4GPTB

Crystal structure of kpt251 in complex with crm1-ran-ranbp1
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
123
structure length
123
Chain Sequence
TAEEDEEVLYKVRAKLFRFDKDAKEWKERGTGDCKFLKNKKTNKVRILMRRDKTLKICANHIIAPEYTLKPNVGSDRSWVYACTADIAEGEAEAFTFAIRFGSKENADKFKEEFEKAQEINKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTP-binding nuclear protein Ran
publication title Antileukemic activity of nuclear export inhibitors that spare normal hematopoietic cells.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport/inhibitor
total genus 31
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2012-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00638 Ran_BP1 RanBP1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4gptB00
1W1GA 5HE0A 1IRSA 4EJNA 3D8EA 1V5MA 1SGHA 3LJUX 4K2PA 1QQGA 2QKMA 2H7DA 1K5GB 2MKRA 4IAPA 1Y19B 3UZTA 5DI9B 2ADZA 2R09A 2I1JA 2COCA 2K2UA 1DDVA 2COAA 5KQ1A 1XODA 2KGXB 2LKOA 2X18A 4IOYX 1OQNA 1AQCA 2NMBA 1MK9B 4PNKA 4WVFB 1MK7B 2DX5A 2MDXA 2RVBB 4CYEA 1MPHA 1U5EA 1X05A 2JP2A 1X86A 4DBBA 1KZGA 1GC6A 3N7CA 3AU5A 3TVVA 2HE7A 1MAIA 4GMXB 2VSZA 1U2BA 2RNRB 2OTXA 4ZRIA 5DIFB 4EMOA 2EC1A 1Z87A 2Z0PA 1KI1B 3G9WA 3SO6A 4MK0A 2J0KA 4D0NB 1V88A 1X1FA 1M7EA 2XQNM 1DROA 1FGZA 2D10A 2D9ZA 4H8SA 1WGUA 2I1KA 2YF0A 2KUPA 3FM8C 3SYXA 1PMSA 2PZ1A 4Z2MB 3CXBB 2YS3A 3WA0A 1FB8A 1XCGA 1WJMA 1FAOA 1V89A 2COFA 4KVGB 1DBHA 2G35A 4A6FA 2GCLA 2N0YA 2K00A 1FOEA 5D3WA 3ZDTA 4GN1A 2ELAA 1V5UA 5GOWB 3QBVB 4A6HA 1DDMA 4HAXB 1XD4A 4WSFA 4EKUA 5HE2A 1GG3A 2HTHB 2D9YA 2YS5A 1FHWA 5CLLB 1PLSA 5CLQB 1RRPB 2YRYA 3BINA 2E2XA 2L1CA 1I7AA 2UZSA 2LG1A 1NI2A 1ZC3B 2ZPYA 1GC7A 1SHCA 5HE1A 2CY4A 3VOQA 3DXCA 1BTNA 2KCJA 4CHJA 4YL8A 4KHBB 5C16A 3KSYA 3ODXA 1OMWA 1DDWA 4HAWB 2RUKB 1WG7A 2DN6A 1TQZA 4MY6A 1U29A 2ROZB 4CHMA 5DH9B 2OQBA 5D27A 2CY5A 1BTKA 4NY0A 4A5KA 5D3XA 2AL6A 2IFSA 4WJ7A 2DKPA 5KQ4A 5J3QA 3OANA 3SUZA 1BAKA 3FSSA 1X11A 3X23A 2D9WA 1MKEA 4B6HA 2GCJA 4HB0B 2GJYA 4HHVA 3HQCA 4C0AA 4GPTB 1V61A 3MPXA 3GYPA 2LULA 5L81A 1FHXA 4BBKA 5LOPB 2DHKA 3FEHA 2DTCA 3ODWA 3O96A 4YONA 4A6KA 1UNRA 3DXDA 1MIXA 3SNHA 3V5WA 2GS0A 3PG7A 4HATB 1UPRA 2Y8GA 1EGXA 1NU2A 5HE3A 1U5GA 2J59M 2LOZA 2DHJA 1U5FA 3AU4A 2DFKA 3PEGA 3PVUA 2VRWB 2P0HA 2BCJA 3ODOA 3QWMA 1I2HA 2M38A 2DHIA 4HAZB 1W1DA 2D9VA 2M14A 2Z0OA 4A6FB 2D2QA 1WGQA 2D9XA 3KRXA 3QIJA 2W2WA 3KZ1A 3KRWA 2W2XD 1M7RA 1Y5OA 1ZC4B 5J3YA 1WVHA 2DLWA 2YT0A 3KY9A 1WI1A 4GXBA 3A8QA 1RJ2A 3A8PA 4Z2NA 2R0DA 2ELBA 3TW1A 4F7GA 4XWXA 1TXDA 1AWEA 1E5WA 1EVHA 3M1IB 1N3HA 1KZ7A 2Y8FA 3ML4A 2YVCA 5KCVA 3D8FA 2UZRA 2DX1A 2LOXA 3PVWA 4K17A 4K81A 3F5RA 1OY2A 1P5TA 1UEFA 2VKIA 5JLJB 2FJLA 1UPQA 2P0DA 3SV1A 1EF1A 2N23A 4ZRJA 3IVFA 5J3TA 1NTVA 3T06A 5C5BA 1W1HA 3TCAA 1B55A 2CAYA 2EJ8A 3DXEA 4GZUA 2LYDA 2Q13A 2K2JA 1NTYA 3U7DA 1J19A 4HAVB 1K5DB 3MDBC 2D4QA 4KAXB 2I5FA 1ZSQA 4TYZA 1ISNA 4NSWA 3U8ZA 1BWNA 2EMTA 4HB3B 2MFQA 1V5PA 1UNPA 3RCPA 4HAYB 2J0MA 3NSUA 