4GPTB

Crystal structure of kpt251 in complex with crm1-ran-ranbp1
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
123
structure length
123
Chain Sequence
TAEEDEEVLYKVRAKLFRFDKDAKEWKERGTGDCKFLKNKKTNKVRILMRRDKTLKICANHIIAPEYTLKPNVGSDRSWVYACTADIAEGEAEAFTFAIRFGSKENADKFKEEFEKAQEINKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Antileukemic activity of nuclear export inhibitors that spare normal hematopoietic cells.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport/inhibitor
molecule keywords GTP-binding nuclear protein Ran
total genus 31
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2012-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00638 Ran_BP1 RanBP1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4gptB00
2H7EA 3ZVRA 4KHBB 1FGZA 1U27A 3CXBB 3LJUX 3WYFB 2XQNM 1UNRA 1X11A 1P5TA 4XWXA 4F7HA 1XKEA 3KRXA 2MFQA 4K2PA 1QQGA 2AL6A 1Z87A 2RGNB 4MK0A 3SNHA 3DXDA 2I5FA 2COAA 2CRFA 2Z0OA 2W2XD 2I1JA 1FB8A 2RLOA 3PSCA 4K17A 3F5RA 2LULA 3QBVB 5HE3A 2EMTA 4A6FA 2JP2A 2NZ8B 2QKLA 2D2QA 2J0MA 3SV1A 1LW3A 1QC6A 4GZUA 3P6AA 2I1KA 4ZRKA 4GPTB 4HAWB 1UEFA 2J0JA 2HTHB 1AWEA 2ELAA 4DXAB 1GC7A 1U5DA 5KQ1A 4Z2NA 1NTVA 5C5BA 1B55A 4HDQA 3PVLA 3D8DA 1NTYA 3KSYA 5CLQB 3D8FA 2K2JA 3PZDA 2Y8GA 2YS1A 1H10A 3ZDTA 1Q67A 2OQBA 2P0DA 2Z0QA 4HB3B 5DI9B 4C0AA 1DDMA 1J0WA 2YS5A 1ZVRA 5L81A 2Z0PA 4IAPA 2YS3A 2N23A 2P8VA 2DHJA 5J3TA 3HQCA 1WJMA 1XD4A 5HE0A 4HAZB 2KGXB 3GYOA 2R09A 5LOPB 1LB1A 2G35A 3WA0A 4EMOA 2BCJA 2CODA 4ZRJA 1U5FA 4CHJA 5KQ4A 2M38A 1W1HA 1MK7B 4DX90 4KHOA 1E5WA 2Y8FA 3TVVA 5GOWB 3ODXA 1KZ7A 1SGHA 1U5EA 1OMWA 2W2XC 1TXDA 4NSWA 1V5MA 3A8PA 2D9XA 1UPQA 4L6EA 2D9YA 5JLJB 2E2XA 4GMXB 1V5UA 1TJ6A 1AQCA 3AU5A 2ELBA 1RRPB 2COCA 4B6HA 4KHAA 3BINA 3ODOA 2LOXA 3ODWA 1M7RA 2KCJA 2DX5A 2CAYA 1UNPA 2DYNA 2FJLA 2YF0A 4Z2MB 2EMSA 4HDOA 1I7AA 1FAOA 4HATB 4A6HA 5D27A 1XX0A 1EAZA 3FM8C 4HHVA 4HB2B 2W2WA 5D3VA 2DN6A 3P7ZA 4WJ7A 3TW1A 2MWNB 3PEGA 2IFSA 2DYQA 4A6FB 5HE2A 2P0FA 1MAIA 3HK0A 3FSSA 4CHMA 4MY6A 4PQ0A 2M14A 3U7DA 2ROZB 4GXBA 5DHAB 2N0YA 2CY4A 1MK9B 1PMSA 3MPXA 1FHWA 1X1GA 2EC1A 2MDXA 2K2UA 3U8ZA 2RNRB 1P3RA 1X05A 5KCVA 1UNQA 4Y94A 2D10A 1FOEA 1MPHA 3BJIA 1BTNA 4F7UP 2EJ8A 1Y5OA 4HAUB 3GYPA 1MKEA 3T06A 2I5CA 1IRSA 5EFXA 4ZRIA 2GCJA 1H4RA 1U2BA 3PVUA 3A8QA 3G9WA 4PNKA 4HB4B 2DHKA 2HE7A 3MDBC 4K81A 5CLLB 1FGYA 3KRWA 3UZTA 2AEHA 2VKIA 2RVBB 2KUPA 4DBBA 2DKQA 2MKRA 1V88A 3F0WA 1MIXA 3O96A 4IFSA 4HB0B 4EJNA 1OY2A 1BAKA 1DDWA 3N7CA 1Y19B 5LONB 1PFJA 4TYZA 2LG1A 1V61A 4WSFA 5FI0A 5D3YA 3RCPA 2P0HA 2LYDA 4GMVA 4HAXB 2GS0A 1ZC3B 3ULCA 2GCLA 2J59M 1EGXA 2UZSA 1WGUA 2IYBA 4BBKA 1SHCA 2VRWB 1V5PA 4DX8A 2DA0A 3KZ1A 4K2OA 4NY0A 3V5WA 2L2IA 3PVWA 4CYEA 1UPRA 5DHFB 1XR0B 2UZRA 4A6KA 2NMBA 5HE1A 2D9ZA 2H7DA 5D3XA 5C6RA 4YONA 3TFMA 3PG7A 1GC6A 2K00A 1RJ2A 3AJ4A 3VOQA 4KVGB 2YSZA 1OQNA 2D4QA 3DXEA 1NI2A 4MT7A 1XODA 4D0NB 3NSUA 1ZC4B 3CIKA 2QKMA 4TKNA 1K5DB 5JHGA 3KY9A 1DDVA 1J19A 