4GPTB

Crystal structure of kpt251 in complex with crm1-ran-ranbp1
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
123
structure length
123
Chain Sequence
b'TAEEDEEVLYKVRAKLFRFDKDAKEWKERGTGDCKFLKNKKTNKVRILMRRDKTLKICANHIIAPEYTLKPNVGSDRSWVYACTADIAEGEAEAFTFAIRFGSKENADKFKEEFEKAQEINKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTP-binding nuclear protein Ran
publication title Antileukemic activity of nuclear export inhibitors that spare normal hematopoietic cells.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport/inhibitor
total genus 31
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2012-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00638 Ran_BP1 RanBP1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4gptB00
2J0JA 3KZ1A 2COFA 2YT0A 4MY6A 2DHIA 5FI0A 3VIAA 1KI1B 1U5FA 5C79A 3PVUA 4ZRJA 1I2HA 4YONA 3SO6A 3OANA 3TO1A 5DHFB 2YS5A 3ODOA 5CLLB 1W1HA 1XR0B 2Y8FA 4KHBB 2I1KA 3BINA 1PMSA 3IVFA 1H10A 2J0KA 4L6EA 2RSGA 4HB3B 2I5FA 1P5TA 2LULA 1OQNA 3AU4A 1M7EA 1QQGA 2DYQA 3DXDA 1FAOA 2V76A 2QKLA 2D9ZA 4IAPA 3WYFB 4F7HA 4HATB 3D8FA 3G9WA 2CAYA 1EAZA 4F7GA 4PQ0A 3KY9A 1AWEA 2EMSA 2K00A 5D3YA 2KGXB 2RLOA 3TVVA 5JHHA 1FGZA 2MWNB 3GYOA 2HE7A 4MK0A 3D8DA 1ZM0A 2RNRB 5EFXA 1UNQA 2DKPA 2EJ8A 2W2WA 1K5DB 1TJ6A 2AEHA 2GS0A 1WVHA 4GMVA 1GC7A 4GMXB 5KQ4A 2Z0PA 5C5BB 1X11A 4HAVB 3NSUA 3F0WA 4A6KA 3KSYA 4ZRKA 1Y5OA 2LKOA 1KZGA 3A98B 2YF0A 2ELBA 2P0DA 1TXDA 4Z2NA 1V89A 1DYNA 3WA0A 2KUPA 1NTYA 1P6SA 1DBHA 2LG1A 2D9WA 2MFQA 2COCA 5KCVA 4HAYB 1UNPA 1MIXA 2Q13A 2RVBB 3ZDTA 2J59M 2YSZA 2P8VA 5DI9B 1I7AA 1X1GA 1Q67A 3PSCA 1X86A 1Y19B 3FEHA 2VSZA 2GCJA 1J0WA 1DDVA 4MT7A 1QC6A 2CY4A 1NTVA 2R0DA 5HE1A 1SHCA 1P3RA 1KZ7A 2N23A 2I1JA 3VOQA 1XD4A 4NY0A 2COAA 1WI1A 2UZRA 3TFMA 4K2OA 4HB2B 3RCPA 1EF1A 4EJNA 1RJ2A 3PVWA 1W1GA 2L1CA 2DN6A 4ZRIA 2LYDA 2JP2A 1RRPB 1UNRA 4A6FB 3TW1A 1J19A 1BTKA 2D9VA 1FB8A 2M38A 1FOEA 3M1IB 1XX0A 2UZSA 4GN1A 4HAUB 2DHJA 3DXCA 4F7UP 1Z87A 1U5EA 3MPXA 2KCJA 5D3VA 1MKEA 1GG3A 5DH9B 1ZC3B 3DXEA 4HB0B 2AL6A 2DKQA 2DYNA 1XKEA 4KHOA 2ADZA 4TYZA 3QWMA 2E2XA 1DDMA 1FHXA 2ZPYA 1N3HA 1X05A 4PNKA 2P0FA 2X18A 3SV1A 3U7DA 4C0AA 2VKIA 5JLJB 2OQBA 2W2XD 2Y8GA 1X1FA 4DXAB 3AJ4A 4GZUA 1TQZA 3ULCA 4KVGB 2DLWA 2QKMA 2NZ8B 3U8ZA 4Y94A 2FJLA 2R09A 1IRSA 4HB4B 2ROVA 3CIKA 3A8PA 3ODWA 1H4RA 3V5WA 4K17A 4HAWB 1GC6A 5FI1A 4HDOA 4B6HA 4CHMA 3ODXA 3PP2A 2GCLA 3PZDA 4YL8A 1B55A 1ZVRA 2N0YA 1UPRA 3KRXA 1MPHA 2ELAA 3P6AA 5HE0A 2H7DA 4KHAA 3PEGA 5D3XA 2OTXA 2CRFA 3AU5A 5LOPB 1WGQA 4D0NB 3A8QA 1NU2A 5CLQB 2G35A 3P7ZA 3LJUX 5JHGA 1M7RA 2CY5A 2HTHB 2LOXA 3D8EA 1W1DA 5DHAB 4WJ7A 3CXBB 2Z0OA 2DX5A 1DROA 3HW2B 1U27A 3O96A 4BBKA 5GOWB 1U5GA 1V5PA 2RGNB 1XODA 2EC1A 1PLSA 4IFSA 4CHJA 2VRWB 4CYEA 4HAZB 4DBBA 1OMWA 2YS3A 2DA0A 4TKNA 1BAKA 3ULBA 3FSSA 1ZC4B 3F5RA 4XWXA 1V5MA 3HK0A 4GXBA 2YVCA 4Z2MB 2D10A 3X23A 2NMBA 4H8SA 2LOZA 2XQNM 1WJ1A 3UZTA 1UPQA 1MAIA 3PVLA 1LW3A 2YT1A 5D27A 