UZRA 2ROZB 2YS5A 3AJ4A 4DX90 2LG1A 2I5FA 2EJ8A 5HE2A 1NTVA 3GYOA 2Y8GA 1OMWA 2P0FA 3O96A 1U29A 2D9YA 4IOYX 2PZ1A 3NSUA 3FEHA 2DKPA 1Y19B 1SHCA 1MAIA 3QIJA 3A98B 2RLOA 5DHFB 2D9VA 2RNRB 2COCA 2HE7A 1UPQA 2Z0PA 4Z2NA 3CIKA 3F0WA 4A6KA 4D0NB 1UNRA 2Z0QA 5J3QA 1H10A 4ZRKA 4F7HA 2J0MA 3PVLA 1WJ1A 3D8DA 1P6SA 3V5WA 5C16A 1J19A 2ROVA 5DHAB 2QKLA 3HK0A 1FGZA 3D8EA 3P7ZA 4WVFB 1EGXA 1P5TA 1LW3A 3UZTA 2OTXA 4TYZA 1Z87A 2RUKB 4H8SA 4IAPA 2K2JA 4HB0B 5KQ1A 3ULBA 3TCAA 3BINA 3SV1A 1OQNA 3MDBC 2L1CA 2LYDA 2YT1A 1DDVA 3AU4A 1V5MA 2DN6A 1EAZA 2KCJA 2NMBA 5D27A 2W2XC 4HHVA 3A8PA 3N7CA 4EMOA 2D9XA 1K5DB 1NU2A 2GS0A 5FI1A 1N3HA 1WGUA 3ODXA 4K2PA 4YL8A 1EF1A 1DROA 2DKQA 1KI1B 1WGQA 4MK0A 5C5BA 2D2QA 1V5UA 2RGNB 2EC1A 2D10A 2X18A 1UEFA 5CLQB 4PNKA 2R09A 4ZRJA 1EVHA 3PVWA 2UVMA 1BAKA 4IFSA 2MFQA 1RJ2A 4HAWB 4P7IA 3OANA 5DI9B 3TVVA 1ZC3B 2K2UA 1GC6A 3PZDA 1GG3A 2J59M 3ODWA 2J0KA 2GJYA 2CY5A 2FJLA 4MY6A 1W1DA 3D8FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CLL B;  1PFJ A;  3TFM A;  1J0W A;  1V5P A;  2COD A;  2E2X A;  2J0J A;  2ADZ A;  2I1J A;  5HE3 A;  4A6H A;  5JHG A;  5D3W A;  3LJU X;  2AEH A;  3QWM A;  5JLJ B;  3HQC A;  3T06 A;  2H7E A;  2I5C A;  1ZC4 B;  1SGH A;  3KRW A;  2W2W A;  2IFS A;  4WSF A;  4BBK A;  1XX0 A;  4HDO A;  4MT7 A;  2YSZ A;  1DDM A;  2DYQ A;  3U8Z A;  1WG7 A;  3ZDT A;  4K2O A;  1AQC A;  1FHO A;  4DXA B;  4K81 A;  3SNH A;  3M1I B;  1UNP A;  4HDQ A;  1GC7 A;  1ZM0 A;  1FB8 A;  1AWE A;  3PVU A;  2YT0 A;  4KHO A;  1IRS A;  4GXB A;  4HB2 B;  2DX5 A;  1NTY A;  1ZSQ A;  4HAV B;  4TKN A;  1FAO A;  1KZ7 A;  5D3V A;  1X86 A;  5D3Y A;  3KY9 A;  2N23 A;  3BJI A;  3WYF B;  3VIA A;  2VKI A;  1U5E A;  3TO1 A;  1XKE A;  2CAY A;  2H7D A;  3A8Q A;  1W1H A;  1I7A A;  2D4Q A;  4KHA A;  4F7U P;  1UNQ A;  2DTC A;  3ULC A;  4L6E A;  2KGX B;  3ODO A;  2K00 A;  5C5B B;  4PQ0 A;  1DYN A;  1FOE A;  3ML4 A;  1B55 A;  3U7D A;  4NY0 A;  2D9W A;  1V89 A;  4DX8 A;  2V76 A;  1H4R A;  2DHI A;  2YVC A;  3PP2 A;  2GCJ A;  3G9W A;  2EMT A;  4HAU B;  2Z0O A;  2NZ8 B;  2RVB B;  2P0D A;  2M14 