2LOZA 2DHIA 3TCAA 3ML4A 2DFKA 1KZGA 2RSGA 2RUKB 2R0DA 4YL8A 3X23A 2DX1A 3HW2B 1ZSQA 1DBHA 5DIFB 3FEHA 1NU2A 3QIJA 3D8EA 4IOYX 3VIAA 1PLSA 5JHHA 1WVHA 2YVCA 4HAVB 5FI1A 1FHOA 4HAYB 3DXCA 2LKOA 2VSZA 1DROA 3ULBA 1EVHA 2YT0A 2ROVA 5DH9B 3PP2A 3SO6A 1W1DA 4P7IA 3TO1A 3OANA 5JP4A 1X1FA 4EKUA 2CY5A 4WVFB 2DTCA 2D11A 2ZPYA 3SYXA 4GN1A 4F7GA 1X86A 2Q13A 1M7EA 1N3HA 1ISNA 1WI1A 1K5GB 2L1CA 3AU4A 1P6SA 1U5GA 2GJYA 2DKPA 1I2HA 2YT1A 4KAXB 4H8SA 3QWMA 4A5KA 1KI1B 1WG7A 2X18A 2UVMA 1WGQA 5C16A 1V89A 1W1GA 5C79A 1EF1A 5C5BB 5J3QA 5D3WA 2J0KA 1GG3A 1XCGA 1ZM0A 2D9WA 2OTXA 1FHXA 2YRYA 1MIZB 2DLWA 1TQZA 5J3YA 2Y7BA 2D9VA 1DYNA 1U29A 2PZ1A 3M1IB 1BTKA 3IVFA 3A98B 3SUZA 2V76A 1WJ1A 1BWNA 2COFA 2ADZA
chains in the Genus database with same CATH superfamily
2H7EA 3ZVRA 4KHBB 1FGZA 1U27A 3CXBB 3LJUX 3WYFB 2XQNM 1UNRA 4D6WA 1X11A 2KIEA 1P5TA 4XWXA 4F7HA 1XKEA 3KRXA 2MFQA 4K2PA 1QQGA 2AL6A 1Z87A 2RGNB 4MK0A 3SNHA 3B77A 2I5FA 3DXDA 2COAA 2CRFA 2Z0OA 2W2XD 2I1JA 1FB8A 2RLOA 3DCXA 3PSCA 2Z59A 2ZKMX 4K17A 3F5RA 2LULA 2RRFA 3QBVB 5HE3A 2EMTA 4A6FA 2JP2A 2NZ8B 2QKLA 2D2QA 2J0MA 3SV1A 1LW3A 1QC6A 4GZUA 3P6AA 2I1KA 4ZRKA 4GPTB 4L1RA 4HAWB 1UEFA 2J0JA 2HTHB 1AWEA 2ELAA 4DXAB 1GC7A 1U5DA 5KQ1A 4Z2NA 1NTVA 5C5BA 1B55A 4HDQA 3PVLA 3D8DA 1NTYA 3KSYA 5CLQB 3D8FA 2K2JA 3PZDA 2Y8GA 2YS1A 2Z13A 1H10A 3ZDTA 1Q67A 2OQBA 2P0DA 2Z0QA 4HB3B 5DI9B 5I2SA 4C0AA 1DDMA 1J0WA 2YS5A 1ZVRA 5L81A 2Z0PA 4IAPA 2YS3A 2N23A 2P8VA 4GOUA 2DHJA 5J3TA 3HQCA 1WJMA 1XD4A 5HE0A 4HAZB 4KHBA 5I2MA 2KGXB 3GYOA 2R09A 5LOPB 2KR0A 1LB1A 2G35A 4QXAB 3WA0A 4EMOA 2BCJA 2CODA 4ZRJA 1U5FA 4CHJA 5KQ4A 2M38A 1W1HA 1MK7B 4DX90 4KHOA 1E5WA 2Y8FA 3TVVA 5GOWB 3ODXA 1KZ7A 1SGHA 1U5EA 1OMWA 1ZYIA 2W2XC 1TXDA 4NSWA 1V5MA 3A8PA 2D9XA 1UPQA 4L6EA 2D9YA 5JLJB 2E2XA 4GMXB 1V5UA 1TJ6A 1AQCA 3AU5A 2ELBA 1RRPB 2COCA 4B6HA 4KHAA 3BINA 3ODOA 2LOXA 3ODWA 1M7RA 2KCJA 2DX5A 2CAYA 1UNPA 2DYNA 2FJLA 2GUMA 2YF0A 4Z2MB 2EMSA 4HDOA 1I7AA 1FAOA 4HATB 4A6HA 5D27A 4OT1A 1XX0A 1EAZA 3FM8C 4HHVA 4HB2B 2W2WA 5D3VA 2DN6A 3P7ZA 4WJ7A 3TW1A 2MWNB 3PEGA 2IFSA 2DYQA 3NWFA 4A6FB 5HE2A 2P0FA 1MAIA 3HK0A 3FSSA 4CHMA 4MY6A 4PQ0A 2M14A 3U7DA 2R2YA 2ROZB 4GXBA 5DHAB 2N0YA 2CY4A 1MK9B 1PMSA 3MPXA 1FHWA 1X1GA 2EC1A 2MDXA 2K2UA 3U8ZA 2RNRB 1P3RA 1X05A 5KCVA 3OHMB 5M4YB 1UNQA 4Y94A 2D10A 4QJ4B 1FOEA 1MPHA 3BJIA 1BTNA 4F7UP 2EJ8A 1Y5OA 4HAUB 3GYPA 1MKEA 3T06A 2I5CA 1IRSA 5EFXA 4ZRIA 2GCJA 1H4RA 1U2BA 3PVUA 3A8QA 3G9WA 4PNKA 4HB4B 2DHKA 2HE7A 3MDBC 4K81A 5CLLB 2Z14A 3A58A 1FGYA 3KRWA 3UZTA 2AEHA 2VKIA 3HIEA 2RVBB 2KUPA 4DBBA 2DKQA 2MKRA 1V88A 3F0WA 1MIXA 3O96A 4IFSA 2KUQA 4HB0B 4EJNA 1OY2A 1BAKA 2K8EA 1DDWA 3N7CA 1Y19B 5LONB 1PFJA 4TYZA 2LG1A 1V61A 4WSFA 5FI0A 5D3YA 3RCPA 2P0HA 2LYDA 4GMVA 5LG4B 4HAXB 2GS0A 1ZC3B 4QJ3B 3ULCA 2GCLA 2J59M 1EGXA 2UZSA 1WGUA 2IYBA 4BBKA 1SHCA 2VRWB 1V5PA 4DX8A 1T77A 2DA0A 3KZ1A 4K2OA 4NY0A 3V5WA 2L2IA 3PVWA 4CYEA 4OSNA 1UPRA 5DHFB 1XR0B 2UZRA 4A6KA 2NMBA 