2MWNB 1LB1A 2DYNA 2DA0A 4HDOA 1P3RA 2Y7BA 4KHAA 1FHOA 4KHOA 5FI0A 3F0WA 1DYNA 1UNQA 2Z0QA 3PZDA 4PQ0A 1WJ1A 4TKNA 3TFMA 1J0WA 2I5CA 3A98B 1U27A 4HDQA 5FI1A 1MIZB 2CODA 3CIKA 4ZRKA 5LONB 2EMSA 2IYBA 2QKLA 2DKQA 2RGNB 4DX90 4K2OA 3D8DA 4HB2B 2ROVA 2P8VA 3ULBA 1U5DA 1X1GA 5DHFB 3HK0A 1QC6A 5EFXA 2NZ8B 1Q67A 1ZM0A 4IFSA 2YSZA 3PSCA 4DX8A 2P0FA 4DXAB 2D11A 1XR0B 5D3VA 2H7EA 1H10A 5D3YA 2DYQA 2W2XC 1FGYA 1H4RA 1PFJA 2YT1A 4F7UP 3PP2A 2RLOA 3VIAA 3GYOA 2AEHA 1XKEA 4P7IA 3TO1A 4L6EA 2YS1A 3P7ZA 3WYFB 5JP4A 2L2IA 5JHGA 4HB4B 5JHHA 1TJ6A 1P6SA 2CRFA 3ULCA 3AJ4A 1LW3A 1XX0A 1EAZA 2V76A 4GMVA 1ZVRA 2RSGA 5C6RA 4Y94A 5C79A 2UVMA 4F7HA 3HW2B 3PVLA 2J0JA 4HAUB 4MT7A 3P6AA 3ZVRA 3BJIA 5DHAB 5C5BB
chains in the Genus database with same CATH superfamily
1W1GA 5HE0A 1IRSA 4EJNA 3D8EA 1V5MA 1SGHA 3LJUX 4K2PA 1QQGA 2QKMA 2H7DA 1K5GB 2MKRA 4QJ5B 4IAPA 1Y19B 3UZTA 5DI9B 2ADZA 2R09A 2I1JA 2COCA 2K2UA 1DDVA 2NBVA 2COAA 5KQ1A 1XODA 2KGXB 2LKOA 2X18A 4IOYX 5I2SA 1OQNA 1AQCA 2NMBA 1MK9B 3B77A 4WVFB 4PNKA 1MK7B 2DX5A 2MDXA 2RVBB 4CYEA 1MPHA 1U5EA 1X05A 2JP2A 1X86A 4DBBA 1KZGA 1GC6A 3N7CA 3AU5A 3TVVA 2HE7A 1MAIA 4GMXB 2VSZA 1U2BA 2RNRB 2OTXA 4ZRIA 5DIFB 4EMOA 2EC1A 1Z87A 2Z0PA 5I2MA 1KI1B 3G9WA 3SO6A 4MK0A 2RRFA 2J0KA 4D0NB 1V88A 1X1FA 1M7EA 2XQNM 1DROA 1FGZA 2D10A 2D9ZA 4H8SA 1WGUA 2I1KA 2YF0A 2KUPA 3FM8C 3SYXA 1PMSA 2Z4DA 2PZ1A 4Z2MB 3CXBB 2YS3A 4DIXA 3WA0A 1FB8A 1XCGA 1WJMA 1FAOA 1V89A 2COFA 4KVGB 1DBHA 3NWAA 2G35A 4A6FA 2GCLA 2N0YA 2K00A 1FOEA 5D3WA 3ZDTA 4GN1A 2ELAA 2GUMA 1V5UA 5GOWB 3QBVB 2YT2A 4A6HA 1DDMA 4OSNA 4HAXB 1XD4A 4WSFA 4GNKB 4EKUA 2Z14A 5HE2A 1GG3A 2HTHB 2D9YA 2YS5A 1FHWA 5CLLB 1PLSA 5CLQB 5LG4B 1RRPB 4QJ3B 2YRYA 3BINA 4D6WA 2E2XA 4OT1A 3NWDA 2L1CA 1I7AA 2UZSA 2LG1A 2ZKMX 1NI2A 1ZC3B 2ZPYA 1GC7A 1SHCA 3DCXA 5HE1A 5M4YB 2CY4A 3VOQA 3DXCA 1BTNA 2KCJA 4CHJA 4YL8A 4KHBB 5C16A 3KSYA 3ODXA 1OMWA 4HSIA 1DDWA 4HAWB 2RUKB 1WG7A 2DN6A 1TQZA 4MY6A 1U29A 3NW8A 2ROZB 4CHMA 5DH9B 2OQBA 5D27A 2CY5A 1BTKA 4NY0A 4A5KA 5D3XA 2AL6A 2IFSA 4WJ7A 2KR0A 2DKPA 5KQ4A 5J3QA 3OANA 3SUZA 1BAKA 3FSSA 1X11A 3X23A 2D9WA 1MKEA 4B6HA 2GCJA 4HB0B 2GJYA 4HHVA 3HQCA 4C0AA 4GPTB 1V61A 2KIEA 3MPXA 3GYPA 2FJUB 2LULA 1FHXA 5L81A 4BBKA 5LOPB 3A58A 2R2YA 2DHKA 3FEHA 2DTCA 3ODWA 3O96A 4YONA 4A6KA 1UNRA 3DXDA 1MIXA 4QXAB 3SNHA 3V5WA 2GS0A 3PG7A 4HATB 1UPRA 2Y8GA 1EGXA 1NU2A 5HE3A 1T77A 1U5GA 2J59M 2LOZA 2DHJA 1U5FA 3AU4A 2DFKA 3PEGA 3PVUA 2VRWB 2P0HA 2BCJA 3ODOA 3QWMA 1I2HA 2M38A 2DHIA 4HAZB 1W1DA 2D9VA 2M14A 2Z0OA 4A6FB 2D2QA 1WGQA 2D9XA 3KRXA 3QIJA 2W2WA 3KZ1A 3KRWA 2W2XD 1M7RA 1Y5OA 1ZC4B 5J3YA 1WVHA 2DLWA 2YT0A 3KY9A 1WI1A 4GXBA 3A8QA 1RJ2A 3A8PA 4Z2NA 2R0DA 2ELBA 3TW1A 4F7GA 4XWXA 1TXDA 1AWEA 1E5WA 1EVHA 3M1IB 1N3HA 1KZ7A 2Y8FA 3ML4A 2YVCA 5KCVA 3D8FA 2UZRA 3U12A 3OHMB 2DX1A 2LOXA 3PVWA 4K17A 2Z59A 4K81A 3F5RA 1OY2A 1P5TA 1UEFA 2VKIA 5JLJB 2FJLA 1UPQA 2P0DA 3SV1A 1EF1A 2N23A 4ZRJA 3IVFA 5J3TA 1NTVA 2Z13A 3T06A 