A;  1K5G B;  2HTH B;  2RSG A;  1LB1 A;  1X05 A;  2JP2 A;  3DXD A;  2DHJ A;  2BCJ A;  4HAY B;  4A5K A;  1P3R A;  4EKU A;  1MIX A;  3KRX A;  4XWX A;  5J3T A;  3DXE A;  5LOP B;  1OY2 A;  5KCV A;  5KQ4 A;  2W2X D;  3SO6 A;  3QBV B;  1U5G A;  1XCG A;  1Y5O A;  1MKE A;  2VSZ A;  5JHH A;  1MPH A;  2GCL A;  5FI0 A;  3FM8 C;  2MDX A;  4GMV A;  3IVF A;  1W1G A;  4GN1 A;  5D3X A;  2N0Y A;  1X1G A;  1MK7 B;  2Y7B A;  4DBB A;  4WJ7 A;  2DFK A;  2DLW A;  5C79 A;  1X11 A;  1TXD A;  1M7R A;  2IYB A;  2YS1 A;  4Y94 A;  2EMS A;  1WI1 A;  2UZS A;  2DX1 A;  4ZRI A;  4K17 A;  5HE0 A;  4HAZ B;  2P8V A;  4HAX B;  1I2H A;  1KZG A;  2ELA A;  1XR0 B;  4CYE A;  1V88 A;  5DH9 B;  4B6H A;  1XOD A;  4HAT B;  4GMX B;  2DHK A;  1QQG A;  2ZPY A;  5EFX A;  1MIZ B;  3CXB B;  1FHX A;  1Q67 A;  3KSY A;  4A6F A;  3HW2 B;  3KZ1 A;  1PMS A;  1TQZ A;  3GYP A;  1E5W A;  2CY4 A;  4YON A;  1DBH A;  1TJ6 A;  1QC6 A;  1XD4 A;  3P6A A;  3SUZ A;  1FGY A;  1UPR A;  5HE1 A;  1PLS A;  3PG7 A;  4KAX B;  3ZVR A;  1M7E A;  1U5D A;  5LON B;  3FSS A;  1X1F A;  1WVH A;  2R0D A;  2I1K A;  1ISN A;  2D11 A;  2COF A;  2AL6 A;  2YS3 A;  4CHJ A;  3PSC A;  5GOW B;  5C6R A;  3RCP A;  1WJM A;  2CRF A;  4GPT B;  1MK9 B;  1FHW A;  2LOX A;  2LUL A;  2QKM A;  1RRP B;  1U2B A;  4C0A A;  2MWN B;  4NSW A;  2XQN M;  2Q13 A;  2DYN A;  2Y8F A;  3DXC A;  2G35 A;  3WA0 A;  3F5R A;  4A6F B;  1BTN A;  1BTK A;  2VRW B;  5L81 A;  1BWN A;  2DA0 A;  1V61 A;  3TW1 A;  1U5F A;  3AU5 A;  1U27 A;  2L2I A;  2LKO A;  5J3Y A;  3PEG A;  3SYX A;  2D9Z A;  2MKR A;  2YF0 A;  2OQB A;  1ZVR A;  5JP4 A;  2M38 A;  4HB4 B;  2YRY A;  4CHM A;  4GZU A;  2COA A;  4HB3 B;  1DDW A;  4EJN A;  4KHB B;  2ELB A;  3VOQ A;  3MPX A;  4Z2M B;  2LOZ A;  2P0H A;  2KUP A;  3X23 A;  4KVG B;  4F7G A;  1NI2 A;  5DIF B;  2UZR A;  2ROZ B;  2YS5 A;  3AJ4 A;  4DX9 0;  2LG1 A;  2I5F A;  2EJ8 A;  5HE2 A;  1NTV A;  3GYO A;  2Y8G A;  1OMW A;  2P0F A;  3O96 A;  1U29 A;  2D9Y A;  4IOY X;  2PZ1 A;  3NSU A;  3FEH A;  2DKP A;  1Y19 B;  1SHC A;  1MAI A;  3QIJ A;  3A98 B;  2RLO A;  5DHF B;  2D9V