4WJ7A

Ccm2 ptb domain in complex with krit1 npxy/f3
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
167
structure length
137
Chain Sequence
PDRLLSDYIEKEVKYLGQLTSIPGYLNPSSRTEILHFIDNAKRAHQLPGHLTQEHDAVLSLSAYNVKLAWRDGEDIILRVPIHDIAAVSYVRDDAAHLVVLKTAQDEACCLVILAAESKVAAEELCCLLGQVFQVVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Malcavernin
publication title Structural Basis for the Disruption of the Cerebral Cavernous Malformations 2 (CCM2) Interaction with Krev Interaction Trapped 1 (KRIT1) by Disease-associated Mutations.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 35
structure length 137
sequence length 167
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-09-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4wj7A00
2CAYA 3UZTA 2RLOA 2LOXA 1XODA 5HE1A 2DYQA 2ROVA 1DYNA 4GZUA 2E2XA 2Z0QA 3M1IB 2D9YA 4F7UP 3TO1A 1WG7A 4F7HA 2G35A 1Y19B 2YSZA 2D10A 2YS3A 1NTYA 3F0WA 5D3YA 4ZRJA 2ROZB 3VOQA 1UNRA 4XWXA 3U7DA 5LOPB 3F5RA 3FEHA 1X86A 3VIAA 2DKPA 5C6RA 3KZ1A 1J0WA 2M14A 5C16A 2N0YA 4K2OA 1X05A 2D2QA 2OTXA 2J0MA 1Z87A 2DN6A 3X23A 4KHOA 3NSUA 4DXAB 3PVUA 2EJ8A 4PNKA 2VRWB 1LW3A 4K81A 3SO6A 5HE2A 1K5DB 2LKOA 2YF0A 5D27A 3QIJA 3QWMA 2OQBA 3SYXA 1MIZB 1DBHA 1MIXA 1H10A 1KI1B 3A98B 3V5WA 2Z0OA 4GXBA 3DXEA 3MPXA 2DLWA 2DFKA 2D11A 3WYFB 3SUZA 3QBVB 1X1FA 2D4QA 1UPQA 4KAXB 5CLQB 3D8FA 2J59M 1AWEA 3BJIA 2ADZA 4K17A 1K5GB 1MK9B 2Q13A 2ELAA 3BINA 1XD4A 4HAZB 4KHAA 2CY5A 5HE0A 3ODWA 1W1DA 4DBBA 2YVCA 4IOYX 4HAVB 2H7EA 2MFQA 1WGUA 4A5KA 1N3HA 2DA0A 1LB1A 1TQZA 4Y94A 1DDMA 1NI2A 3CIKA 2LULA 1Y5OA 3T06A 1KZGA 3FSSA 2I5FA 3G9WA 2H7DA 2KGXB 2FJLA 1WJMA 2JP2A 1XCGA 1PMSA 3ODOA 5JHHA 1ISNA 2K2UA 5L81A 1FHOA 4H8SA 1WGQA 1FHWA 4L6EA 1E5WA 2DKQA 5HE3A 2K00A 2GCLA 4A6FA 1XX0A 1V5UA 2EMTA 4F7GA 1V89A 2LYDA 2ZPYA 5EFXA 1I2HA 2NMBA 2P0DA 4HAXB 3KRXA 3ODXA 3A8QA 3WA0A 2Y8GA 2MDXA 1ZM0A 1U5DA 1B55A 1V61A 4NSWA 5D3VA 4HB4B 3AU5A 1U27A 3PVLA 1TXDA 4HAWB 4CYEA 3DXCA 1H4RA 2YT0A 2RUKB 3KY9A 1DDVA 2D9XA 4HDQA 5DHFB 3CXBB 