5C5BA 1W1HA 3TCAA 1B55A 2CAYA 2EJ8A 3DXEA 4GZUA 4KHBA 2LYDA 2Q13A 2K2JA 1NTYA 3U7DA 1J19A 4HAVB 1K5DB 3MDBC 2D4QA 4KAXB 2I5FA 1ZSQA 4TYZA 3HIEA 1ISNA 4NSWA 3U8ZA 4QJ4B 1BWNA 2K49A 2EMTA 4HB3B 2MFQA 1V5PA 1UNPA 3RCPA 4HAYB 2J0MA 3NSUA 2MWNB 1LB1A 2DYNA 2DA0A 4HDOA 1P3RA 2Y7BA 4KHAA 1FHOA 4KHOA 5FI0A 3F0WA 1DYNA 1UNQA 2Z0QA 3PZDA 4PQ0A 1WJ1A 4TKNA 3TFMA 1J0WA 2I5CA 3A98B 1U27A 4HDQA 5FI1A 1MIZB 2CODA 3CIKA 4ZRKA 1MI1A 5LONB 2EMSA 2IYBA 2QKLA 2DKQA 2RGNB 4DX90 4K2OA 3D8DA 4HB2B 2ROVA 2P8VA 3ULBA 1ZYIA 1U5DA 1X1GA 5DHFB 2KUQA 3HK0A 1QC6A 5EFXA 2NZ8B 4GOUA 5IRSA 1Q67A 1ZM0A 4IFSA 2YSZA 3PSCA 4L1RA 4DX8A 2P0FA 4DXAB 2D11A 1XR0B 5D3VA 2H7EA 1H10A 5D3YA 2DYQA 2W2XC 1FGYA 1H4RA 3NWFA 3HSAA 1PFJA 2YT1A 4F7UP 3PP2A 2RLOA 2KIGA 3VIAA 3GYOA 2AEHA 1XKEA 4P7IA 3TO1A 4L6EA 2YS1A 3P7ZA 3WYFB 5JP4A 2L2IA 5JHGA 4CSQA 4HB4B 5JHHA 1TJ6A 1P6SA 2CRFA 3ULCA 3AJ4A 1LW3A 1XX0A 1EAZA 2V76A 4GMVA 1ZVRA 3FVCA 2RSGA 5C6RA 2K8EA 4Y94A 5C79A 2UVMA 4F7HA 3HW2B 3PVLA 2J0JA 4HAUB 4MT7A 3P6AA 3ZVRA 3BJIA 5DHAB 5C5BB
chains in the Genus database with same CATH topology
1W1GA 5HE0A 1IRSA 4EJNA 3D8EA 1V5MA 1SGHA 3LJUX 4K2PA 1QQGA 2QKMA 2H7DA 1K5GB 2MKRA 4IAPA 1Y19B 3UZTA 5DI9B 2ADZA 2R09A 2I1JA 2COCA 2K2UA 1DDVA 2COAA 5KQ1A 1XODA 2KGXB 2LKOA 2X18A 4IOYX 1OQNA 1AQCA 2NMBA 1MK9B 4PNKA 4WVFB 1MK7B 2DX5A 2MDXA 2RVBB 4CYEA 1MPHA 1U5EA 1X05A 2JP2A 1X86A 4DBBA 1KZGA 1GC6A 3N7CA 3AU5A 3TVVA 2HE7A 1MAIA 4GMXB 2VSZA 1U2BA 2RNRB 2OTXA 4ZRIA 5DIFB 4EMOA 2EC1A 1Z87A 2Z0PA 1KI1B 3G9WA 3SO6A 4MK0A 2J0KA 4D0NB 1V88A 1X1FA 1M7EA 2XQNM 1DROA 1FGZA 2D10A 2D9ZA 4H8SA 1WGUA 2I1KA 2YF0A 2KUPA 3FM8C 3SYXA 1PMSA 2PZ1A 4Z2MB 3CXBB 2YS3A 3WA0A 1FB8A 1XCGA 1WJMA 1FAOA 1V89A 2COFA 4KVGB 1DBHA 2G35A 4A6FA 2GCLA 2N0YA 2K00A 1FOEA 5D3WA 3ZDTA 4GN1A 2ELAA 1V5UA 5GOWB 3QBVB 4A6HA 1DDMA 4HAXB 1XD4A 4WSFA 4EKUA 5HE2A 1GG3A 2HTHB 2D9YA 2YS5A 1FHWA 5CLLB 1PLSA 5CLQB 1RRPB 2YRYA 3BINA 2E2XA 2L1CA 1I7AA 2UZSA 2LG1A 1NI2A 1ZC3B 2ZPYA 1GC7A 1SHCA 5HE1A 2CY4A 3VOQA 3DXCA 1BTNA 2KCJA 4CHJA 4YL8A 4KHBB 5C16A 3KSYA 3ODXA 1OMWA 1DDWA 4HAWB 2RUKB 1WG7A 2DN6A 1TQZA 4MY6A 1U29A 2ROZB 4CHMA 5DH9B 2OQBA 5D27A 2CY5A 1BTKA 4NY0A 4A5KA 5D3XA 2AL6A 2IFSA 4WJ7A 2DKPA 5KQ4A 5J3QA 3OANA 3SUZA 1BAKA 3FSSA 1X11A 3X23A 2D9WA 1MKEA 4B6HA 2GCJA 4HB0B 2GJYA 4HHVA 3HQCA 4C0AA 4GPTB 1V61A 3MPXA 3GYPA 2LULA 5L81A 1FHXA 4BBKA 5LOPB 2DHKA 3FEHA 2DTCA 3ODWA 3O96A 4YONA 4A6KA 1UNRA 3DXDA 1MIXA 3SNHA 3V5WA 2GS0A 3PG7A 4HATB 1UPRA 2Y8GA 1EGXA 1NU2A 5HE3A 1U5GA 2J59M 2LOZA 2DHJA 1U5FA 3AU4A 2DFKA 3PEGA 3PVUA 2VRWB 2P0HA 2BCJA 3ODOA 3QWMA 1I2HA 2M38A 2DHIA 4HAZB 1W1DA 2D9VA 2M14A 2Z0OA 4A6FB 2D2QA 1WGQA 2D9XA 3KRXA 3QIJA 2W2WA 3KZ1A 3KRWA 2W2XD 1M7RA 1Y5OA 1ZC4B 5J3YA 1WVHA 2DLWA 2YT0A 3KY9A 1WI1A 4GXBA 3A8QA 1RJ2A 3A8PA 4Z2NA 2R0DA 2ELBA 3TW1A 4F7GA 4XWXA 1TXDA 1AWEA 1E5WA 1EVHA 3M1IB 1N3HA 1KZ7A 2Y8FA 3ML4A 2YVCA 5KCVA 3D8FA 2UZRA 2DX1A 2LOXA 3PVWA 4K17A 4K81A 3F5RA 1OY2A 