A;  2RNR B;  2COC A;  2HE7 A;  1UPQ A;  2Z0P A;  4Z2N A;  3CIK A;  3F0W A;  4A6K A;  4D0N B;  1UNR A;  2Z0Q A;  5J3Q A;  1H10 A;  4ZRK A;  4F7H A;  2J0M A;  3PVL A;  1WJ1 A;  3D8D A;  1P6S A;  3V5W A;  5C16 A;  1J19 A;  2ROV A;  5DHA B;  2QKL A;  3HK0 A;  1FGZ A;  3D8E A;  3P7Z A;  4WVF B;  1EGX A;  1P5T A;  1LW3 A;  3UZT A;  2OTX A;  4TYZ A;  1Z87 A;  2RUK B;  4H8S A;  4IAP A;  2K2J A;  4HB0 B;  5KQ1 A;  3ULB A;  3TCA A;  3BIN A;  3SV1 A;  1OQN A;  3MDB C;  2L1C A;  2LYD A;  2YT1 A;  1DDV A;  3AU4 A;  1V5M A;  2DN6 A;  1EAZ A;  2KCJ A;  2NMB A;  5D27 A;  2W2X C;  4HHV A;  3A8P A;  3N7C A;  4EMO A;  2D9X A;  1K5D B;  1NU2 A;  2GS0 A;  5FI1 A;  1N3H A;  1WGU A;  3ODX A;  4K2P A;  4YL8 A;  1EF1 A;  1DRO A;  2DKQ A;  1KI1 B;  1WGQ A;  4MK0 A;  5C5B A;  2D2Q A;  1V5U A;  2RGN B;  2EC1 A;  2D10 A;  2X18 A;  1UEF A;  5CLQ B;  4PNK A;  2R09 A;  4ZRJ A;  1EVH A;  3PVW A;  2UVM A;  1BAK A;  4IFS A;  2MFQ A;  1RJ2 A;  4HAW B;  4P7I A;  3OAN A;  5DI9 B;  3TVV A;  1ZC3 B;  2K2U A;  1GC6 A;  3PZD A;  1GG3 A;  2J59 M;  3ODW A;  2J0K A;  2GJY A;  2CY5 A;  2FJL A;  4MY6 A;  1W1D A;  3D8F A; 
#chains in the Genus database with same CATH topology
 5CLL B;  1PFJ A;  2R2Y A;  3TFM A;  1J0W A;  1V5P A;  2COD A;  2E2X A;  2J0J A;  2ADZ A;  2I1J A;  5HE3 A;  4A6H A;  5JHG A;  5D3W A;  3LJU X;  2AEH A;  4GNK B;  3QWM A;  5JLJ B;  3HQC A;  3T06 A;  2H7E A;  2I5C A;  1ZC4 B;  2NBV A;  3A58 A;  1SGH A;  3KRW A;  2W2W A;  2IFS A;  4WSF A;  4BBK A;  1XX0 A;  4HDO A;  4MT7 A;  2YSZ A;  1DDM A;  2DYQ A;  3U8Z A;  1WG7 A;  3ZDT A;  4K2O A;  1AQC A;  1FHO A;  4DXA B;  4K81 A;  3SNH A;  3M1I B;  1UNP A;  4HDQ A;  1GC7 A;  4QJ3 B;  1ZM0 A;  1FB8 A;  1AWE A;  3PVU A;  2YT0 A;  4KHO A;  1IRS A;  4GXB A;  4HB2 B;  2DX5 A;  1NTY A;  1ZSQ A;  4HAV B;  4TKN A;  1FAO A;  1KZ7 A;  5D3V A;  1X86 A;  5D3Y A;  3KY9 A;  2N23 A;  5IRS A;  3NW8 A;  3BJI A;  2KIE A;  3WYF B;  3VIA A;  2VKI A;  1U5E A;  3TO1 A;  1XKE A;  2CAY A;  2H7D A;  3A8Q A;  1W1H A;  1I7A A;  2D4Q A;  4KHA A;  4F7U P;  1UNQ A;  2DTC A;  