5HE1A 2D9ZA 2H7DA 5D3XA 5C6RA 4YONA 3TFMA 3PG7A 1GC6A 2YT2A 2K00A 1RJ2A 3AJ4A 4GNKB 3VOQA 4KVGB 2YSZA 1OQNA 2D4QA 3DXEA 1NI2A 4MT7A 1XODA 4D0NB 2NBVA 3NSUA 1ZC4B 3CIKA 2QKMA 3NW8A 4TKNA 1K5DB 5JHGA 3KY9A 1DDVA 1J19A 2LOZA 2DHIA 3TCAA 3ML4A 2DFKA 1KZGA 2RSGA 2RUKB 5IRSA 2R0DA 4YL8A 3X23A 2DX1A 3HW2B 1ZSQA 1DBHA 5DIFB 3FEHA 1NU2A 2Z4DA 3QIJA 3D8EA 3U12A 4IOYX 3VIAA 4QJ5B 1PLSA 5JHHA 1WVHA 3NWDA 2YVCA 4HAVB 5FI1A 1FHOA 4HAYB 3DXCA 2LKOA 2VSZA 1DROA 3ULBA 1EVHA 2YT0A 2ROVA 5DH9B 4CSQA 3PP2A 3SO6A 3NWAA 1W1DA 4P7IA 3TO1A 3OANA 5JP4A 1X1FA 4EKUA 2CY5A 4WVFB 2DTCA 2D11A 2ZPYA 3HSAA 3SYXA 4GN1A 4F7GA 1X86A 2Q13A 1M7EA 1N3HA 1ISNA 1WI1A 1K5GB 2L1CA 3AU4A 1P6SA 1U5GA 2GJYA 2DKPA 1I2HA 2YT1A 2KIGA 4KAXB 2K49A 4H8SA 3QWMA 4A5KA 1KI1B 1WG7A 2X18A 1MI1A 3FVCA 2UVMA 1WGQA 5C16A 1V89A 1W1GA 5C79A 1EF1A 5C5BB 5J3QA 5D3WA 2J0KA 1GG3A 1XCGA 1ZM0A 2D9WA 2OTXA 1FHXA 2YRYA 1MIZB 2FJUB 4DIXA 2DLWA 1TQZA 5J3YA 2Y7BA 4HSIA 2D9VA 1DYNA 1U29A 2PZ1A 3M1IB 1BTKA 3IVFA 3A98B 3SUZA 2V76A 1WJ1A 1BWNA 2COFA 2ADZA
chains in the Genus database with same CATH topology
2H7EA 3ZVRA 4KHBB 1FGZA 1U27A 3CXBB 3LJUX 3WYFB 2XQNM 1UNRA 1X11A 1P5TA 4XWXA 4F7HA 1XKEA 3KRXA 2MFQA 4K2PA 1QQGA 2AL6A 1Z87A 2RGNB 4MK0A 3SNHA 3DXDA 2I5FA 2COAA 2CRFA 2Z0OA 2W2XD 2I1JA 1FB8A 2RLOA 3PSCA 4K17A 3F5RA 2LULA 3QBVB 5HE3A 2EMTA 4A6FA 2JP2A 2NZ8B 2QKLA 2D2QA 2J0MA 3SV1A 1LW3A 1QC6A 4GZUA 3P6AA 2I1KA 4ZRKA 4GPTB 4HAWB 1UEFA 2J0JA 2HTHB 1AWEA 2ELAA 4DXAB 1GC7A 1U5DA 5KQ1A 4Z2NA 1NTVA 5C5BA 1B55A 4HDQA 3PVLA 3D8DA 1NTYA 3KSYA 5CLQB 3D8FA 2K2JA 3PZDA 2Y8GA 2YS1A 1H10A 3ZDTA 1Q67A 2OQBA 2P0DA 2Z0QA 4HB3B 5DI9B 4C0AA 1DDMA 1J0WA 2YS5A 1ZVRA 5L81A 2Z0PA 4IAPA 2YS3A 2N23A 2P8VA 2DHJA 5J3TA 3HQCA 1WJMA 1XD4A 5HE0A 4HAZB 2KGXB 3GYOA 2R09A 5LOPB 1LB1A 2G35A 3WA0A 4EMOA 2BCJA 2CODA 4ZRJA 1U5FA 4CHJA 5KQ4A 2M38A 1W1HA 1MK7B 4DX90 4KHOA 1E5WA 2Y8FA 3TVVA 5GOWB 3ODXA 1KZ7A 1SGHA 1U5EA 1OMWA 2W2XC 1TXDA 4NSWA 1V5MA 3A8PA 2D9XA 1UPQA 4L6EA 2D9YA 5JLJB 2E2XA 4GMXB 1V5UA 1TJ6A 1AQCA 3AU5A 2ELBA 1RRPB 2COCA 4B6HA 4KHAA 3BINA 3ODOA 2LOXA 3ODWA 1M7RA 2KCJA 2DX5A 2CAYA 1UNPA 2DYNA 2FJLA 2YF0A 4Z2MB 2EMSA 4HDOA 1I7AA 1FAOA 4HATB 4A6HA 5D27A 1XX0A 1EAZA 3FM8C 4HHVA 4HB2B 2W2WA 5D3VA 2DN6A 3P7ZA 4WJ7A 3TW1A 2MWNB 3PEGA 2IFSA 2DYQA 4A6FB 5HE2A 2P0FA 1MAIA 3HK0A 3FSSA 4CHMA 4MY6A 4PQ0A 2M14A 3U7DA 2ROZB 4GXBA 5DHAB 2N0YA 2CY4A 1MK9B 1PMSA 3MPXA 1FHWA 1X1GA 2EC1A 2MDXA 2K2UA 3U8ZA 2RNRB 1P3RA 1X05A 5KCVA 1UNQA 4Y94A 2D10A 1FOEA 1MPHA 3BJIA 1BTNA 4F7UP 2EJ8A 1Y5OA 4HAUB 3GYPA 1MKEA 3T06A 2I5CA 1IRSA 5EFXA 4ZRIA 2GCJA 1H4RA 1U2BA 3PVUA 3A8QA 3G9WA 4PNKA 4HB4B 2DHKA 2HE7A 3MDBC 4K81A 5CLLB 1FGYA 3KRWA 3UZTA 2AEHA 2VKIA 2RVBB 2KUPA 4DBBA 2DKQA 2MKRA 1V88A 3F0WA 1MIXA 3O96A 4IFSA 4HB0B 4EJNA 1OY2A 1BAKA 1DDWA 3N7CA 1Y19B 5LONB 1PFJA 4TYZA 2LG1A 1V61A 4WSFA 5FI0A 5D3YA 3RCPA 2P0HA 2LYDA 4GMVA 4HAXB 2GS0A 1ZC3B 3ULCA 2GCLA 2J59M 1EGXA 2UZSA 1WGUA 2IYBA 