1P5TA 1UEFA 2VKIA 5JLJB 2FJLA 1UPQA 2P0DA 3SV1A 1EF1A 2N23A 4ZRJA 3IVFA 5J3TA 1NTVA 3T06A 5C5BA 1W1HA 3TCAA 1B55A 2CAYA 2EJ8A 3DXEA 4GZUA 2LYDA 2Q13A 2K2JA 1NTYA 3U7DA 1J19A 4HAVB 1K5DB 3MDBC 2D4QA 4KAXB 2I5FA 1ZSQA 4TYZA 1ISNA 4NSWA 3U8ZA 1BWNA 2EMTA 4HB3B 2MFQA 1V5PA 1UNPA 3RCPA 4HAYB 2J0MA 3NSUA 2MWNB 1LB1A 2DYNA 2DA0A 4HDOA 1P3RA 2Y7BA 4KHAA 1FHOA 4KHOA 5FI0A 3F0WA 1DYNA 1UNQA 2Z0QA 3PZDA 4PQ0A 1WJ1A 4TKNA 3TFMA 1J0WA 2I5CA 3A98B 1U27A 4HDQA 5FI1A 1MIZB 2CODA 3CIKA 4ZRKA 5LONB 2EMSA 2IYBA 2QKLA 2DKQA 2RGNB 4DX90 4K2OA 3D8DA 4HB2B 2ROVA 2P8VA 3ULBA 1U5DA 1X1GA 5DHFB 3HK0A 1QC6A 5EFXA 2NZ8B 1Q67A 1ZM0A 4IFSA 2YSZA 3PSCA 4DX8A 2P0FA 4DXAB 2D11A 1XR0B 5D3VA 2H7EA 1H10A 5D3YA 2DYQA 2W2XC 1FGYA 1H4RA 1PFJA 2YT1A 4F7UP 3PP2A 2RLOA 3VIAA 3GYOA 2AEHA 1XKEA 4P7IA 3TO1A 4L6EA 2YS1A 3P7ZA 3WYFB 5JP4A 2L2IA 5JHGA 4HB4B 5JHHA 1TJ6A 1P6SA 2CRFA 3ULCA 3AJ4A 1LW3A 1XX0A 1EAZA 2V76A 4GMVA 1ZVRA 2RSGA 5C6RA 4Y94A 5C79A 2UVMA 4F7HA 3HW2B 3PVLA 2J0JA 4HAUB 4MT7A 3P6AA 3ZVRA 3BJIA 5DHAB 5C5BB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W1G A;  5HE0 A;  1IRS A;  4EJN A;  3D8E A;  1V5M A;  1SGH A;  3LJU X;  4K2P A;  1QQG A;  2QKM A;  2H7D A;  1K5G B;  2MKR A;  4IAP A;  1Y19 B;  3UZT A;  5DI9 B;  2ADZ A;  2R09 A;  2I1J A;  2COC A;  2K2U A;  1DDV A;  2COA A;  5KQ1 A;  1XOD A;  2KGX B;  2LKO A;  2X18 A;  4IOY X;  1OQN A;  1AQC A;  2NMB A;  1MK9 B;  4PNK A;  4WVF B;  1MK7 B;  2DX5 A;  2MDX A;  2RVB B;  4CYE A;  1MPH A;  1U5E A;  1X05 A;  2JP2 A;  1X86 A;  4DBB A;  1KZG A;  1GC6 A;  3N7C A;  3AU5 A;  3TVV A;  2HE7 A;  1MAI A;  4GMX B;  2VSZ A;  1U2B A;  2RNR B;  2OTX A;  4ZRI A;  5DIF B;  4EMO A;  2EC1 A;  1Z87 A;  2Z0P A;  1KI1 B;  3G9W A;  3SO6 A;  4MK0 A;  2J0K A;  4D0N B;  1V88 A;  1X1F A;  1M7E A;  2XQN M;  1DRO A;  1FGZ A;  2D10 A;  2D9Z A;  4H8S A;  1WGU A;  2I1K A;  2YF0 A;  2KUP A;  3FM8 C;  3SYX A;  1PMS A;  2PZ1 A;  4Z2M B;  3CXB B;  2YS3 A;  3WA0 A;  1FB8 A;  1XCG A;  1WJM A;  1FAO A;  1V89 A;  2COF A;  4KVG B;  1DBH A;  2G35 A;  4A6F A;  2GCL A;  2N0Y A;  2K00 A;  1FOE A;  5D3W A;  3ZDT A;  4GN1 A;  2ELA A;  1V5U A;  5GOW B;  3QBV B;  4A6H A;  1DDM A;  4HAX B;  1XD4 A;  4WSF A;  4EKU A;  5HE2 A;  1GG3 A;  2HTH B;  2D9Y A;  2YS5 A;  1FHW A;  5CLL B;  1PLS A;  5CLQ B;  1RRP B;  2YRY A;  3BIN A;  2E2X A;  2L1C A;  1I7A A;  2UZS A;  2LG1 A;  1NI2 A;  1ZC3 B;  2ZPY A;  1GC7 A;  1SHC A;  5HE1 A;  2CY4 A;  3VOQ A;  3DXC A;  1BTN A;  2KCJ A;  4CHJ A;  4YL8 A;  4KHB B;  5C16 A;  3KSY A;  3ODX A;  1OMW A;  1DDW A;  4HAW B;  2RUK B;  1WG7 A;  2DN6 A;  1TQZ A;  4MY6 A;  1U29 A;  2ROZ B;  4CHM A;  5DH9 B;  2OQB A;  5D27 A;  2CY5 A;  1BTK A;  4NY0 A;  4A5K A;  5D3X A;  2AL6 A;  2IFS A;  4WJ7 A;  2DKP A;  5KQ4 A;  5J3Q A;  3OAN A;  3SUZ A;  1BAK A;  3FSS A;  1X11 A;  3X23 A;  2D9W A;  1MKE A;  4B6H A;  2GCJ A;  4HB0 B;  2GJY A;  4HHV A;  3HQC A;  4C0A A;  4GPT B;  1V61 A;  3MPX