3ULC A;  4L6E A;  2KGX B;  3ODO A;  2K00 A;  3HIE A;  5C5B B;  4PQ0 A;  1DYN A;  1FOE A;  3ML4 A;  1B55 A;  3U7D A;  4NY0 A;  2D9W A;  1V89 A;  4DX8 A;  2V76 A;  1H4R A;  2DHI A;  3HSA A;  2YVC A;  3PP2 A;  2GCJ A;  3G9W A;  2EMT A;  4HAU B;  2Z0O A;  2NZ8 B;  2RVB B;  2P0D A;  2M14 A;  1K5G B;  2HTH B;  2RSG A;  1LB1 A;  5I2S A;  1X05 A;  2JP2 A;  3DXD A;  2DHJ A;  2BCJ A;  4HAY B;  4A5K A;  2Z4D A;  1P3R A;  4EKU A;  1MIX A;  3KRX A;  4XWX A;  5J3T A;  3DXE A;  5LOP B;  1OY2 A;  3DCX A;  5KCV A;  5KQ4 A;  2W2X D;  3SO6 A;  3QBV B;  1U5G A;  1XCG A;  1Y5O A;  1MKE A;  2VSZ A;  5JHH A;  4L1R A;  4OT1 A;  1MPH A;  2GCL A;  5FI0 A;  3FM8 C;  2MDX A;  4GMV A;  4DIX A;  3IVF A;  1W1G A;  4GN1 A;  5D3X A;  2N0Y A;  1X1G A;  2Z14 A;  1MK7 B;  2Y7B A;  2KUQ A;  4DBB A;  4WJ7 A;  5M4Y B;  2DFK A;  2DLW A;  5C79 A;  1X11 A;  1TXD A;  1M7R A;  2IYB A;  2YS1 A;  4Y94 A;  2EMS A;  1WI1 A;  2UZS A;  2DX1 A;  4ZRI A;  4K17 A;  5HE0 A;  4HAZ B;  2P8V A;  4GOU A;  4HAX B;  4QJ5 B;  2Z13 A;  1I2H A;  1KZG A;  2ELA A;  1XR0 B;  4CYE A;  2K8E A;  1V88 A;  5DH9 B;  4B6H A;  1XOD A;  4HAT B;  4GMX B;  2DHK A;  1QQG A;  3NWF A;  2ZPY A;  5EFX A;  5I2M A;  1MIZ B;  3CXB B;  1FHX A;  1Q67 A;  3KSY A;  4A6F A;  3HW2 B;  3KZ1 A;  1PMS A;  1TQZ A;  3GYP A;  1E5W A;  2CY4 A;  4YON A;  1DBH A;  1TJ6 A;  1QC6 A;  1XD4 A;  3P6A A;  3SUZ A;  1FGY A;  1UPR A;  2FJU B;  5HE1 A;  1PLS A;  3PG7 A;  4KAX B;  3ZVR A;  1M7E A;  1U5D A;  5LON B;  3FSS A;  1X1F A;  1WVH A;  2R0D A;  2I1K A;  1ISN A;  2D11 A;  2COF A;  2AL6 A;  2K49 A;  2YS3 A;  4CHJ A;  3PSC A;  5GOW B;  5C6R A;  3RCP A;  1WJM A;  2CRF A;  4GPT B;  1MK9 B;  1FHW A;  2LOX A;  2LUL A;  4CSQ A;  2QKM A;  1RRP B;  1U2B A;  4C0A A;  2MWN B;  4NSW A;  2XQN M;  2Q13 A;  2DYN A;  2Y8F A;  3DXC A;  2G35 A;  3WA0 A;  3F5R A;  4A6F B;  1BTN A;  3FVC A;  1BTK A;  2VRW B;  5L81 A;  1BWN A;  2DA0 A;  1V61 A;  3NWD A;  3TW1 A;  1U5F A;  3AU5 A;  1U27 A;  2L2I A;  2LKO A;  5J3Y A;  3PEG A;  3SYX A;  2D9Z A;  2MKR A;  2YF0 A;  2OQB A;  4OSN A;  1ZVR