5J3QA 1AQCA 4K81A 5C6RA 4HDQA 2YRYA 1ISNA 1FGYA 1SGHA 1FHOA 2Z0QA 3QBVB 2CODA 1K5GB 4GPTB 4EMOA 1V88A 1MK9B 2M14A 2W2XC 1BWNA 1PFJA 2D2QA 3ML4A 2D11A 5D3WA 1EGXA 1XCGA 2D9XA 3PG7A 3SYXA 3TCAA 1U2BA 2YS1A 1V5UA 2DX1A 3ZVRA 5C16A 2D9YA 4WSFA 2DTCA 3KRWA 2EMTA 4A6HA 3BJIA 2PZ1A 1LB1A 4NSWA 4EKUA 5JP4A 4K2PA 5J3TA 5HE2A 4A6FA 1U5DA 3T06A 2BCJA 5LONB 1EVHA 3N7CA 5J3YA 1WJMA 2DHKA 1DDWA 1BTNA 3HQCA 5L81A 1V61A 3SUZA 1WGUA 1MK7B 3FM8C 2MDXA 3MDBC 1UEFA 2L2IA 1ZSQA 4DX90 2P0HA 2Y7BA 1MIZB 4WVFB 2K2UA 4HAXB 1OY2A 1NI2A 2H7EA 2ROZB 2GJYA 3QIJA 2IFSA 1U29A 4DX8A 2RUKB 3SNHA 5DIFB 3GYPA 2K2JA 4P7IA 2MKRA 2UVMA 4IOYX 5C5BA 2DFKA 5KQ1A 4HHVA 1WG7A 1FHWA 4A5KA 2D4QA 2IYBA 2I5CA 1E5WA 2J0MA 5HE3A 4KAXB
chains in the Genus database with same CATH superfamily
2J0JA 3KZ1A 2COFA 2YT0A 4MY6A 2DHIA 5FI0A 2KUQA 3VIAA 2FJUB 1KI1B 1U5FA 5C79A 4QJ5B 3PVUA 4ZRJA 1I2HA 2Z13A 4YONA 3SO6A 3OANA 3TO1A 5I2MA 5DHFB 2YS5A 3ODOA 5CLLB 1W1HA 1XR0B 2Y8FA 4KHBB 2I1KA 3BINA 1PMSA 3IVFA 1H10A 3NWAA 2J0KA 4L6EA 3HIEA 2RSGA 4HB3B 2I5FA 1P5TA 2LULA 1OQNA 3AU4A 1M7EA 3A58A 1QQGA 3HSAA 2DYQA 3DXDA 1FAOA 2V76A 2QKLA 4OSNA 2D9ZA 4IAPA 3WYFB 4F7HA 4HATB 3D8FA 3G9WA 2CAYA 4QJ3B 1EAZA 4F7GA 4PQ0A 3KY9A 1AWEA 2EMSA 2K00A 5D3YA 2KGXB 2RLOA 3TVVA 1MI1A 5JHHA 1FGZA 2MWNB 3GYOA 2HE7A 4MK0A 3OHMB 3D8DA 1ZM0A 2RNRB 5EFXA 1UNQA 2DKPA 2EJ8A 2W2WA 1K5DB 1TJ6A 2AEHA 2GS0A 1WVHA 2NBVA 2R2YA 4GMVA 1GC7A 4GMXB 5KQ4A 2Z0PA 5C5BB 1X11A 4HAVB 3NSUA 3F0WA 4A6KA 3KSYA 4ZRKA 1Y5OA 2LKOA 1KZGA 3A98B 2YF0A 2ELBA 2P0DA 1TXDA 4Z2NA 1V89A 1DYNA 3WA0A 2KUPA 1NTYA 1P6SA 2YT2A 1DBHA 2K49A 2LG1A 2D9WA 2MFQA 2COCA 5KCVA 4HAYB 1UNPA 1MIXA 2Q13A 2RVBB 3ZDTA 2J59M 2YSZA 2P8VA 5DI9B 1I7AA 1X1GA 1Q67A 3PSCA 3U12A 1X86A 1Y19B 3FEHA 2VSZA 2GCJA 4L1RA 1J0WA 1DDVA 4MT7A 1QC6A 2CY4A 4HSIA 1NTVA 2R0DA 5HE1A 1SHCA 1P3RA 1KZ7A 2N23A 2I1JA 3VOQA 1XD4A 4NY0A 2COAA 1WI1A 2UZRA 3TFMA 4K2OA 4HB2B 5LG4B 3RCPA 1EF1A 1ZYIA 4EJNA 1RJ2A 3PVWA 3B77A 1W1GA 2L1CA 2DN6A 4ZRIA 2LYDA 2JP2A 1RRPB 1UNRA 4A6FB 3TW1A 1J19A 1BTKA 2D9VA 1FB8A 2M38A 1FOEA 3M1IB 1XX0A 2UZSA 4GN1A 3FVCA 4HAUB 2DHJA 3DXCA 4F7UP 2ZKMX 1Z87A 1U5EA 3MPXA 3NW8A 4DIXA 2KCJA 5D3VA 1MKEA 1GG3A 5DH9B 1ZC3B 3DXEA 2Z59A 4HB0B 2AL6A 2DKQA 2DYNA 1XKEA 4KHOA 2ADZA 4TYZA 3QWMA 2E2XA 1DDMA 1FHXA 2ZPYA 1N3HA 1X05A 4PNKA 2P0FA 2X18A 3SV1A 3U7DA 4C0AA 2VKIA 5JLJB 2OQBA 2W2XD 2Y8GA 1X1FA 4DXAB 4QJ4B 3AJ4A 4GZUA 1TQZA 3ULCA 4KVGB 2DLWA 2QKMA 2NZ8B 2GUMA 3U8ZA 4Y94A 2FJLA 2R09A 1IRSA 4HB4B 2ROVA 3CIKA 3A8PA 3NWDA 3ODWA 1H4RA 2KIGA 3V5WA 4K17A 4HAWB 1GC6A 5FI1A 4OT1A 4HDOA 4B6HA 4CHMA 2Z4DA 3ODXA 3PP2A 2GCLA 3PZDA 4YL8A 1B55A 1ZVRA 2N0YA 1UPRA 3KRXA 1MPHA 2ELAA 3P6AA 5HE0A 2H7DA 4KHAA 3PEGA 5D3XA 2OTXA 2CRFA 2RRFA 3AU5A 5LOPB 1WGQA 3DCXA 4D0NB 3A8QA 1NU2A 5CLQB 2G35A 3P7ZA 3LJUX 5JHGA 1M7RA 4GOUA 2CY5A 2HTHB 1T77A 2LOXA 3D8EA 1W1DA 2K8EA 4WJ7A 5DHAB 3CXBB 2Z0OA 2DX5A 1DROA 3HW2B 1U27A 3O96A 4BBKA 5GOWB 1U5GA 1V5PA 2RGNB 