4C0AA 5DH9B 2W2XC 1U5GA 1XR0B 1BTNA 1ZVRA 5JHGA 2PZ1A 5C5BB 4WSFA 4MY6A 4P7IA 2IFSA 2CODA 5KCVA 4HB0B 2CY4A 1QQGA 1Q67A 3AU4A 1EAZA 1BAKA 3D8DA 3GYPA 2COFA 2X18A 3P6AA 3ULBA 1J19A 3KSYA 4DX8A 1NU2A 1UEFA 1EGXA 1U5FA 2AEHA 2IYBA 1AQCA 2KCJA 1WI1A 2L2IA 5DIFB 2W2WA 2UZSA 5J3TA 3N7CA 5CLLB 4TYZA 1MAIA 1PFJA 1M7RA 1W1GA 2KUPA 2UZRA 1SGHA 2EMSA 2EC1A 1UPRA 5JLJB 2QKMA 4HHVA 4K2PA 4YL8A 3HQCA 4GPTB 2MWNB 2DHJA 5KQ1A 1GC7A 1WVHA 1FGZA 1MPHA 1I7AA 4TKNA 2LOZA 3IVFA 2LG1A 1XKEA 3PSCA 4EMOA 3U8ZA 1EF1A 2P0FA 1P3RA 1SHCA 2YS1A 2AL6A 2Y7BA 1BTKA 3PG7A 4A6HA 2COAA 1PLSA 4NY0A 2W2XD 3SV1A 2CRFA 2M38A 3RCPA 1IRSA 1X11A 5FI0A 1UNQA 5LONB 1BWNA 2P8VA 3KRWA 4A6KA 5C5BA 1MKEA 1U29A 3LJUX 3PZDA 4WJ7A 2QKLA 2DTCA 2MKRA 4YONA 1WJ1A 2HTHB 5FI1A 3AJ4A 4PQ0A 5C79A 4MT7A 1U2BA 2I5CA 2J0KA 2DX5A 2Z0PA 1P5TA 1QC6A 4BBKA 4GMVA 2DYNA 1GG3A 3P7ZA 3PP2A 2D9WA 3SNHA 2NZ8B 4EJNA 3TCAA 4GN1A 4EKUA 2COCA 1GC6A 2GCJA 4Z2MB 4A6FB 1P6SA 2BCJA 5JP4A 2VSZA 2DHKA 1EVHA 2J0JA 4Z2NA 1TJ6A 2D9ZA 3O96A 2RGNB 4WVFB 3GYOA 3TVVA 2K2JA 1KZ7A 1OQNA 2RSGA 4KHBB 1ZSQA 2DX1A 2UVMA 2VKIA 3A8PA 2GJYA 2ELBA 3MDBC 5D3XA 1OMWA 4ZRIA 4HAYB 2D9VA 1RJ2A 4HDOA 2N23A 2DHIA 2I1JA 2YT1A 1FHXA 1DROA 4B6HA 2HE7A 1W1HA 2RVBB 5DHAB 1DDWA 4IFSA 2RNRB 2YRYA 4HB2B 3PVWA 3TW1A 4CHJA 4DX90 4HB3B 3D8EA 1FGYA 1FB8A 4KVGB 1FAOA 1ZC4B 1FOEA 1V5MA 3TFMA 2Y8FA 2GS0A 2R0DA 1V5PA 4D0NB 1NTVA 4ZRKA 1V88A 5D3WA 3OANA 5GOWB 4IAPA 3DXDA 3HW2B 1UNPA 2P0HA 5J3QA 2R09A 3ULCA 1RRPB 4HAUB 4HATB 3PEGA 3HK0A 5J3YA 2YS5A 4GMXB 2L1CA 5KQ4A 1X1GA 3ZDTA 1M7EA 2V76A 3FM8C 1OY2A 3ZVRA 1U5EA 4CHMA 2I1KA 5DI9B 2XQNM 1MK7B 3ML4A 1ZC3B 4MK0A
chains in the Genus database with same CATH superfamily
4L1RA 2CAYA 2ZKMX 3UZTA 2RLOA 2LOXA 4D6WA 1XODA 5HE1A 2DYQA 3A58A 2ROVA 1DYNA 4GZUA 2E2XA 2Z0QA 3M1IB 2D9YA 4F7UP 3TO1A 4DIXA 1WG7A 4F7HA 2G35A 1Y19B 2YSZA 2D10A 3FVCA 2YS3A 1NTYA 3F0WA 5D3YA 4ZRJA 3U12A 2FJUB 2ROZB 3VOQA 1UNRA 4XWXA 3U7DA 5LOPB 3F5RA 4KHBA 3FEHA 1X86A 3VIAA 2DKPA 5C6RA 3KZ1A 1J0WA 2M14A 5C16A 