4BBKA 1SHCA 2VRWB 1V5PA 4DX8A 2DA0A 3KZ1A 4K2OA 4NY0A 3V5WA 2L2IA 3PVWA 4CYEA 1UPRA 5DHFB 1XR0B 2UZRA 4A6KA 2NMBA 5HE1A 2D9ZA 2H7DA 5D3XA 5C6RA 4YONA 3TFMA 3PG7A 1GC6A 2K00A 1RJ2A 3AJ4A 3VOQA 4KVGB 2YSZA 1OQNA 2D4QA 3DXEA 1NI2A 4MT7A 1XODA 4D0NB 3NSUA 1ZC4B 3CIKA 2QKMA 4TKNA 1K5DB 5JHGA 3KY9A 1DDVA 1J19A 2LOZA 2DHIA 3TCAA 3ML4A 2DFKA 1KZGA 2RSGA 2RUKB 2R0DA 4YL8A 3X23A 2DX1A 3HW2B 1ZSQA 1DBHA 5DIFB 3FEHA 1NU2A 3QIJA 3D8EA 4IOYX 3VIAA 1PLSA 5JHHA 1WVHA 2YVCA 4HAVB 5FI1A 1FHOA 4HAYB 3DXCA 2LKOA 2VSZA 1DROA 3ULBA 1EVHA 2YT0A 2ROVA 5DH9B 3PP2A 3SO6A 1W1DA 4P7IA 3TO1A 3OANA 5JP4A 1X1FA 4EKUA 2CY5A 4WVFB 2DTCA 2D11A 2ZPYA 3SYXA 4GN1A 4F7GA 1X86A 2Q13A 1M7EA 1N3HA 1ISNA 1WI1A 1K5GB 2L1CA 3AU4A 1P6SA 1U5GA 2GJYA 2DKPA 1I2HA 2YT1A 4KAXB 4H8SA 3QWMA 4A5KA 1KI1B 1WG7A 2X18A 2UVMA 1WGQA 5C16A 1V89A 1W1GA 5C79A 1EF1A 5C5BB 5J3QA 5D3WA 2J0KA 1GG3A 1XCGA 1ZM0A 2D9WA 2OTXA 1FHXA 2YRYA 1MIZB 2DLWA 1TQZA 5J3YA 2Y7BA 2D9VA 1DYNA 1U29A 2PZ1A 3M1IB 1BTKA 3IVFA 3A98B 3SUZA 2V76A 1WJ1A 1BWNA 2COFA 2ADZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H7E A;  3ZVR A;  4KHB B;  1FGZ A;  1U27 A;  3CXB B;  3LJU X;  3WYF B;  2XQN M;  1UNR A;  1X11 A;  1P5T A;  4XWX A;  4F7H A;  1XKE A;  3KRX A;  2MFQ A;  4K2P A;  1QQG A;  2AL6 A;  1Z87 A;  2RGN B;  4MK0 A;  3SNH A;  3DXD A;  2I5F A;  2COA A;  2CRF A;  2Z0O A;  2W2X D;  2I1J A;  1FB8 A;  2RLO A;  3PSC A;  4K17 A;  3F5R A;  2LUL A;  3QBV B;  5HE3 A;  2EMT A;  4A6F A;  2JP2 A;  2NZ8 B;  2QKL A;  2D2Q A;  2J0M A;  3SV1 A;  1LW3 A;  1QC6 A;  4GZU A;  3P6A A;  2I1K A;  4ZRK A;  4GPT B;  4HAW B;  1UEF A;  2J0J A;  2HTH B;  1AWE A;  2ELA A;  4DXA B;  1GC7 A;  1U5D A;  5KQ1 A;  4Z2N A;  1NTV A;  5C5B A;  1B55 A;  4HDQ A;  3PVL A;  3D8D A;  1NTY A;  3KSY A;  5CLQ B;  3D8F A;  2K2J A;  3PZD A;  2Y8G A;  2YS1 A;  1H10 A;  3ZDT A;  1Q67 A;  2OQB A;  2P0D A;  2Z0Q A;  4HB3 B;  5DI9 B;  4C0A A;  1DDM A;  1J0W A;  2YS5 A;  1ZVR A;  5L81 A;  2Z0P A;  4IAP A;  2YS3 A;  2N23 A;  2P8V A;  2DHJ A;  5J3T A;  3HQC A;  1WJM A;  1XD4 A;  5HE0 A;  4HAZ B;  2KGX B;  3GYO A;  2R09 A;  5LOP B;  1LB1 A;  2G35 A;  3WA0 A;  4EMO A;  2BCJ A;  2COD A;  4ZRJ A;  1U5F A;  4CHJ A;  5KQ4 A;  2M38 A;  1W1H A;  1MK7 B;  4DX9 0;  4KHO A;  1E5W A;  2Y8F A;  3TVV A;  5GOW B;  3ODX A;  1KZ7 A;  1SGH A;  1U5E A;  1OMW A;  2W2X C;  1TXD A;  4NSW A;  1V5M A;  3A8P A;  2D9X A;  1UPQ A;  4L6E A;  2D9Y A;  5JLJ B;  2E2X A;  4GMX B;  1V5U A;  1TJ6 A;  1AQC A;  3AU5 A;  2ELB A;  1RRP B;  2COC A;  4B6H A;  4KHA A;  3BIN A;  3ODO A;  2LOX A;  3ODW A;  1M7R A;  2KCJ A;  2DX5 A;  2CAY A;  1UNP A;  2DYN A;  2FJL A;  2YF0 A;  4Z2M B;  2EMS A;  4HDO A;  1I7A A;  1FAO A;  4HAT B;  4A6H A;  5D27 A;  1XX0 A;  1EAZ A;  3FM8 C;  4HHV A;  4HB2 B;  2W2W A;  5D3V A;  2DN6 A;  3P7Z A;  4WJ7 A;  3TW1 A;  2MWN B;  3PEG A;  2IFS A;  2DYQ A;  4A6F B;  5HE2 A;  2P0F A;  1MAI A;  3HK0 A;  3FSS A;  4CHM A;  4MY6 