A;  3GYP A;  2LUL A;  5L81 A;  1FHX A;  4BBK A;  5LOP B;  2DHK A;  3FEH A;  2DTC A;  3ODW A;  3O96 A;  4YON A;  4A6K A;  1UNR A;  3DXD A;  1MIX A;  3SNH A;  3V5W A;  2GS0 A;  3PG7 A;  4HAT B;  1UPR A;  2Y8G A;  1EGX A;  1NU2 A;  5HE3 A;  1U5G A;  2J59 M;  2LOZ A;  2DHJ A;  1U5F A;  3AU4 A;  2DFK A;  3PEG A;  3PVU A;  2VRW B;  2P0H A;  2BCJ A;  3ODO A;  3QWM A;  1I2H A;  2M38 A;  2DHI A;  4HAZ B;  1W1D A;  2D9V A;  2M14 A;  2Z0O A;  4A6F B;  2D2Q A;  1WGQ A;  2D9X A;  3KRX A;  3QIJ A;  2W2W A;  3KZ1 A;  3KRW A;  2W2X D;  1M7R A;  1Y5O A;  1ZC4 B;  5J3Y A;  1WVH A;  2DLW A;  2YT0 A;  3KY9 A;  1WI1 A;  4GXB A;  3A8Q A;  1RJ2 A;  3A8P A;  4Z2N A;  2R0D A;  2ELB A;  3TW1 A;  4F7G A;  4XWX A;  1TXD A;  1AWE A;  1E5W A;  1EVH A;  3M1I B;  1N3H A;  1KZ7 A;  2Y8F A;  3ML4 A;  2YVC A;  5KCV A;  3D8F A;  2UZR A;  2DX1 A;  2LOX A;  3PVW A;  4K17 A;  4K81 A;  3F5R A;  1OY2 A;  1P5T A;  1UEF A;  2VKI A;  5JLJ B;  2FJL A;  1UPQ A;  2P0D A;  3SV1 A;  1EF1 A;  2N23 A;  4ZRJ A;  3IVF A;  5J3T A;  1NTV A;  3T06 A;  5C5B A;  1W1H A;  3TCA A;  1B55 A;  2CAY A;  2EJ8 A;  3DXE A;  4GZU A;  2LYD A;  2Q13 A;  2K2J A;  1NTY A;  3U7D A;  1J19 A;  4HAV B;  1K5D B;  3MDB C;  2D4Q A;  4KAX B;  2I5F A;  1ZSQ A;  4TYZ A;  1ISN A;  4NSW A;  3U8Z A;  1BWN A;  2EMT A;  4HB3 B;  2MFQ A;  1V5P A;  1UNP A;  3RCP A;  4HAY B;  2J0M A;  3NSU A;  2MWN B;  1LB1 A;  2DYN A;  2DA0 A;  4HDO A;  1P3R A;  2Y7B A;  4KHA A;  1FHO A;  4KHO A;  5FI0 A;  3F0W A;  1DYN A;  1UNQ A;  2Z0Q A;  3PZD A;  4PQ0 A;  1WJ1 A;  4TKN A;  3TFM A;  1J0W A;  2I5C A;  3A98 B;  1U27 A;  4HDQ A;  5FI1 A;  1MIZ B;  2COD A;  3CIK A;  4ZRK A;  5LON B;  2EMS A;  2IYB A;  2QKL A;  2DKQ A;  2RGN B;  4DX9 0;  4K2O A;  3D8D A;  4HB2 B;  2ROV A;  2P8V A;  3ULB A;  1U5D A;  1X1G A;  5DHF B;  3HK0 A;  1QC6 A;  5EFX A;  2NZ8 B;  1Q67 A;  1ZM0 A;  4IFS A;  2YSZ A;  3PSC A;  4DX8 A;  2P0F A;  4DXA B;  2D11 A;  1XR0 B;  5D3V A;  2H7E A;  1H10 A;  5D3Y A;  2DYQ A;  2W2X C;  1FGY A;  1H4R A;  1PFJ A;  2YT1 A;  4F7U P;  3PP2 A;  2RLO A;  3VIA A;  3GYO A;  2AEH A;  1XKE A;  4P7I A;  3TO1 A;  4L6E A;  2YS1 A;  3P7Z A;  3WYF B;  5JP4 A;  2L2I A;  5JHG A;  4HB4 B;  5JHH A;  1TJ6 A;  1P6S A;  2CRF A;  3ULC A;  3AJ4 A;  1LW3 A;  1XX0 A;  1EAZ A;  2V76 A;  4GMV A;  1ZVR A;  2RSG A;  5C6R A;  4Y94 A;  5C79 A;  2UVM A;  4F7H A;  3HW2 B;  3PVL A;  2J0J A;  4HAU B;  4MT7 A;  3P6A A;  3ZVR A;  3BJI A;  5DHA B;  5C5B B; 
#chains in the Genus database with same CATH topology