1XODA 2EC1A 1PLSA 4IFSA 4CHJA 2VRWB 4CYEA 4HAZB 4DBBA 1OMWA 2YS3A 2DA0A 4TKNA 1BAKA 3ULBA 3FSSA 1ZC4B 2KR0A 3F5RA 5IRSA 4XWXA 1V5MA 3HK0A 4GXBA 2YVCA 4Z2MB 2D10A 3X23A 2NMBA 4H8SA 2LOZA 2XQNM 1WJ1A 3UZTA 1UPQA 1MAIA 3PVLA 1LW3A 2YT1A 5D27A 5J3QA 1AQCA 4K81A 5C6RA 4HDQA 2YRYA 1ISNA 1FGYA 1SGHA 1FHOA 2Z0QA 3QBVB 2CODA 1K5GB 4GPTB 4D6WA 4EMOA 1V88A 1MK9B 2M14A 2W2XC 1BWNA 1PFJA 2D2QA 3ML4A 2D11A 5D3WA 1EGXA 1XCGA 2D9XA 3PG7A 3SYXA 4KHBA 3TCAA 1U2BA 2YS1A 1V5UA 2DX1A 3ZVRA 5C16A 2D9YA 4WSFA 2DTCA 3KRWA 2EMTA 4A6HA 3BJIA 2PZ1A 1LB1A 4NSWA 4EKUA 5JP4A 4K2PA 5J3TA 4GNKB 5M4YB 5HE2A 4A6FA 1U5DA 3T06A 2BCJA 5LONB 1EVHA 2Z14A 4CSQA 3N7CA 5J3YA 1WJMA 2DHKA 1DDWA 1BTNA 3NWFA 3HQCA 2KIEA 5L81A 1V61A 3SUZA 1WGUA 1MK7B 3FM8C 2MDXA 3MDBC 1UEFA 2L2IA 1ZSQA 4DX90 2P0HA 2Y7BA 1MIZB 4WVFB 2K2UA 4HAXB 1OY2A 1NI2A 2H7EA 2ROZB 2GJYA 3QIJA 2IFSA 1U29A 4DX8A 2RUKB 3SNHA 5DIFB 3GYPA 2K2JA 4P7IA 4QXAB 2MKRA 2UVMA 4IOYX 5C5BA 2DFKA 5KQ1A 4HHVA 5I2SA 1WG7A 1FHWA 4A5KA 2D4QA 2IYBA 2I5CA 1E5WA 2J0MA 5HE3A 4KAXB
chains in the Genus database with same CATH topology
2J0JA 3KZ1A 2COFA 2YT0A 4MY6A 2DHIA 5FI0A 3VIAA 1KI1B 1U5FA 5C79A 3PVUA 4ZRJA 1I2HA 4YONA 3SO6A 3OANA 3TO1A 5DHFB 2YS5A 3ODOA 5CLLB 1W1HA 1XR0B 2Y8FA 4KHBB 2I1KA 3BINA 1PMSA 3IVFA 1H10A 2J0KA 4L6EA 2RSGA 4HB3B 2I5FA 1P5TA 2LULA 1OQNA 3AU4A 1M7EA 1QQGA 2DYQA 3DXDA 1FAOA 2V76A 2QKLA 2D9ZA 4IAPA 3WYFB 4F7HA 4HATB 3D8FA 3G9WA 2CAYA 1EAZA 4F7GA 4PQ0A 3KY9A 1AWEA 2EMSA 2K00A 5D3YA 2KGXB 2RLOA 3TVVA 5JHHA 1FGZA 2MWNB 3GYOA 2HE7A 4MK0A 3D8DA 1ZM0A 2RNRB 5EFXA 1UNQA 2DKPA 2EJ8A 2W2WA 1K5DB 1TJ6A 2AEHA 2GS0A 1WVHA 4GMVA 1GC7A 4GMXB 5KQ4A 2Z0PA 5C5BB 1X11A 4HAVB 3NSUA 3F0WA 4A6KA 3KSYA 4ZRKA 1Y5OA 2LKOA 1KZGA 3A98B 2YF0A 2ELBA 2P0DA 1TXDA 4Z2NA 1V89A 1DYNA 3WA0A 2KUPA 1NTYA 1P6SA 1DBHA 2LG1A 2D9WA 2MFQA 2COCA 5KCVA 4HAYB 1UNPA 1MIXA 2Q13A 2RVBB 3ZDTA 2J59M 2YSZA 2P8VA 5DI9B 1I7AA 1X1GA 1Q67A 3PSCA 1X86A 1Y19B 3FEHA 2VSZA 2GCJA 1J0WA 1DDVA 4MT7A 1QC6A 2CY4A 1NTVA 2R0DA 5HE1A 1SHCA 1P3RA 1KZ7A 2N23A 2I1JA 3VOQA 1XD4A 4NY0A 2COAA 1WI1A 2UZRA 3TFMA 4K2OA 4HB2B 3RCPA 1EF1A 4EJNA 1RJ2A 3PVWA 1W1GA 2L1CA 2DN6A 4ZRIA 2LYDA 2JP2A 1RRPB 1UNRA 4A6FB 3TW1A 1J19A 1BTKA 2D9VA 1FB8A 2M38A 1FOEA 3M1IB 1XX0A 2UZSA 4GN1A 4HAUB 2DHJA 3DXCA 4F7UP 1Z87A 1U5EA 3MPXA 2KCJA 5D3VA 1MKEA 1GG3A 5DH9B 1ZC3B 3DXEA 4HB0B 2AL6A 2DKQA 2DYNA 1XKEA 4KHOA 2ADZA 4TYZA 3QWMA 2E2XA 1DDMA 1FHXA 2ZPYA 1N3HA 1X05A 4PNKA 2P0FA 2X18A 3SV1A 3U7DA 4C0AA 2VKIA 5JLJB 2OQBA 2W2XD 2Y8GA 1X1FA 4DXAB 3AJ4A 4GZUA 1TQZA 3ULCA 4KVGB 2DLWA 2QKMA 2NZ8B 3U8ZA 4Y94A 2FJLA 2R09A 1IRSA 4HB4B 2ROVA 3CIKA 3A8PA 3ODWA 1H4RA 3V5WA 4K17A 4HAWB 1GC6A 5FI1A 4HDOA 4B6HA 4CHMA 3ODXA 3PP2A 2GCLA 3PZDA 4YL8A 1B55A 1ZVRA 2N0YA 1UPRA 3KRXA 1MPHA 2ELAA 3P6AA 5HE0A 2H7DA 4KHAA 3PEGA 5D3XA 2OTXA 2CRFA 3AU5A 5LOPB 1WGQA 4D0NB 3A8QA 1NU2A 5CLQB 2G35A 3P7ZA 3LJUX 5JHGA 1M7RA 2CY5A 2HTHB 2LOXA 3D8EA 1W1DA 5DHAB 4WJ7A 3CXBB 