A;  4PQ0 A;  2M14 A;  3U7D A;  2ROZ B;  4GXB A;  5DHA B;  2N0Y A;  2CY4 A;  1MK9 B;  1PMS A;  3MPX A;  1FHW A;  1X1G A;  2EC1 A;  2MDX A;  2K2U A;  3U8Z A;  2RNR B;  1P3R A;  1X05 A;  5KCV A;  1UNQ A;  4Y94 A;  2D10 A;  1FOE A;  1MPH A;  3BJI A;  1BTN A;  4F7U P;  2EJ8 A;  1Y5O A;  4HAU B;  3GYP A;  1MKE A;  3T06 A;  2I5C A;  1IRS A;  5EFX A;  4ZRI A;  2GCJ A;  1H4R A;  1U2B A;  3PVU A;  3A8Q A;  3G9W A;  4PNK A;  4HB4 B;  2DHK A;  2HE7 A;  3MDB C;  4K81 A;  5CLL B;  1FGY A;  3KRW A;  3UZT A;  2AEH A;  2VKI A;  2RVB B;  2KUP A;  4DBB A;  2DKQ A;  2MKR A;  1V88 A;  3F0W A;  1MIX A;  3O96 A;  4IFS A;  4HB0 B;  4EJN A;  1OY2 A;  1BAK A;  1DDW A;  3N7C A;  1Y19 B;  5LON B;  1PFJ A;  4TYZ A;  2LG1 A;  1V61 A;  4WSF A;  5FI0 A;  5D3Y A;  3RCP A;  2P0H A;  2LYD A;  4GMV A;  4HAX B;  2GS0 A;  1ZC3 B;  3ULC A;  2GCL A;  2J59 M;  1EGX A;  2UZS A;  1WGU A;  2IYB A;  4BBK A;  1SHC A;  2VRW B;  1V5P A;  4DX8 A;  2DA0 A;  3KZ1 A;  4K2O A;  4NY0 A;  3V5W A;  2L2I A;  3PVW A;  4CYE A;  1UPR A;  5DHF B;  1XR0 B;  2UZR A;  4A6K A;  2NMB A;  5HE1 A;  2D9Z A;  2H7D A;  5D3X A;  5C6R A;  4YON A;  3TFM A;  3PG7 A;  1GC6 A;  2K00 A;  1RJ2 A;  3AJ4 A;  3VOQ A;  4KVG B;  2YSZ A;  1OQN A;  2D4Q A;  3DXE A;  1NI2 A;  4MT7 A;  1XOD A;  4D0N B;  3NSU A;  1ZC4 B;  3CIK A;  2QKM A;  4TKN A;  1K5D B;  5JHG A;  3KY9 A;  1DDV A;  1J19 A;  2LOZ A;  2DHI A;  3TCA A;  3ML4 A;  2DFK A;  1KZG A;  2RSG A;  2RUK B;  2R0D A;  4YL8 A;  3X23 A;  2DX1 A;  3HW2 B;  1ZSQ A;  1DBH A;  5DIF B;  3FEH A;  1NU2 A;  3QIJ A;  3D8E A;  4IOY X;  3VIA A;  1PLS A;  5JHH A;  1WVH A;  2YVC A;  4HAV B;  5FI1 A;  1FHO A;  4HAY B;  3DXC A;  2LKO A;  2VSZ A;  1DRO A;  3ULB A;  1EVH A;  2YT0 A;  2ROV A;  5DH9 B;  3PP2 A;  3SO6 A;  1W1D A;  4P7I A;  3TO1 A;  3OAN A;  5JP4 A;  1X1F A;  4EKU A;  2CY5 A;  4WVF B;  2DTC A;  2D11 A;  2ZPY A;  3SYX A;  4GN1 A;  4F7G A;  1X86 A;  2Q13 A;  1M7E A;  1N3H A;  1ISN A;  1WI1 A;  1K5G B;  2L1C A;  3AU4 A;  1P6S A;  1U5G A;  2GJY A;  2DKP A;  1I2H A;  2YT1 A;  4KAX B;  4H8S A;  3QWM A;  4A5K A;  1KI1 B;  1WG7 A;  2X18 A;  2UVM A;  1WGQ A;  5C16 A;  1V89 A;  1W1G A;  5C79 A;  1EF1 A;  5C5B B;  5J3Q A;  5D3W A;  2J0K A;  1GG3 A;  1XCG A;  1ZM0 A;  2D9W A;  2OTX A;  1FHX A;  2YRY A;  1MIZ B;  2DLW A;  1TQZ A;  5J3Y A;  2Y7B A;  2D9V A;  1DYN A;  1U29 A;  2PZ1 A;  3M1I B;  1BTK A;  3IVF A;  3A98 B;  3SUZ A;  2V76 A;  1WJ1 A;  1BWN A;  2COF A;  2ADZ A; 
#chains in the Genus database with same CATH topology