 1W1G A;  5HE0 A;  1IRS A;  4EJN A;  3D8E A;  1V5M A;  1SGH A;  3LJU X;  4K2P A;  1QQG A;  2QKM A;  2H7D A;  1K5G B;  2MKR A;  4QJ5 B;  4IAP A;  1Y19 B;  3UZT A;  5DI9 B;  2ADZ A;  2R09 A;  2I1J A;  2COC A;  2K2U A;  1DDV A;  2NBV A;  2COA A;  5KQ1 A;  1XOD A;  2KGX B;  2LKO A;  2X18 A;  4IOY X;  5I2S A;  1OQN A;  1AQC A;  2NMB A;  1MK9 B;  3B77 A;  4WVF B;  4PNK A;  1MK7 B;  2DX5 A;  2MDX A;  2RVB B;  4CYE A;  1MPH A;  1U5E A;  1X05 A;  2JP2 A;  1X86 A;  4DBB A;  1KZG A;  1GC6 A;  3N7C A;  3AU5 A;  3TVV A;  2HE7 A;  1MAI A;  4GMX B;  2VSZ A;  1U2B A;  2RNR B;  2OTX A;  4ZRI A;  5DIF B;  4EMO A;  2EC1 A;  1Z87 A;  2Z0P A;  5I2M A;  1KI1 B;  3G9W A;  3SO6 A;  4MK0 A;  2RRF A;  2J0K A;  4D0N B;  1V88 A;  1X1F A;  1M7E A;  2XQN M;  1DRO A;  1FGZ A;  2D10 A;  2D9Z A;  4H8S A;  1WGU A;  2I1K A;  2YF0 A;  2KUP A;  3FM8 C;  3SYX A;  1PMS A;  2Z4D A;  2PZ1 A;  4Z2M B;  3CXB B;  2YS3 A;  4DIX A;  3WA0 A;  1FB8 A;  1XCG A;  1WJM A;  1FAO A;  1V89 A;  2COF A;  4KVG B;  1DBH A;  3NWA A;  2G35 A;  4A6F A;  2GCL A;  2N0Y A;  2K00 A;  1FOE A;  5D3W A;  3ZDT A;  4GN1 A;  2ELA A;  2GUM A;  1V5U A;  5GOW B;  3QBV B;  2YT2 A;  4A6H A;  1DDM A;  4OSN A;  4HAX B;  1XD4 A;  4WSF A;  4GNK B;  4EKU A;  2Z14 A;  5HE2 A;  1GG3 A;  2HTH B;  2D9Y A;  2YS5 A;  1FHW A;  5CLL B;  1PLS A;  5CLQ B;  5LG4 B;  1RRP B;  4QJ3 B;  2YRY A;  3BIN A;  4D6W A;  2E2X A;  4OT1 A;  3NWD A;  2L1C A;  1I7A A;  2UZS A;  2LG1 A;  2ZKM X;  1NI2 A;  1ZC3 B;  2ZPY A;  1GC7 A;  1SHC A;  3DCX A;  5HE1 A;  5M4Y B;  2CY4 A;  3VOQ A;  3DXC A;  1BTN A;  2KCJ A;  4CHJ A;  4YL8 A;  4KHB B;  5C16 A;  3KSY A;  3ODX A;  1OMW A;  4HSI A;  1DDW A;  4HAW B;  2RUK B;  1WG7 A;  2DN6 A;  1TQZ A;  4MY6 A;  1U29 A;  3NW8 A;  2ROZ B;  4CHM A;  5DH9 B;  2OQB A;  5D27 A;  2CY5 A;  1BTK A;  4NY0 A;  4A5K A;  5D3X A;  2AL6 A;  2IFS A;  4WJ7 A;  2KR0 A;  2DKP A;  5KQ4 A;  5J3Q A;  3OAN A;  3SUZ A;  1BAK A;  3FSS A;  1X11 A;  3X23 A;  2D9W A;  1MKE A;  4B6H A;  2GCJ A;  4HB0 B;  2GJY A;  4HHV A;  3HQC A;  4C0A A;  4GPT B;  1V61 A;  2KIE A;  3MPX A;  3GYP A;  2FJU B;  2LUL A;  1FHX A;  5L81 A;  4BBK A;  5LOP B;  3A58 A;  2R2Y A;  2DHK A;  3FEH A;  2DTC A;  3ODW A;  3O96 A;  4YON A;  4A6K A;  1UNR A;  3DXD A;  1MIX A;  4QXA B;  3SNH A;  3V5W A;  2GS0 A;  3PG7 A;  4HAT B;  1UPR A;  2Y8G A;  1EGX A;  1NU2 A;  5HE3 A;  1T77 A;  1U5G A;  2J59 M;  2LOZ A;  2DHJ A;  1U5F A;  3AU4 A;  2DFK A;  3PEG A;  3PVU A;  2VRW B;  2P0H A;  2BCJ A;  3ODO A;  3QWM A;  1I2H A;  2M38 A;  2DHI A;  4HAZ B;  1W1D A;  2D9V A;  2M14 A;  2Z0O A;  4A6F B;  2D2Q A;  1WGQ A;  2D9X A;  3KRX A;  3QIJ A;  2W2W A;  3KZ1 A;  3KRW A;  2W2X D;  1M7R A;  1Y5O A;  1ZC4 B;  5J3Y A;  1WVH A;  2DLW A;  2YT0 A;  3KY9 A;  1WI1 A;  4GXB A;  3A8Q A;  1RJ2 A;  3A8P A;  4Z2N A;  2R0D A;  2ELB A;  3TW1 A;  4F7G A;  4XWX A;  1TXD A;  1AWE A;  1E5W A;  1EVH A;  3M1I B;  1N3H A;  1KZ7 A;  2Y8F A;  3ML4 A;  2YVC A;  5KCV A;  3D8F A;  2UZR A;  3U12 A;  3OHM B;  2DX1 A;  2LOX A;  3PVW A;  4K17 A;  2Z59 A;  4K81 A;  3F5R A;  1OY2 A;  1P5T A;  1UEF A;  2VKI A;  5JLJ B;  2FJL A;  1UPQ A;  2P0D A;  3SV1 A;  1EF1 A;  2N23 A;  4ZRJ A;  3IVF A;  5J3T A;  1NTV A;  2Z13 A;  3T06 A;  5C5B A;  1W1H A;  3TCA A;  1B55 A;  2CAY A;  2EJ8 A;  3DXE A;  4GZU A;  4KHB A;  2LYD A;  2Q13 A;  2K2J A;  