2Z0OA 2DX5A 1DROA 3HW2B 1U27A 3O96A 4BBKA 5GOWB 1U5GA 1V5PA 2RGNB 1XODA 2EC1A 1PLSA 4IFSA 4CHJA 2VRWB 4CYEA 4HAZB 4DBBA 1OMWA 2YS3A 2DA0A 4TKNA 1BAKA 3ULBA 3FSSA 1ZC4B 3F5RA 4XWXA 1V5MA 3HK0A 4GXBA 2YVCA 4Z2MB 2D10A 3X23A 2NMBA 4H8SA 2LOZA 2XQNM 1WJ1A 3UZTA 1UPQA 1MAIA 3PVLA 1LW3A 2YT1A 5D27A 5J3QA 1AQCA 4K81A 5C6RA 4HDQA 2YRYA 1ISNA 1FGYA 1SGHA 1FHOA 2Z0QA 3QBVB 2CODA 1K5GB 4GPTB 4EMOA 1V88A 1MK9B 2M14A 2W2XC 1BWNA 1PFJA 2D2QA 3ML4A 2D11A 5D3WA 1EGXA 1XCGA 2D9XA 3PG7A 3SYXA 3TCAA 1U2BA 2YS1A 1V5UA 2DX1A 3ZVRA 5C16A 2D9YA 4WSFA 2DTCA 3KRWA 2EMTA 4A6HA 3BJIA 2PZ1A 1LB1A 4NSWA 4EKUA 5JP4A 4K2PA 5J3TA 5HE2A 4A6FA 1U5DA 3T06A 2BCJA 5LONB 1EVHA 3N7CA 5J3YA 1WJMA 2DHKA 1DDWA 1BTNA 3HQCA 5L81A 1V61A 3SUZA 1WGUA 1MK7B 3FM8C 2MDXA 3MDBC 1UEFA 2L2IA 1ZSQA 4DX90 2P0HA 2Y7BA 1MIZB 4WVFB 2K2UA 4HAXB 1OY2A 1NI2A 2H7EA 2ROZB 2GJYA 3QIJA 2IFSA 1U29A 4DX8A 2RUKB 3SNHA 5DIFB 3GYPA 2K2JA 4P7IA 2MKRA 2UVMA 4IOYX 5C5BA 2DFKA 5KQ1A 4HHVA 1WG7A 1FHWA 4A5KA 2D4QA 2IYBA 2I5CA 1E5WA 2J0MA 5HE3A 4KAXB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J0J A;  3KZ1 A;  2COF A;  2YT0 A;  4MY6 A;  2DHI A;  5FI0 A;  3VIA A;  1KI1 B;  1U5F A;  5C79 A;  3PVU A;  4ZRJ A;  1I2H A;  4YON A;  3SO6 A;  3OAN A;  3TO1 A;  5DHF B;  2YS5 A;  3ODO A;  5CLL B;  1W1H A;  1XR0 B;  2Y8F A;  4KHB B;  2I1K A;  3BIN A;  1PMS A;  3IVF A;  1H10 A;  2J0K A;  4L6E A;  2RSG A;  4HB3 B;  2I5F A;  1P5T A;  2LUL A;  1OQN A;  3AU4 A;  1M7E A;  1QQG A;  2DYQ A;  3DXD A;  1FAO A;  2V76 A;  2QKL A;  2D9Z A;  4IAP A;  3WYF B;  4F7H A;  4HAT B;  3D8F A;  3G9W A;  2CAY A;  1EAZ A;  4F7G A;  4PQ0 A;  3KY9 A;  1AWE A;  2EMS A;  2K00 A;  5D3Y A;  2KGX B;  2RLO A;  3TVV A;  5JHH A;  1FGZ A;  2MWN B;  3GYO A;  2HE7 A;  4MK0 A;  3D8D A;  1ZM0 A;  2RNR B;  5EFX A;  1UNQ A;  2DKP A;  2EJ8 A;  2W2W A;  1K5D B;  1TJ6 A;  2AEH A;  2GS0 A;  1WVH A;  4GMV A;  1GC7 A;  4GMX B;  5KQ4 A;  2Z0P A;  5C5B B;  1X11 A;  4HAV B;  3NSU A;  3F0W A;  4A6K A;  3KSY A;  4ZRK A;  1Y5O A;  2LKO A;  1KZG A;  3A98 B;  2YF0 A;  2ELB A;  2P0D A;  1TXD A;  4Z2N A;  1V89 A;  1DYN A;  3WA0 A;  2KUP A;  1NTY A;  1P6S A;  1DBH A;  2LG1 A;  2D9W A;  2MFQ A;  2COC A;  5KCV A;  4HAY B;  1UNP A;  1MIX A;  2Q13 A;  2RVB B;  3ZDT A;  2J59 M;  2YSZ A;  2P8V A;  5DI9 B;  1I7A A;  1X1G A;  1Q67 A;  3PSC A;  1X86 A;  1Y19 B;  3FEH A;  2VSZ A;  2GCJ A;  1J0W A;  1DDV A;  4MT7 A;  1QC6 A;  2CY4 A;  1NTV A;  2R0D A;  5HE1 A;  1SHC A;  1P3R A;  1KZ7 A;  2N23 A;  2I1J A;  3VOQ A;  1XD4 A;  4NY0 A;  2COA A;  1WI1 A;  2UZR A;  3TFM A;  4K2O A;  4HB2 B;  3RCP A;  1EF1 A;  4EJN A;  1RJ2 A;  3PVW A;  1W1G A;  2L1C A;  2DN6 A;  4ZRI A;  2LYD A;  2JP2 A;  1RRP B;  1UNR A;  4A6F B;  3TW1 A;  1J19 A;  1BTK A;  2D9V A;  1FB8 A;  2M38 A;  1FOE A;  3M1I B;  1XX0 A;  2UZS A;  4GN1 A;  4HAU B;  2DHJ A;  3DXC A;  4F7U P;  1Z87 A;  1U5E A;  3MPX A;  2KCJ A;  5D3V A;  1MKE A;  1GG3 A;  5DH9 