2N0YA 4K2OA 1X05A 2D2QA 2OTXA 2J0MA 1Z87A 2DN6A 3X23A 5I2SA 4KHOA 3NSUA 4DXAB 5M4YB 3NWFA 3PVUA 2EJ8A 4PNKA 2VRWB 1LW3A 4K81A 3SO6A 5HE2A 1K5DB 2LKOA 2KIGA 2YF0A 5D27A 3QIJA 4OSNA 3QWMA 2OQBA 3SYXA 1MIZB 1DBHA 2Z14A 1MIXA 1H10A 1KI1B 3A98B 3V5WA 2Z0OA 4GXBA 3DXEA 3MPXA 2DLWA 2DFKA 2D11A 3WYFB 5LG4B 3SUZA 3QBVB 1X1FA 2D4QA 1UPQA 4KAXB 5CLQB 3D8FA 2J59M 1AWEA 3BJIA 2ADZA 4K17A 1K5GB 1MK9B 2Q13A 2ELAA 3BINA 4HSIA 1XD4A 4HAZB 4KHAA 2CY5A 5HE0A 2R2YA 3ODWA 1W1DA 4DBBA 2YVCA 4IOYX 4HAVB 2H7EA 2MFQA 1WGUA 4A5KA 1N3HA 2DA0A 1LB1A 1TQZA 4Y94A 1DDMA 1NI2A 3CIKA 2LULA 1Y5OA 2KR0A 3T06A 1KZGA 3FSSA 4GOUA 2I5FA 3G9WA 2H7DA 2KGXB 2FJLA 1WJMA 2JP2A 1XCGA 1PMSA 3ODOA 5JHHA 1ISNA 2K2UA 5L81A 1FHOA 4OT1A 4H8SA 1WGQA 1FHWA 4L6EA 1E5WA 2DKQA 5HE3A 2K00A 2GCLA 4A6FA 1XX0A 1V5UA 2EMTA 4F7GA 1V89A 2LYDA 2ZPYA 2RRFA 5EFXA 1I2HA 2NMBA 2P0DA 4HAXB 3KRXA 3ODXA 3A8QA 3WA0A 2Y8GA 2MDXA 1ZM0A 1U5DA 1B55A 1V61A 4NSWA 5D3VA 4HB4B 3AU5A 1U27A 5I2MA 3PVLA 1TXDA 4HAWB 4CYEA 2YT2A 3DXCA 1H4RA 2YT0A 2RUKB 3KY9A 1DDVA 2D9XA 4HDQA 5DHFB 3CXBB 4C0AA 5DH9B 2W2XC 1U5GA 1XR0B 2NBVA 1BTNA 1ZVRA 3NW8A 5JHGA 2PZ1A 5C5BB 4WSFA 4MY6A 1T77A 4P7IA 2IFSA 2CODA 5KCVA 4HB0B 2CY4A 1QQGA 1Q67A 3AU4A 1EAZA 1BAKA 3D8DA 3GYPA 2COFA 2GUMA 2X18A 3P6AA 3ULBA 1J19A 3KSYA 4DX8A 1NU2A 3HSAA 1UEFA 1EGXA 1U5FA 2AEHA 2IYBA 2KIEA 1AQCA 2KCJA 1WI1A 2L2IA 5DIFB 2W2WA 2UZSA 5J3TA 3N7CA 5CLLB 4TYZA 1MAIA 1PFJA 1M7RA 1W1GA 2KUPA 2UZRA 1SGHA 2EMSA 2EC1A 1MI1A 1UPRA 5JLJB 2QKMA 4HHVA 4K2PA 4YL8A 3HQCA 4GPTB 2MWNB 2DHJA 5KQ1A 1GC7A 1WVHA 1FGZA 1MPHA 1I7AA 4TKNA 2LOZA 3IVFA 2LG1A 1XKEA 3PSCA 4EMOA 3U8ZA 3NWDA 1EF1A 2P0FA 1P3RA 4GNKB 1SHCA 2YS1A 2AL6A 2Y7BA 1BTKA 3PG7A 4A6HA 2COAA 1PLSA 1ZYIA 4QJ4B 4NY0A 2W2XD 3SV1A 2CRFA 2M38A 3RCPA 1IRSA 1X11A 5FI0A 1UNQA 5LONB 1BWNA 2P8VA 3KRWA 4A6KA 5C5BA 1MKEA 1U29A 2K8EA 4QJ5B 3LJUX 3PZDA 4WJ7A 2QKLA 2DTCA 3NWAA 2MKRA 4YONA 1WJ1A 2HTHB 5FI1A 3AJ4A 4PQ0A 5C79A 4MT7A 1U2BA 2I5CA 2J0KA 2Z13A 2DX5A 2Z0PA 1P5TA 1QC6A 4BBKA 4GMVA 2DYNA 1GG3A 3P7ZA 