A;  5JP4 A;  2M38 A;  4HB4 B;  2KIG A;  2YRY A;  4CHM A;  4GZU A;  2COA A;  4HB3 B;  1DDW A;  4EJN A;  4KHB B;  3OHM B;  2ELB A;  3VOQ A;  3MPX A;  4Z2M B;  2LOZ A;  2P0H A;  2KUP A;  3X23 A;  4KVG B;  1T77 A;  4F7G A;  3U12 A;  2RRF A;  2ZKM X;  1NI2 A;  5DIF B;  2UZR A;  2ROZ B;  3NWA A;  2YS5 A;  3AJ4 A;  4DX9 0;  2LG1 A;  2I5F A;  2EJ8 A;  5HE2 A;  1NTV A;  3GYO A;  2Y8G A;  1OMW A;  2P0F A;  3O96 A;  1U29 A;  2D9Y A;  4IOY X;  2PZ1 A;  3NSU A;  3FEH A;  2DKP A;  1Y19 B;  1SHC A;  1MAI A;  3QIJ A;  3A98 B;  2RLO A;  5DHF B;  2D9V A;  2RNR B;  2COC A;  2HE7 A;  1UPQ A;  2Z0P A;  4Z2N A;  3CIK A;  3F0W A;  3B77 A;  4A6K A;  4D0N B;  1UNR A;  2Z0Q A;  5J3Q A;  1H10 A;  4ZRK A;  4F7H A;  2J0M A;  3PVL A;  1WJ1 A;  3D8D A;  1P6S A;  3V5W A;  5C16 A;  1J19 A;  1ZYI A;  2ROV A;  5DHA B;  2QKL A;  3HK0 A;  1FGZ A;  3D8E A;  3P7Z A;  4WVF B;  1EGX A;  1P5T A;  1MI1 A;  4QXA B;  1LW3 A;  3UZT A;  2OTX A;  4TYZ A;  1Z87 A;  2RUK B;  4H8S A;  4IAP A;  2K2J A;  4HB0 B;  5KQ1 A;  3ULB A;  3TCA A;  3BIN A;  4D6W A;  2KR0 A;  3SV1 A;  1OQN A;  3MDB C;  2L1C A;  2LYD A;  2YT1 A;  1DDV A;  3AU4 A;  1V5M A;  5LG4 B;  2DN6 A;  1EAZ A;  2KCJ A;  2NMB A;  5D27 A;  2W2X C;  4HHV A;  3A8P A;  3N7C A;  4EMO A;  2D9X A;  1K5D B;  1NU2 A;  2GS0 A;  5FI1 A;  1N3H A;  1WGU A;  3ODX A;  2YT2 A;  4K2P A;  4YL8 A;  1EF1 A;  4QJ4 B;  1DRO A;  2GUM A;  2DKQ A;  1KI1 B;  1WGQ A;  4MK0 A;  5C5B A;  4KHB A;  2D2Q A;  1V5U A;  2RGN B;  2EC1 A;  2D10 A;  2X18 A;  1UEF A;  2Z59 A;  5CLQ B;  4PNK A;  2R09 A;  4ZRJ A;  1EVH A;  3PVW A;  2UVM A;  1BAK A;  4IFS A;  2MFQ A;  1RJ2 A;  4HAW B;  4P7I A;  3OAN A;  5DI9 B;  3TVV A;  1ZC3 B;  2K2U A;  1GC6 A;  3PZD A;  1GG3 A;  2J59 M;  3ODW A;  2J0K A;  2GJY A;  2CY5 A;  2FJL A;  4MY6 A;  4HSI A;  1W1D A;  3D8F A; 
#chains in the Genus database with same CATH homology