B;  1ZC3 B;  3DXE A;  4HB0 B;  2AL6 A;  2DKQ A;  2DYN A;  1XKE A;  4KHO A;  2ADZ A;  4TYZ A;  3QWM A;  2E2X A;  1DDM A;  1FHX A;  2ZPY A;  1N3H A;  1X05 A;  4PNK A;  2P0F A;  2X18 A;  3SV1 A;  3U7D A;  4C0A A;  2VKI A;  5JLJ B;  2OQB A;  2W2X D;  2Y8G A;  1X1F A;  4DXA B;  3AJ4 A;  4GZU A;  1TQZ A;  3ULC A;  4KVG B;  2DLW A;  2QKM A;  2NZ8 B;  3U8Z A;  4Y94 A;  2FJL A;  2R09 A;  1IRS A;  4HB4 B;  2ROV A;  3CIK A;  3A8P A;  3ODW A;  1H4R A;  3V5W A;  4K17 A;  4HAW B;  1GC6 A;  5FI1 A;  4HDO A;  4B6H A;  4CHM A;  3ODX A;  3PP2 A;  2GCL A;  3PZD A;  4YL8 A;  1B55 A;  1ZVR A;  2N0Y A;  1UPR A;  3KRX A;  1MPH A;  2ELA A;  3P6A A;  5HE0 A;  2H7D A;  4KHA A;  3PEG A;  5D3X A;  2OTX A;  2CRF A;  3AU5 A;  5LOP B;  1WGQ A;  4D0N B;  3A8Q A;  1NU2 A;  5CLQ B;  2G35 A;  3P7Z A;  3LJU X;  5JHG A;  1M7R A;  2CY5 A;  2HTH B;  2LOX A;  3D8E A;  1W1D A;  5DHA B;  4WJ7 A;  3CXB B;  2Z0O A;  2DX5 A;  1DRO A;  3HW2 B;  1U27 A;  3O96 A;  4BBK A;  5GOW B;  1U5G A;  1V5P A;  2RGN B;  1XOD A;  2EC1 A;  1PLS A;  4IFS A;  4CHJ A;  2VRW B;  4CYE A;  4HAZ B;  4DBB A;  1OMW A;  2YS3 A;  2DA0 A;  4TKN A;  1BAK A;  3ULB A;  3FSS A;  1ZC4 B;  3F5R A;  4XWX A;  1V5M A;  3HK0 A;  4GXB A;  2YVC A;  4Z2M B;  2D10 A;  3X23 A;  2NMB A;  4H8S A;  2LOZ A;  2XQN M;  1WJ1 A;  3UZT A;  1UPQ A;  1MAI A;  3PVL A;  1LW3 A;  2YT1 A;  5D27 A;  5J3Q A;  1AQC A;  4K81 A;  5C6R A;  4HDQ A;  2YRY A;  1ISN A;  1FGY A;  1SGH A;  1FHO A;  2Z0Q A;  3QBV B;  2COD A;  1K5G B;  4GPT B;  4EMO A;  1V88 A;  1MK9 B;  2M14 A;  2W2X C;  1BWN A;  1PFJ A;  2D2Q A;  3ML4 A;  2D11 A;  5D3W A;  1EGX A;  1XCG A;  2D9X A;  3PG7 A;  3SYX A;  3TCA A;  1U2B A;  2YS1 A;  1V5U A;  2DX1 A;  3ZVR A;  5C16 A;  2D9Y A;  4WSF A;  2DTC A;  3KRW A;  2EMT A;  4A6H A;  3BJI A;  2PZ1 A;  1LB1 A;  4NSW A;  4EKU A;  5JP4 A;  4K2P A;  5J3T A;  5HE2 A;  4A6F A;  1U5D A;  3T06 A;  2BCJ A;  5LON B;  1EVH A;  3N7C A;  5J3Y A;  1WJM A;  2DHK A;  1DDW A;  1BTN A;  3HQC A;  5L81 A;  1V61 A;  3SUZ A;  1WGU A;  1MK7 B;  3FM8 C;  2MDX A;  3MDB C;  1UEF A;  2L2I A;  1ZSQ A;  4DX9 0;  2P0H A;  2Y7B A;  1MIZ B;  4WVF B;  2K2U A;  4HAX B;  1OY2 A;  1NI2 A;  2H7E A;  2ROZ B;  2GJY A;  3QIJ A;  2IFS A;  1U29 A;  4DX8 A;  2RUK B;  3SNH A;  5DIF B;  3GYP A;  2K2J A;  4P7I A;  2MKR A;  2UVM A;  4IOY X;  5C5B A;  2DFK A;  5KQ1 A;  4HHV A;  1WG7 A;  1FHW A;  4A5K A;  2D4Q A;  2IYB A;  2I5C A;  1E5W A;  2J0M A;  5HE3 A;  4KAX B; 
#chains in the Genus database with same CATH topology