 2H7E A;  3ZVR A;  4KHB B;  1FGZ A;  1U27 A;  3CXB B;  3LJU X;  3WYF B;  2XQN M;  1UNR A;  4D6W A;  1X11 A;  2KIE A;  1P5T A;  4XWX A;  4F7H A;  1XKE A;  3KRX A;  2MFQ A;  4K2P A;  1QQG A;  2AL6 A;  1Z87 A;  2RGN B;  4MK0 A;  3SNH A;  3B77 A;  2I5F A;  3DXD A;  2COA A;  2CRF A;  2Z0O A;  2W2X D;  2I1J A;  1FB8 A;  2RLO A;  3DCX A;  3PSC A;  2Z59 A;  2ZKM X;  4K17 A;  3F5R A;  2LUL A;  2RRF A;  3QBV B;  5HE3 A;  2EMT A;  4A6F A;  2JP2 A;  2NZ8 B;  2QKL A;  2D2Q A;  2J0M A;  3SV1 A;  1LW3 A;  1QC6 A;  4GZU A;  3P6A A;  2I1K A;  4ZRK A;  4GPT B;  4L1R A;  4HAW B;  1UEF A;  2J0J A;  2HTH B;  1AWE A;  2ELA A;  4DXA B;  1GC7 A;  1U5D A;  5KQ1 A;  4Z2N A;  1NTV A;  5C5B A;  1B55 A;  4HDQ A;  3PVL A;  3D8D A;  1NTY A;  3KSY A;  5CLQ B;  3D8F A;  2K2J A;  3PZD A;  2Y8G A;  2YS1 A;  2Z13 A;  1H10 A;  3ZDT A;  1Q67 A;  2OQB A;  2P0D A;  2Z0Q A;  4HB3 B;  5DI9 B;  5I2S A;  4C0A A;  1DDM A;  1J0W A;  2YS5 A;  1ZVR A;  5L81 A;  2Z0P A;  4IAP A;  2YS3 A;  2N23 A;  2P8V A;  4GOU A;  2DHJ A;  5J3T A;  3HQC A;  1WJM A;  1XD4 A;  5HE0 A;  4HAZ B;  4KHB A;  5I2M A;  2KGX B;  3GYO A;  2R09 A;  5LOP B;  2KR0 A;  1LB1 A;  2G35 A;  4QXA B;  3WA0 A;  4EMO A;  2BCJ A;  2COD A;  4ZRJ A;  1U5F A;  4CHJ A;  5KQ4 A;  2M38 A;  1W1H A;  1MK7 B;  4DX9 0;  4KHO A;  1E5W A;  2Y8F A;  3TVV A;  5GOW B;  3ODX A;  1KZ7 A;  1SGH A;  1U5E A;  1OMW A;  1ZYI A;  2W2X C;  1TXD A;  4NSW A;  1V5M A;  3A8P A;  2D9X A;  1UPQ A;  4L6E A;  2D9Y A;  5JLJ B;  2E2X A;  4GMX B;  1V5U A;  1TJ6 A;  1AQC A;  3AU5 A;  2ELB A;  1RRP B;  2COC A;  4B6H A;  4KHA A;  3BIN A;  3ODO A;  2LOX A;  3ODW A;  1M7R A;  2KCJ A;  2DX5 A;  2CAY A;  1UNP A;  2DYN A;  2FJL A;  2GUM A;  2YF0 A;  4Z2M B;  2EMS A;  4HDO A;  1I7A A;  1FAO A;  4HAT B;  4A6H A;  5D27 A;  4OT1 A;  1XX0 A;  1EAZ A;  3FM8 C;  4HHV A;  4HB2 B;  2W2W A;  5D3V A;  2DN6 A;  3P7Z A;  4WJ7 A;  3TW1 A;  2MWN B;  3PEG A;  2IFS A;  2DYQ A;  3NWF A;  4A6F B;  5HE2 A;  2P0F A;  1MAI A;  3HK0 A;  3FSS A;  4CHM A;  4MY6 A;  4PQ0 A;  2M14 A;  3U7D A;  2R2Y A;  2ROZ B;  4GXB A;  5DHA B;  2N0Y A;  2CY4 A;  1MK9 B;  1PMS A;  3MPX A;  1FHW A;  1X1G A;  2EC1 A;  2MDX A;  2K2U A;  3U8Z A;  2RNR B;  1P3R A;  1X05 A;  5KCV A;  3OHM B;  5M4Y B;  1UNQ A;  4Y94 A;  2D10 A;  4QJ4 B;  1FOE A;  1MPH A;  3BJI A;  1BTN A;  4F7U P;  2EJ8 A;  1Y5O A;  4HAU B;  3GYP A;  1MKE A;  3T06 A;  2I5C A;  1IRS A;  5EFX A;  4ZRI A;  2GCJ A;  1H4R A;  1U2B A;  3PVU A;  3A8Q A;  3G9W A;  4PNK A;  4HB4 B;  2DHK A;  2HE7 A;  3MDB C;  4K81 A;  5CLL B;  2Z14 A;  3A58 A;  1FGY A;  3KRW A;  3UZT A;  2AEH A;  2VKI A;  3HIE A;  2RVB B;  2KUP A;  4DBB A;  2DKQ A;  2MKR A;  1V88 A;  3F0W A;  1MIX A;  3O96 A;  4IFS A;  2KUQ A;  4HB0 B;  4EJN A;  1OY2 A;  1BAK A;  2K8E A;  1DDW A;  3N7C A;  1Y19 B;  5LON B;  1PFJ A;  4TYZ A;  2LG1 A;  1V61 A;  4WSF A;  5FI0 A;  5D3Y A;  3RCP A;  2P0H A;  2LYD A;  4GMV A;  5LG4 B;  4HAX B;  2GS0 A;  1ZC3 B;  4QJ3 B;  3ULC A;  2GCL A;  2J59 M;  1EGX A;  2UZS A;  1WGU A;  2IYB A;  4BBK A;  1SHC A;  2VRW B;  1V5P A;  4DX8 A;  1T77 A;  2DA0 A;  3KZ1 A;  4K2O A;  4NY0 A;  3V5W A;  2L2I A;  3PVW A;  4CYE A;  4OSN A;  1UPR A;  5DHF B;  1XR0 B;  2UZR A;  4A6K A;  2NMB A;  5HE1 A;  2D9Z A;  2H7D A;  5D3X A;  5C6R A;  4YON A;  3TFM A;  3PG7 A;  1GC6 A;  2YT2 A;  2K00 A;  1RJ2 A;  