1NTY A;  3U7D A;  1J19 A;  4HAV B;  1K5D B;  3MDB C;  2D4Q A;  4KAX B;  2I5F A;  1ZSQ A;  4TYZ A;  3HIE A;  1ISN A;  4NSW A;  3U8Z A;  4QJ4 B;  1BWN A;  2K49 A;  2EMT A;  4HB3 B;  2MFQ A;  1V5P A;  1UNP A;  3RCP A;  4HAY B;  2J0M A;  3NSU A;  2MWN B;  1LB1 A;  2DYN A;  2DA0 A;  4HDO A;  1P3R A;  2Y7B A;  4KHA A;  1FHO A;  4KHO A;  5FI0 A;  3F0W A;  1DYN A;  1UNQ A;  2Z0Q A;  3PZD A;  4PQ0 A;  1WJ1 A;  4TKN A;  3TFM A;  1J0W A;  2I5C A;  3A98 B;  1U27 A;  4HDQ A;  5FI1 A;  1MIZ B;  2COD A;  3CIK A;  4ZRK A;  1MI1 A;  5LON B;  2EMS A;  2IYB A;  2QKL A;  2DKQ A;  2RGN B;  4DX9 0;  4K2O A;  3D8D A;  4HB2 B;  2ROV A;  2P8V A;  3ULB A;  1ZYI A;  1U5D A;  1X1G A;  5DHF B;  2KUQ A;  3HK0 A;  1QC6 A;  5EFX A;  2NZ8 B;  4GOU A;  5IRS A;  1Q67 A;  1ZM0 A;  4IFS A;  2YSZ A;  3PSC A;  4L1R A;  4DX8 A;  2P0F A;  4DXA B;  2D11 A;  1XR0 B;  5D3V A;  2H7E A;  1H10 A;  5D3Y A;  2DYQ A;  2W2X C;  1FGY A;  1H4R A;  3NWF A;  3HSA A;  1PFJ A;  2YT1 A;  4F7U P;  3PP2 A;  2RLO A;  2KIG A;  3VIA A;  3GYO A;  2AEH A;  1XKE A;  4P7I A;  3TO1 A;  4L6E A;  2YS1 A;  3P7Z A;  3WYF B;  5JP4 A;  2L2I A;  5JHG A;  4CSQ A;  4HB4 B;  5JHH A;  1TJ6 A;  1P6S A;  2CRF A;  3ULC A;  3AJ4 A;  1LW3 A;  1XX0 A;  1EAZ A;  2V76 A;  4GMV A;  1ZVR A;  3FVC A;  2RSG A;  5C6R A;  2K8E A;  4Y94 A;  5C79 A;  2UVM A;  4F7H A;  3HW2 B;  3PVL A;  2J0J A;  4HAU B;  4MT7 A;  3P6A A;  3ZVR A;  3BJI A;  5DHA B;  5C5B B; 
#chains in the Genus database with same CATH homology
 1W1G A;  5HE0 A;  1IRS A;  4EJN A;  3D8E A;  1V5M A;  1SGH A;  3LJU X;  4K2P A;  1QQG A;  2QKM A;  2H7D A;  1K5G B;  2MKR A;  4IAP A;  1Y19 B;  3UZT A;  5DI9 B;  2ADZ A;  2R09 A;  2I1J A;  2COC A;  2K2U A;  1DDV A;  2COA A;  5KQ1 A;  1XOD A;  2KGX B;  2LKO A;  2X18 A;  4IOY X;  1OQN A;  1AQC A;  2NMB A;  1MK9 B;  4PNK A;  4WVF B;  1MK7 B;  2DX5 A;  2MDX A;  2RVB B;  4CYE A;  1MPH A;  1U5E A;  1X05 A;  2JP2 A;  1X86 A;  4DBB A;  1KZG A;  1GC6 A;  3N7C A;  3AU5 A;  3TVV A;  2HE7 A;  1MAI A;  4GMX B;  2VSZ A;  1U2B A;  2RNR B;  2OTX A;  4ZRI A;  5DIF B;  4EMO A;  2EC1 A;  1Z87 A;  2Z0P A;  1KI1 B;  3G9W A;  3SO6 A;  4MK0 A;  2J0K A;  4D0N B;  1V88 A;  1X1F A;  1M7E A;  2XQN M;  1DRO A;  1FGZ A;  2D10 A;  2D9Z A;  4H8S A;  1WGU A;  2I1K A;  2YF0 A;  2KUP A;  3FM8 C;  3SYX A;  1PMS A;  2PZ1 A;  4Z2M B;  3CXB B;  2YS3 A;  3WA0 A;  1FB8 A;  1XCG A;  1WJM A;  1FAO A;  1V89 A;  2COF A;  4KVG B;  1DBH A;  2G35 A;  4A6F A;  2GCL A;  2N0Y A;  2K00 A;  1FOE A;  5D3W A;  3ZDT A;  4GN1 A;  2ELA A;  1V5U A;  5GOW B;  3QBV B;  4A6H A;  1DDM A;  4HAX B;  1XD4 A;  4WSF A;  4EKU A;  5HE2 A;  1GG3 A;  2HTH B;  2D9Y A;  2YS5 A;  1FHW A;  5CLL B;  1PLS A;  5CLQ B;  1RRP B;  2YRY A;  3BIN A;  2E2X A;  2L1C A;  1I7A A;  2UZS A;  2LG1 A;  1NI2 A;  1ZC3 B;  2ZPY A;  1GC7 A;  1SHC A;  5HE1 A;  2CY4 A;  3VOQ A;  3DXC A;  1BTN A;  2KCJ A;  4CHJ A;  4YL8 A;  4KHB B;  5C16 A;  3KSY