 2J0J A;  3KZ1 A;  2COF A;  2YT0 A;  4MY6 A;  2DHI A;  5FI0 A;  2KUQ A;  3VIA A;  2FJU B;  1KI1 B;  1U5F A;  5C79 A;  4QJ5 B;  3PVU A;  4ZRJ A;  1I2H A;  2Z13 A;  4YON A;  3SO6 A;  3OAN A;  3TO1 A;  5I2M A;  5DHF B;  2YS5 A;  3ODO A;  5CLL B;  1W1H A;  1XR0 B;  2Y8F A;  4KHB B;  2I1K A;  3BIN A;  1PMS A;  3IVF A;  1H10 A;  3NWA A;  2J0K A;  4L6E A;  3HIE A;  2RSG A;  4HB3 B;  2I5F A;  1P5T A;  2LUL A;  1OQN A;  3AU4 A;  1M7E A;  3A58 A;  1QQG A;  3HSA A;  2DYQ A;  3DXD A;  1FAO A;  2V76 A;  2QKL A;  4OSN A;  2D9Z A;  4IAP A;  3WYF B;  4F7H A;  4HAT B;  3D8F A;  3G9W A;  2CAY A;  4QJ3 B;  1EAZ A;  4F7G A;  4PQ0 A;  3KY9 A;  1AWE A;  2EMS A;  2K00 A;  5D3Y A;  2KGX B;  2RLO A;  3TVV A;  1MI1 A;  5JHH A;  1FGZ A;  2MWN B;  3GYO A;  2HE7 A;  4MK0 A;  3OHM B;  3D8D A;  1ZM0 A;  2RNR B;  5EFX A;  1UNQ A;  2DKP A;  2EJ8 A;  2W2W A;  1K5D B;  1TJ6 A;  2AEH A;  2GS0 A;  1WVH A;  2NBV A;  2R2Y A;  4GMV A;  1GC7 A;  4GMX B;  5KQ4 A;  2Z0P A;  5C5B B;  1X11 A;  4HAV B;  3NSU A;  3F0W A;  4A6K A;  3KSY A;  4ZRK A;  1Y5O A;  2LKO A;  1KZG A;  3A98 B;  2YF0 A;  2ELB A;  2P0D A;  1TXD A;  4Z2N A;  1V89 A;  1DYN A;  3WA0 A;  2KUP A;  1NTY A;  1P6S A;  2YT2 A;  1DBH A;  2K49 A;  2LG1 A;  2D9W A;  2MFQ A;  2COC A;  5KCV A;  4HAY B;  1UNP A;  1MIX A;  2Q13 A;  2RVB B;  3ZDT A;  2J59 M;  2YSZ A;  2P8V A;  5DI9 B;  1I7A A;  1X1G A;  1Q67 A;  3PSC A;  3U12 A;  1X86 A;  1Y19 B;  3FEH A;  2VSZ A;  2GCJ A;  4L1R A;  1J0W A;  1DDV A;  4MT7 A;  1QC6 A;  2CY4 A;  4HSI A;  1NTV A;  2R0D A;  5HE1 A;  1SHC A;  1P3R A;  1KZ7 A;  2N23 A;  2I1J A;  3VOQ A;  1XD4 A;  4NY0 A;  2COA A;  1WI1 A;  2UZR A;  3TFM A;  4K2O A;  4HB2 B;  5LG4 B;  3RCP A;  1EF1 A;  1ZYI A;  4EJN A;  1RJ2 A;  3PVW A;  3B77 A;  1W1G A;  2L1C A;  2DN6 A;  4ZRI A;  2LYD A;  2JP2 A;  1RRP B;  1UNR A;  4A6F B;  3TW1 A;  1J19 A;  1BTK A;  2D9V A;  1FB8 A;  2M38 A;  1FOE A;  3M1I B;  1XX0 A;  2UZS A;  4GN1 A;  3FVC A;  4HAU B;  2DHJ A;  3DXC A;  4F7U P;  2ZKM X;  1Z87 A;  1U5E A;  3MPX A;  3NW8 A;  4DIX A;  2KCJ A;  5D3V A;  1MKE A;  1GG3 A;  5DH9 B;  1ZC3 B;  3DXE A;  2Z59 A;  4HB0 B;  2AL6 A;  2DKQ A;  2DYN A;  1XKE A;  4KHO A;  2ADZ A;  4TYZ A;  3QWM A;  2E2X A;  1DDM A;  1FHX A;  2ZPY A;  1N3H A;  1X05 A;  4PNK A;  2P0F A;  2X18 A;  3SV1 A;  3U7D A;  4C0A A;  2VKI A;  5JLJ B;  2OQB A;  2W2X D;  2Y8G A;  1X1F A;  4DXA B;  4QJ4 B;  3AJ4 A;  4GZU A;  1TQZ A;  3ULC A;  4KVG B;  2DLW A;  2QKM A;  2NZ8 B;  2GUM A;  3U8Z A;  4Y94 A;  2FJL A;  2R09 A;  1IRS A;  4HB4 B;  2ROV A;  3CIK A;  3A8P A;  3NWD A;  3ODW A;  1H4R A;  2KIG A;  3V5W A;  4K17 A;  4HAW B;  1GC6 A;  5FI1 A;  4OT1 A;  4HDO A;  4B6H A;  4CHM A;  2Z4D A;  3ODX A;  3PP2 A;  2GCL A;  3PZD A;  4YL8 A;  1B55 A;  1ZVR A;  2N0Y A;  1UPR A;  3KRX A;  1MPH A;  2ELA A;  3P6A A;  5HE0 A;  2H7D A;  4KHA A;  3PEG A;  5D3X A;  2OTX A;  2CRF A;  2RRF A;  3AU5 A;  5LOP B;  1WGQ A;  3DCX A;  4D0N B;  3A8Q A;  1NU2 A;  5CLQ B;  2G35 A;  3P7Z A;  3LJU X;  5JHG A;  1M7R A;  4GOU A;  2CY5 A;  2HTH B;  1T77 A;  2LOX A;  3D8E A;  1W1D A;  2K8E A;  4WJ7 A;  5DHA B;  3CXB B;  2Z0O A;  2DX5 A;  1DRO A;  3HW2 B;  1U27 A;  3O96 A;  4BBK A;  5GOW B;  1U5G A;  1V5P A;  2RGN B;  1XOD A;  2EC1 A;  1PLS A;  4IFS A;  4CHJ A;  2VRW B;  4CYE A;  4HAZ B;  4DBB A;  1OMW A;  2YS3 A;  2DA0 A;  