 5CLL B;  1PFJ A;  3TFM A;  1J0W A;  1V5P A;  2COD A;  2E2X A;  2J0J A;  2ADZ A;  2I1J A;  5HE3 A;  4A6H A;  5JHG A;  5D3W A;  3LJU X;  2AEH A;  3QWM A;  5JLJ B;  3HQC A;  3T06 A;  2H7E A;  2I5C A;  1ZC4 B;  1SGH A;  3KRW A;  2W2W A;  2IFS A;  4WSF A;  4BBK A;  1XX0 A;  4HDO A;  4MT7 A;  2YSZ A;  1DDM A;  2DYQ A;  3U8Z A;  1WG7 A;  3ZDT A;  4K2O A;  1AQC A;  1FHO A;  4DXA B;  4K81 A;  3SNH A;  3M1I B;  1UNP A;  4HDQ A;  1GC7 A;  1ZM0 A;  1FB8 A;  1AWE A;  3PVU A;  2YT0 A;  4KHO A;  1IRS A;  4GXB A;  4HB2 B;  2DX5 A;  1NTY A;  1ZSQ A;  4HAV B;  4TKN A;  1FAO A;  1KZ7 A;  5D3V A;  1X86 A;  5D3Y A;  3KY9 A;  2N23 A;  3BJI A;  3WYF B;  3VIA A;  2VKI A;  1U5E A;  3TO1 A;  1XKE A;  2CAY A;  2H7D A;  3A8Q A;  1W1H A;  1I7A A;  2D4Q A;  4KHA A;  4F7U P;  1UNQ A;  2DTC A;  3ULC A;  4L6E A;  2KGX B;  3ODO A;  2K00 A;  5C5B B;  4PQ0 A;  1DYN A;  1FOE A;  3ML4 A;  1B55 A;  3U7D A;  4NY0 A;  2D9W A;  1V89 A;  4DX8 A;  2V76 A;  1H4R A;  2DHI A;  2YVC A;  3PP2 A;  2GCJ A;  3G9W A;  2EMT A;  4HAU B;  2Z0O A;  2NZ8 B;  2RVB B;  2P0D A;  2M14 A;  1K5G B;  2HTH B;  2RSG A;  1LB1 A;  1X05 A;  2JP2 A;  3DXD A;  2DHJ A;  2BCJ A;  4HAY B;  4A5K A;  1P3R A;  4EKU A;  1MIX A;  3KRX A;  4XWX A;  5J3T A;  3DXE A;  5LOP B;  1OY2 A;  5KCV A;  5KQ4 A;  2W2X D;  3SO6 A;  3QBV B;  1U5G A;  1XCG A;  1Y5O A;  1MKE A;  2VSZ A;  5JHH A;  1MPH A;  2GCL A;  5FI0 A;  3FM8 C;  2MDX A;  4GMV A;  3IVF A;  1W1G A;  4GN1 A;  5D3X A;  2N0Y A;  1X1G A;  1MK7 B;  2Y7B A;  4DBB A;  4WJ7 A;  2DFK A;  2DLW A;  5C79 A;  1X11 A;  1TXD A;  1M7R A;  2IYB A;  2YS1 A;  4Y94 A;  2EMS A;  1WI1 A;  2UZS A;  2DX1 A;  4ZRI A;  4K17 A;  5HE0 A;  4HAZ B;  2P8V A;  4HAX B;  1I2H A;  1KZG A;  2ELA A;  1XR0 B;  4CYE A;  1V88 A;  5DH9 B;  4B6H A;  1XOD A;  4HAT B;  4GMX B;  2DHK A;  1QQG A;  2ZPY A;  5EFX A;  1MIZ B;  3CXB B;  1FHX A;  1Q67 A;  3KSY A;  4A6F A;  3HW2 B;  3KZ1 A;  1PMS A;  1TQZ A;  3GYP A;  1E5W A;  2CY4 A;  4YON A;  1DBH A;  1TJ6 A;  1QC6 A;  1XD4 A;  3P6A A;  3SUZ A;  1FGY A;  1UPR A;  5HE1 A;  1PLS A;  3PG7 A;  4KAX B;  3ZVR A;  1M7E A;  1U5D A;  5LON B;  3FSS A;  1X1F A;  1WVH A;  2R0D A;  2I1K A;  1ISN A;  2D11 A;  2COF A;  2AL6 A;  2YS3 A;  4CHJ A;  3PSC A;  5GOW B;  5C6R A;  3RCP A;  1WJM A;  