A;  3ODX A;  1OMW A;  1DDW A;  4HAW B;  2RUK B;  1WG7 A;  2DN6 A;  1TQZ A;  4MY6 A;  1U29 A;  2ROZ B;  4CHM A;  5DH9 B;  2OQB A;  5D27 A;  2CY5 A;  1BTK A;  4NY0 A;  4A5K A;  5D3X A;  2AL6 A;  2IFS A;  4WJ7 A;  2DKP A;  5KQ4 A;  5J3Q A;  3OAN A;  3SUZ A;  1BAK A;  3FSS A;  1X11 A;  3X23 A;  2D9W A;  1MKE A;  4B6H A;  2GCJ A;  4HB0 B;  2GJY A;  4HHV A;  3HQC A;  4C0A A;  4GPT B;  1V61 A;  3MPX A;  3GYP A;  2LUL A;  5L81 A;  1FHX A;  4BBK A;  5LOP B;  2DHK A;  3FEH A;  2DTC A;  3ODW A;  3O96 A;  4YON A;  4A6K A;  1UNR A;  3DXD A;  1MIX A;  3SNH A;  3V5W A;  2GS0 A;  3PG7 A;  4HAT B;  1UPR A;  2Y8G A;  1EGX A;  1NU2 A;  5HE3 A;  1U5G A;  2J59 M;  2LOZ A;  2DHJ A;  1U5F A;  3AU4 A;  2DFK A;  3PEG A;  3PVU A;  2VRW B;  2P0H A;  2BCJ A;  3ODO A;  3QWM A;  1I2H A;  2M38 A;  2DHI A;  4HAZ B;  1W1D A;  2D9V A;  2M14 A;  2Z0O A;  4A6F B;  2D2Q A;  1WGQ A;  2D9X A;  3KRX A;  3QIJ A;  2W2W A;  3KZ1 A;  3KRW A;  2W2X D;  1M7R A;  1Y5O A;  1ZC4 B;  5J3Y A;  1WVH A;  2DLW A;  2YT0 A;  3KY9 A;  1WI1 A;  4GXB A;  3A8Q A;  1RJ2 A;  3A8P A;  4Z2N A;  2R0D A;  2ELB A;  3TW1 A;  4F7G A;  4XWX A;  1TXD A;  1AWE A;  1E5W A;  1EVH A;  3M1I B;  1N3H A;  1KZ7 A;  2Y8F A;  3ML4 A;  2YVC A;  5KCV A;  3D8F A;  2UZR A;  2DX1 A;  2LOX A;  3PVW A;  4K17 A;  4K81 A;  3F5R A;  1OY2 A;  1P5T A;  1UEF A;  2VKI A;  5JLJ B;  2FJL A;  1UPQ A;  2P0D A;  3SV1 A;  1EF1 A;  2N23 A;  4ZRJ A;  3IVF A;  5J3T A;  1NTV A;  3T06 A;  5C5B A;  1W1H A;  3TCA A;  1B55 A;  2CAY A;  2EJ8 A;  3DXE A;  4GZU A;  2LYD A;  2Q13 A;  2K2J A;  1NTY A;  3U7D A;  1J19 A;  4HAV B;  1K5D B;  3MDB C;  2D4Q A;  4KAX B;  2I5F A;  1ZSQ A;  4TYZ A;  1ISN A;  4NSW A;  3U8Z A;  1BWN A;  2EMT A;  4HB3 B;  2MFQ A;  1V5P A;  1UNP A;  3RCP A;  4HAY B;  2J0M A;  3NSU A;  2MWN B;  1LB1 A;  2DYN A;  2DA0 A;  4HDO A;  1P3R A;  2Y7B A;  4KHA A;  1FHO A;  4KHO A;  5FI0 A;  3F0W A;  1DYN A;  1UNQ A;  2Z0Q A;  3PZD A;  4PQ0 A;  1WJ1 A;  4TKN A;  3TFM A;  1J0W A;  2I5C A;  3A98 B;  1U27 A;  4HDQ A;  5FI1 A;  1MIZ B;  2COD A;  3CIK A;  4ZRK A;  5LON B;  2EMS A;  2IYB A;  2QKL A;  2DKQ A;  2RGN B;  4DX9 0;  4K2O A;  3D8D A;  4HB2 B;  2ROV A;  2P8V A;  3ULB A;  1U5D A;  1X1G A;  5DHF B;  3HK0 A;  1QC6 A;  5EFX A;  2NZ8 B;  1Q67 A;  1ZM0 A;  4IFS A;  2YSZ A;  3PSC A;  4DX8 A;  2P0F A;  4DXA B;  2D11 A;  1XR0 B;  5D3V A;  2H7E A;  1H10 A;  5D3Y A;  2DYQ A;  2W2X C;  1FGY A;  1H4R A;  1PFJ A;  2YT1 A;  4F7U P;  3PP2 A;  2RLO A;  3VIA A;  3GYO A;  2AEH A;  1XKE A;  4P7I A;  3TO1 A;  4L6E A;  2YS1 A;  3P7Z A;  3WYF B;  5JP4 A;  2L2I A;  5JHG A;  4HB4 B;  5JHH A;  1TJ6 A;  1P6S A;  2CRF A;  3ULC A;  3AJ4 A;  1LW3 A;  1XX0 A;  1EAZ A;  2V76 A;  4GMV A;  1ZVR A;  2RSG A;  5C6R A;  4Y94 A;  5C79 A;  2UVM A;  4F7H A;  3HW2 B;  3PVL A;  2J0J A;  4HAU B;  4MT7 A;  3P6A A;  3ZVR A;  3BJI A;  5DHA B;  5C5B B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...