4TKN A;  1BAK A;  3ULB A;  3FSS A;  1ZC4 B;  2KR0 A;  3F5R A;  5IRS A;  4XWX A;  1V5M A;  3HK0 A;  4GXB A;  2YVC A;  4Z2M B;  2D10 A;  3X23 A;  2NMB A;  4H8S A;  2LOZ A;  2XQN M;  1WJ1 A;  3UZT A;  1UPQ A;  1MAI A;  3PVL A;  1LW3 A;  2YT1 A;  5D27 A;  5J3Q A;  1AQC A;  4K81 A;  5C6R A;  4HDQ A;  2YRY A;  1ISN A;  1FGY A;  1SGH A;  1FHO A;  2Z0Q A;  3QBV B;  2COD A;  1K5G B;  4GPT B;  4D6W A;  4EMO A;  1V88 A;  1MK9 B;  2M14 A;  2W2X C;  1BWN A;  1PFJ A;  2D2Q A;  3ML4 A;  2D11 A;  5D3W A;  1EGX A;  1XCG A;  2D9X A;  3PG7 A;  3SYX A;  4KHB A;  3TCA A;  1U2B A;  2YS1 A;  1V5U A;  2DX1 A;  3ZVR A;  5C16 A;  2D9Y A;  4WSF A;  2DTC A;  3KRW A;  2EMT A;  4A6H A;  3BJI A;  2PZ1 A;  1LB1 A;  4NSW A;  4EKU A;  5JP4 A;  4K2P A;  5J3T A;  4GNK B;  5M4Y B;  5HE2 A;  4A6F A;  1U5D A;  3T06 A;  2BCJ A;  5LON B;  1EVH A;  2Z14 A;  4CSQ A;  3N7C A;  5J3Y A;  1WJM A;  2DHK A;  1DDW A;  1BTN A;  3NWF A;  3HQC A;  2KIE A;  5L81 A;  1V61 A;  3SUZ A;  1WGU A;  1MK7 B;  3FM8 C;  2MDX A;  3MDB C;  1UEF A;  2L2I A;  1ZSQ A;  4DX9 0;  2P0H A;  2Y7B A;  1MIZ B;  4WVF B;  2K2U A;  4HAX B;  1OY2 A;  1NI2 A;  2H7E A;  2ROZ B;  2GJY A;  3QIJ A;  2IFS A;  1U29 A;  4DX8 A;  2RUK B;  3SNH A;  5DIF B;  3GYP A;  2K2J A;  4P7I A;  4QXA B;  2MKR A;  2UVM A;  4IOY X;  5C5B A;  2DFK A;  5KQ1 A;  4HHV A;  5I2S A;  1WG7 A;  1FHW A;  4A5K A;  2D4Q A;  2IYB A;  2I5C A;  1E5W A;  2J0M A;  5HE3 A;  4KAX B; 
#chains in the Genus database with same CATH homology
 2J0J A;  3KZ1 A;  2COF A;  2YT0 A;  4MY6 A;  2DHI A;  5FI0 A;  3VIA A;  1KI1 B;  1U5F A;  5C79 A;  3PVU A;  4ZRJ A;  1I2H A;  4YON A;  3SO6 A;  3OAN A;  3TO1 A;  5DHF B;  2YS5 A;  3ODO A;  5CLL B;  1W1H A;  1XR0 B;  2Y8F A;  4KHB B;  2I1K A;  3BIN A;  1PMS A;  3IVF A;  1H10 A;  2J0K A;  4L6E A;  2RSG A;  4HB3 B;  2I5F A;  1P5T A;  2LUL A;  1OQN A;  3AU4 A;  1M7E A;  1QQG A;  2DYQ A;  3DXD A;  1FAO A;  2V76 A;  2QKL A;  2D9Z A;  4IAP A;  3WYF B;  4F7H A;  4HAT B;  3D8F A;  3G9W A;  2CAY A;  1EAZ A;  4F7G A;  4PQ0 A;  3KY9 A;  1AWE A;  2EMS A;  2K00 A;  5D3Y A;  2KGX B;  2RLO A;  3TVV A;  5JHH A;  1FGZ A;  2MWN B;  3GYO A;  2HE7 A;  4MK0 A;  3D8D A;  1ZM0 A;  2RNR B;  5EFX A;  1UNQ A;  2DKP A;  2EJ8 A;  2W2W A;  1K5D B;  1TJ6 A;  2AEH A;  2GS0 A;  1WVH A;  4GMV A;  1GC7 A;  4GMX B;  5KQ4 A;  2Z0P A;  5C5B B;  1X11 A;  4HAV B;  3NSU A;  3F0W A;  4A6K A;  3KSY A;  4ZRK A;  1Y5O A;  2LKO A;  1KZG A;  3A98 B;  2YF0 A;  2ELB A;  2P0D A;  1TXD A;  4Z2N A;  1V89 A;  1DYN A;  3WA0 A;  2KUP A;  1NTY A;  1P6S A;  1DBH A;  2LG1 A;  2D9W A;  2MFQ A;  2COC A;  5KCV A;  4HAY B;  1UNP A;  1MIX A;  2Q13 A;  2RVB B;  3ZDT A;  2J59 M;  2YSZ A;  2P8V A;  5DI9 B;  1I7A A;  1X1G A;  1Q67 A;  3PSC A;  1X86 A;  1Y19 B;  3FEH A;  2VSZ A;  2GCJ A;  1J0W A;  1DDV A;  4MT7 A;  1QC6 A;  2CY4 A;  1NTV A;  2R0D A;  5HE1 A;  1SHC A;  1P3R A;  1KZ7 A;  2N23 A;  2I1J A;  3VOQ A;  1XD4 