3AJ4 A;  4GNK B;  3VOQ A;  4KVG B;  2YSZ A;  1OQN A;  2D4Q A;  3DXE A;  1NI2 A;  4MT7 A;  1XOD A;  4D0N B;  2NBV A;  3NSU A;  1ZC4 B;  3CIK A;  2QKM A;  3NW8 A;  4TKN A;  1K5D B;  5JHG A;  3KY9 A;  1DDV A;  1J19 A;  2LOZ A;  2DHI A;  3TCA A;  3ML4 A;  2DFK A;  1KZG A;  2RSG A;  2RUK B;  5IRS A;  2R0D A;  4YL8 A;  3X23 A;  2DX1 A;  3HW2 B;  1ZSQ A;  1DBH A;  5DIF B;  3FEH A;  1NU2 A;  2Z4D A;  3QIJ A;  3D8E A;  3U12 A;  4IOY X;  3VIA A;  4QJ5 B;  1PLS A;  5JHH A;  1WVH A;  3NWD A;  2YVC A;  4HAV B;  5FI1 A;  1FHO A;  4HAY B;  3DXC A;  2LKO A;  2VSZ A;  1DRO A;  3ULB A;  1EVH A;  2YT0 A;  2ROV A;  5DH9 B;  4CSQ A;  3PP2 A;  3SO6 A;  3NWA A;  1W1D A;  4P7I A;  3TO1 A;  3OAN A;  5JP4 A;  1X1F A;  4EKU A;  2CY5 A;  4WVF B;  2DTC A;  2D11 A;  2ZPY A;  3HSA A;  3SYX A;  4GN1 A;  4F7G A;  1X86 A;  2Q13 A;  1M7E A;  1N3H A;  1ISN A;  1WI1 A;  1K5G B;  2L1C A;  3AU4 A;  1P6S A;  1U5G A;  2GJY A;  2DKP A;  1I2H A;  2YT1 A;  2KIG A;  4KAX B;  2K49 A;  4H8S A;  3QWM A;  4A5K A;  1KI1 B;  1WG7 A;  2X18 A;  1MI1 A;  3FVC A;  2UVM A;  1WGQ A;  5C16 A;  1V89 A;  1W1G A;  5C79 A;  1EF1 A;  5C5B B;  5J3Q A;  5D3W A;  2J0K A;  1GG3 A;  1XCG A;  1ZM0 A;  2D9W A;  2OTX A;  1FHX A;  2YRY A;  1MIZ B;  2FJU B;  4DIX A;  2DLW A;  1TQZ A;  5J3Y A;  2Y7B A;  4HSI A;  2D9V A;  1DYN A;  1U29 A;  2PZ1 A;  3M1I B;  1BTK A;  3IVF A;  3A98 B;  3SUZ A;  2V76 A;  1WJ1 A;  1BWN A;  2COF A;  2ADZ A; 
#chains in the Genus database with same CATH homology
 2H7E A;  3ZVR A;  4KHB B;  1FGZ A;  1U27 A;  3CXB B;  3LJU X;  3WYF B;  2XQN M;  1UNR A;  1X11 A;  1P5T A;  4XWX A;  4F7H A;  1XKE A;  3KRX A;  2MFQ A;  4K2P A;  1QQG A;  2AL6 A;  1Z87 A;  2RGN B;  4MK0 A;  3SNH A;  3DXD A;  2I5F A;  2COA A;  2CRF A;  2Z0O A;  2W2X D;  2I1J A;  1FB8 A;  2RLO A;  3PSC A;  4K17 A;  3F5R A;  2LUL A;  3QBV B;  5HE3 A;  2EMT A;  4A6F A;  2JP2 A;  2NZ8 B;  2QKL A;  2D2Q A;  2J0M A;  3SV1 A;  1LW3 A;  1QC6 A;  4GZU A;  3P6A A;  2I1K A;  4ZRK A;  4GPT B;  4HAW B;  1UEF A;  2J0J A;  2HTH B;  1AWE A;  2ELA A;  4DXA B;  1GC7 A;  1U5D A;  5KQ1 A;  4Z2N A;  1NTV A;  5C5B A;  1B55 A;  4HDQ A;  3PVL A;  3D8D A;  1NTY A;  3KSY A;  5CLQ B;  3D8F A;  2K2J A;  3PZD A;  2Y8G A;  2YS1 A;  1H10 A;  3ZDT A;  1Q67 A;  2OQB A;  2P0D A;  2Z0Q A;  4HB3 B;  5DI9 B;  4C0A A;  1DDM A;  1J0W A;  2YS5 A;  1ZVR A;  5L81 A;  2Z0P A;  4IAP A;  2YS3 A;  2N23 A;  2P8V A;  2DHJ A;  5J3T A;  3HQC A;  1WJM A;  1XD4 A;  5HE0 A;  4HAZ B;  2KGX B;  3GYO A;  2R09 A;  5LOP B;  1LB1 A;  2G35 A;  3WA0 A;  4EMO A;  2BCJ A;  2COD A;  4ZRJ A;  1U5F A;  4CHJ A;  5KQ4 A;  2M38 A;  1W1H A;  1MK7 B;  4DX9 0;  4KHO A;  1E5W A;  2Y8F A;  3TVV A;  5GOW B;  3ODX A;  1KZ7 A;  1SGH A;  1U5E A;  1OMW A;  2W2X C;  1TXD A;  4NSW A;  1V5M A;  3A8P A;  2D9X A;  1UPQ A;  4L6E A;  2D9Y A;  5JLJ B;  2E2X A;  4GMX B;  1V5U A;  1TJ6 A;  1AQC A;  3AU5 A;  2ELB A;  1RRP B;  2COC A;  4B6H