2CRF A;  4GPT B;  1MK9 B;  1FHW A;  2LOX A;  2LUL A;  2QKM A;  1RRP B;  1U2B A;  4C0A A;  2MWN B;  4NSW A;  2XQN M;  2Q13 A;  2DYN A;  2Y8F A;  3DXC A;  2G35 A;  3WA0 A;  3F5R A;  4A6F B;  1BTN A;  1BTK A;  2VRW B;  5L81 A;  1BWN A;  2DA0 A;  1V61 A;  3TW1 A;  1U5F A;  3AU5 A;  1U27 A;  2L2I A;  2LKO A;  5J3Y A;  3PEG A;  3SYX A;  2D9Z A;  2MKR A;  2YF0 A;  2OQB A;  1ZVR A;  5JP4 A;  2M38 A;  4HB4 B;  2YRY A;  4CHM A;  4GZU A;  2COA A;  4HB3 B;  1DDW A;  4EJN A;  4KHB B;  2ELB A;  3VOQ A;  3MPX A;  4Z2M B;  2LOZ A;  2P0H A;  2KUP A;  3X23 A;  4KVG B;  4F7G A;  1NI2 A;  5DIF B;  2UZR A;  2ROZ B;  2YS5 A;  3AJ4 A;  4DX9 0;  2LG1 A;  2I5F A;  2EJ8 A;  5HE2 A;  1NTV A;  3GYO A;  2Y8G A;  1OMW A;  2P0F A;  3O96 A;  1U29 A;  2D9Y A;  4IOY X;  2PZ1 A;  3NSU A;  3FEH A;  2DKP A;  1Y19 B;  1SHC A;  1MAI A;  3QIJ A;  3A98 B;  2RLO A;  5DHF B;  2D9V A;  2RNR B;  2COC A;  2HE7 A;  1UPQ A;  2Z0P A;  4Z2N A;  3CIK A;  3F0W A;  4A6K A;  4D0N B;  1UNR A;  2Z0Q A;  5J3Q A;  1H10 A;  4ZRK A;  4F7H A;  2J0M A;  3PVL A;  1WJ1 A;  3D8D A;  1P6S A;  3V5W A;  5C16 A;  1J19 A;  2ROV A;  5DHA B;  2QKL A;  3HK0 A;  1FGZ A;  3D8E A;  3P7Z A;  4WVF B;  1EGX A;  1P5T A;  1LW3 A;  3UZT A;  2OTX A;  4TYZ A;  1Z87 A;  2RUK B;  4H8S A;  4IAP A;  2K2J A;  4HB0 B;  5KQ1 A;  3ULB A;  3TCA A;  3BIN A;  3SV1 A;  1OQN A;  3MDB C;  2L1C A;  2LYD A;  2YT1 A;  1DDV A;  3AU4 A;  1V5M A;  2DN6 A;  1EAZ A;  2KCJ A;  2NMB A;  5D27 A;  2W2X C;  4HHV A;  3A8P A;  3N7C A;  4EMO A;  2D9X A;  1K5D B;  1NU2 A;  2GS0 A;  5FI1 A;  1N3H A;  1WGU A;  3ODX A;  4K2P A;  4YL8 A;  1EF1 A;  1DRO A;  2DKQ A;  1KI1 B;  1WGQ A;  4MK0 A;  5C5B A;  2D2Q A;  1V5U A;  2RGN B;  2EC1 A;  2D10 A;  2X18 A;  1UEF A;  5CLQ B;  4PNK A;  2R09 A;  4ZRJ A;  1EVH A;  3PVW A;  2UVM A;  1BAK A;  4IFS A;  2MFQ A;  1RJ2 A;  4HAW B;  4P7I A;  3OAN A;  5DI9 B;  3TVV A;  1ZC3 B;  2K2U A;  1GC6 A;  3PZD A;  1GG3 A;  2J59 M;  3ODW A;  2J0K A;  2GJY A;  2CY5 A;  2FJL A;  4MY6 A;  1W1D A;  3D8F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...