A;  4NY0 A;  2COA A;  1WI1 A;  2UZR A;  3TFM A;  4K2O A;  4HB2 B;  3RCP A;  1EF1 A;  4EJN A;  1RJ2 A;  3PVW A;  1W1G A;  2L1C A;  2DN6 A;  4ZRI A;  2LYD A;  2JP2 A;  1RRP B;  1UNR A;  4A6F B;  3TW1 A;  1J19 A;  1BTK A;  2D9V A;  1FB8 A;  2M38 A;  1FOE A;  3M1I B;  1XX0 A;  2UZS A;  4GN1 A;  4HAU B;  2DHJ A;  3DXC A;  4F7U P;  1Z87 A;  1U5E A;  3MPX A;  2KCJ A;  5D3V A;  1MKE A;  1GG3 A;  5DH9 B;  1ZC3 B;  3DXE A;  4HB0 B;  2AL6 A;  2DKQ A;  2DYN A;  1XKE A;  4KHO A;  2ADZ A;  4TYZ A;  3QWM A;  2E2X A;  1DDM A;  1FHX A;  2ZPY A;  1N3H A;  1X05 A;  4PNK A;  2P0F A;  2X18 A;  3SV1 A;  3U7D A;  4C0A A;  2VKI A;  5JLJ B;  2OQB A;  2W2X D;  2Y8G A;  1X1F A;  4DXA B;  3AJ4 A;  4GZU A;  1TQZ A;  3ULC A;  4KVG B;  2DLW A;  2QKM A;  2NZ8 B;  3U8Z A;  4Y94 A;  2FJL A;  2R09 A;  1IRS A;  4HB4 B;  2ROV A;  3CIK A;  3A8P A;  3ODW A;  1H4R A;  3V5W A;  4K17 A;  4HAW B;  1GC6 A;  5FI1 A;  4HDO A;  4B6H A;  4CHM A;  3ODX A;  3PP2 A;  2GCL A;  3PZD A;  4YL8 A;  1B55 A;  1ZVR A;  2N0Y A;  1UPR A;  3KRX A;  1MPH A;  2ELA A;  3P6A A;  5HE0 A;  2H7D A;  4KHA A;  3PEG A;  5D3X A;  2OTX A;  2CRF A;  3AU5 A;  5LOP B;  1WGQ A;  4D0N B;  3A8Q A;  1NU2 A;  5CLQ B;  2G35 A;  3P7Z A;  3LJU X;  5JHG A;  1M7R A;  2CY5 A;  2HTH B;  2LOX A;  3D8E A;  1W1D A;  5DHA B;  4WJ7 A;  3CXB B;  2Z0O A;  2DX5 A;  1DRO A;  3HW2 B;  1U27 A;  3O96 A;  4BBK A;  5GOW B;  1U5G A;  1V5P A;  2RGN B;  1XOD A;  2EC1 A;  1PLS A;  4IFS A;  4CHJ A;  2VRW B;  4CYE A;  4HAZ B;  4DBB A;  1OMW A;  2YS3 A;  2DA0 A;  4TKN A;  1BAK A;  3ULB A;  3FSS A;  1ZC4 B;  3F5R A;  4XWX A;  1V5M A;  3HK0 A;  4GXB A;  2YVC A;  4Z2M B;  2D10 A;  3X23 A;  2NMB A;  4H8S A;  2LOZ A;  2XQN M;  1WJ1 A;  3UZT A;  1UPQ A;  1MAI A;  3PVL A;  1LW3 A;  2YT1 A;  5D27 A;  5J3Q A;  1AQC A;  4K81 A;  5C6R A;  4HDQ A;  2YRY A;  1ISN A;  1FGY A;  1SGH A;  1FHO A;  2Z0Q A;  3QBV B;  2COD A;  1K5G B;  4GPT B;  4EMO A;  1V88 A;  1MK9 B;  2M14 A;  2W2X C;  1BWN A;  1PFJ A;  2D2Q A;  3ML4 A;  2D11 A;  5D3W A;  1EGX A;  1XCG A;  2D9X A;  3PG7 A;  3SYX A;  3TCA A;  1U2B A;  2YS1 A;  1V5U A;  2DX1 A;  3ZVR A;  5C16 A;  2D9Y A;  4WSF A;  2DTC A;  3KRW A;  2EMT A;  4A6H A;  3BJI A;  2PZ1 A;  1LB1 A;  4NSW A;  4EKU A;  5JP4 A;  4K2P A;  5J3T A;  5HE2 A;  4A6F A;  1U5D A;  3T06 A;  2BCJ A;  5LON B;  1EVH A;  3N7C A;  5J3Y A;  1WJM A;  2DHK A;  1DDW A;  1BTN A;  3HQC A;  5L81 A;  1V61 A;  3SUZ A;  1WGU A;  1MK7 B;  3FM8 C;  2MDX A;  3MDB C;  1UEF A;  2L2I A;  1ZSQ A;  4DX9 0;  2P0H A;  2Y7B A;  1MIZ B;  4WVF B;  2K2U A;  4HAX B;  1OY2 A;  1NI2 A;  2H7E A;  2ROZ B;  2GJY A;  3QIJ A;  2IFS A;  1U29 A;  4DX8 A;  2RUK B;  3SNH A;  5DIF B;  3GYP A;  2K2J A;  4P7I A;  2MKR A;  2UVM A;  4IOY X;  5C5B A;  2DFK A;  5KQ1 A;  4HHV A;  1WG7 A;  1FHW A;  4A5K A;  2D4Q A;  2IYB A;  2I5C A;  1E5W A;  2J0M A;  5HE3 A;  4KAX B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...