A;  4KHA A;  3BIN A;  3ODO A;  2LOX A;  3ODW A;  1M7R A;  2KCJ A;  2DX5 A;  2CAY A;  1UNP A;  2DYN A;  2FJL A;  2YF0 A;  4Z2M B;  2EMS A;  4HDO A;  1I7A A;  1FAO A;  4HAT B;  4A6H A;  5D27 A;  1XX0 A;  1EAZ A;  3FM8 C;  4HHV A;  4HB2 B;  2W2W A;  5D3V A;  2DN6 A;  3P7Z A;  4WJ7 A;  3TW1 A;  2MWN B;  3PEG A;  2IFS A;  2DYQ A;  4A6F B;  5HE2 A;  2P0F A;  1MAI A;  3HK0 A;  3FSS A;  4CHM A;  4MY6 A;  4PQ0 A;  2M14 A;  3U7D A;  2ROZ B;  4GXB A;  5DHA B;  2N0Y A;  2CY4 A;  1MK9 B;  1PMS A;  3MPX A;  1FHW A;  1X1G A;  2EC1 A;  2MDX A;  2K2U A;  3U8Z A;  2RNR B;  1P3R A;  1X05 A;  5KCV A;  1UNQ A;  4Y94 A;  2D10 A;  1FOE A;  1MPH A;  3BJI A;  1BTN A;  4F7U P;  2EJ8 A;  1Y5O A;  4HAU B;  3GYP A;  1MKE A;  3T06 A;  2I5C A;  1IRS A;  5EFX A;  4ZRI A;  2GCJ A;  1H4R A;  1U2B A;  3PVU A;  3A8Q A;  3G9W A;  4PNK A;  4HB4 B;  2DHK A;  2HE7 A;  3MDB C;  4K81 A;  5CLL B;  1FGY A;  3KRW A;  3UZT A;  2AEH A;  2VKI A;  2RVB B;  2KUP A;  4DBB A;  2DKQ A;  2MKR A;  1V88 A;  3F0W A;  1MIX A;  3O96 A;  4IFS A;  4HB0 B;  4EJN A;  1OY2 A;  1BAK A;  1DDW A;  3N7C A;  1Y19 B;  5LON B;  1PFJ A;  4TYZ A;  2LG1 A;  1V61 A;  4WSF A;  5FI0 A;  5D3Y A;  3RCP A;  2P0H A;  2LYD A;  4GMV A;  4HAX B;  2GS0 A;  1ZC3 B;  3ULC A;  2GCL A;  2J59 M;  1EGX A;  2UZS A;  1WGU A;  2IYB A;  4BBK A;  1SHC A;  2VRW B;  1V5P A;  4DX8 A;  2DA0 A;  3KZ1 A;  4K2O A;  4NY0 A;  3V5W A;  2L2I A;  3PVW A;  4CYE A;  1UPR A;  5DHF B;  1XR0 B;  2UZR A;  4A6K A;  2NMB A;  5HE1 A;  2D9Z A;  2H7D A;  5D3X A;  5C6R A;  4YON A;  3TFM A;  3PG7 A;  1GC6 A;  2K00 A;  1RJ2 A;  3AJ4 A;  3VOQ A;  4KVG B;  2YSZ A;  1OQN A;  2D4Q A;  3DXE A;  1NI2 A;  4MT7 A;  1XOD A;  4D0N B;  3NSU A;  1ZC4 B;  3CIK A;  2QKM A;  4TKN A;  1K5D B;  5JHG A;  3KY9 A;  1DDV A;  1J19 A;  2LOZ A;  2DHI A;  3TCA A;  3ML4 A;  2DFK A;  1KZG A;  2RSG A;  2RUK B;  2R0D A;  4YL8 A;  3X23 A;  2DX1 A;  3HW2 B;  1ZSQ A;  1DBH A;  5DIF B;  3FEH A;  1NU2 A;  3QIJ A;  3D8E A;  4IOY X;  3VIA A;  1PLS A;  5JHH A;  1WVH A;  2YVC A;  4HAV B;  5FI1 A;  1FHO A;  4HAY B;  3DXC A;  2LKO A;  2VSZ A;  1DRO A;  3ULB A;  1EVH A;  2YT0 A;  2ROV A;  5DH9 B;  3PP2 A;  3SO6 A;  1W1D A;  4P7I A;  3TO1 A;  3OAN A;  5JP4 A;  1X1F A;  4EKU A;  2CY5 A;  4WVF B;  2DTC A;  2D11 A;  2ZPY A;  3SYX A;  4GN1 A;  4F7G A;  1X86 A;  2Q13 A;  1M7E A;  1N3H A;  1ISN A;  1WI1 A;  1K5G B;  2L1C A;  3AU4 A;  1P6S A;  1U5G A;  2GJY A;  2DKP A;  1I2H A;  2YT1 A;  4KAX B;  4H8S A;  3QWM A;  4A5K A;  1KI1 B;  1WG7 A;  2X18 A;  2UVM A;  1WGQ A;  5C16 A;  1V89 A;  1W1G A;  5C79 A;  1EF1 A;  5C5B B;  5J3Q A;  5D3W A;  2J0K A;  1GG3 A;  1XCG A;  1ZM0 A;  2D9W A;  2OTX A;  1FHX A;  2YRY A;  1MIZ B;  2DLW A;  1TQZ A;  5J3Y A;  2Y7B A;  2D9V A;  1DYN A;  1U29 A;  2PZ1 A;  3M1I B;  1BTK A;  3IVF A;  3A98 B;  3SUZ A;  2V76 A;  1WJ1 A;  1BWN A;  2COF A;  2ADZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...