3PP2A 2D9WA 3SNHA 2NZ8B 4EJNA 3TCAA 4GN1A 4EKUA 2COCA 1GC6A 2GCJA 4Z2MB 4A6FB 1P6SA 2BCJA 5JP4A 2VSZA 2DHKA 1EVHA 2J0JA 4Z2NA 1TJ6A 2D9ZA 3O96A 2RGNB 3B77A 4WVFB 3GYOA 3TVVA 2K2JA 1KZ7A 1OQNA 2RSGA 4QJ3B 4KHBB 1ZSQA 2DX1A 2UVMA 2VKIA 3A8PA 3HIEA 2GJYA 4QXAB 2ELBA 3MDBC 5D3XA 1OMWA 2KUQA 4ZRIA 4HAYB 2D9VA 1RJ2A 4HDOA 2N23A 2DHIA 2I1JA 2YT1A 1FHXA 1DROA 4B6HA 2HE7A 1W1HA 2RVBB 5DHAB 1DDWA 4IFSA 2RNRB 2YRYA 4HB2B 3PVWA 3TW1A 4CHJA 4DX90 5IRSA 4HB3B 3D8EA 1FGYA 1FB8A 4KVGB 1FAOA 1ZC4B 1FOEA 1V5MA 3TFMA 2Y8FA 4CSQA 2GS0A 2R0DA 1V5PA 4D0NB 1NTVA 4ZRKA 1V88A 3OHMB 5D3WA 3OANA 5GOWB 4IAPA 3DXDA 2K49A 1UNPA 3HW2B 2P0HA 5J3QA 2R09A 3ULCA 1RRPB 4HAUB 4HATB 3PEGA 3HK0A 3DCXA 5J3YA 2YS5A 4GMXB 2Z59A 2L1CA 5KQ4A 2Z4DA 1X1GA 3ZDTA 1M7EA 2V76A 3FM8C 1OY2A 3ZVRA 1U5EA 4CHMA 2I1KA 5DI9B 2XQNM 1MK7B 3ML4A 1ZC3B 4MK0A
chains in the Genus database with same CATH topology
2CAYA 3UZTA 2RLOA 2LOXA 1XODA 5HE1A 2DYQA 2ROVA 1DYNA 4GZUA 2E2XA 2Z0QA 3M1IB 2D9YA 4F7UP 3TO1A 1WG7A 4F7HA 2G35A 1Y19B 2YSZA 2D10A 2YS3A 1NTYA 3F0WA 5D3YA 4ZRJA 2ROZB 3VOQA 1UNRA 4XWXA 3U7DA 5LOPB 3F5RA 3FEHA 1X86A 3VIAA 2DKPA 5C6RA 3KZ1A 1J0WA 2M14A 5C16A 2N0YA 4K2OA 1X05A 2D2QA 2OTXA 2J0MA 1Z87A 2DN6A 3X23A 4KHOA 3NSUA 4DXAB 3PVUA 2EJ8A 4PNKA 2VRWB 1LW3A 4K81A 3SO6A 5HE2A 1K5DB 2LKOA 2YF0A 5D27A 3QIJA 3QWMA 2OQBA 3SYXA 1MIZB 1DBHA 1MIXA 1H10A 1KI1B 3A98B 3V5WA 2Z0OA 4GXBA 3DXEA 3MPXA 2DLWA 2DFKA 2D11A 3WYFB 3SUZA 3QBVB 1X1FA 2D4QA 1UPQA 4KAXB 5CLQB 3D8FA 2J59M 1AWEA 3BJIA 2ADZA 4K17A 1K5GB 1MK9B 2Q13A 2ELAA 3BINA 1XD4A 4HAZB 4KHAA 2CY5A 5HE0A 3ODWA 1W1DA 4DBBA 2YVCA 4IOYX 4HAVB 2H7EA 2MFQA 1WGUA 4A5KA 1N3HA 2DA0A 1LB1A 1TQZA 4Y94A 1DDMA 1NI2A 3CIKA 2LULA 1Y5OA 3T06A 1KZGA 3FSSA 2I5FA 3G9WA 2H7DA 2KGXB 2FJLA 1WJMA 2JP2A 1XCGA 1PMSA 3ODOA 5JHHA 1ISNA 2K2UA 5L81A 1FHOA 4H8SA 1WGQA 1FHWA 4L6EA 1E5WA 2DKQA 5HE3A 2K00A 2GCLA 4A6FA 1XX0A 1V5UA 2EMTA 4F7GA 1V89A 2LYDA 2ZPYA 5EFXA 1I2HA 2NMBA 2P0DA 4HAXB 3KRXA 3ODXA 3A8QA 3WA0A 2Y8GA 2MDXA 1ZM0A 1U5DA 1B55A 1V61A 4NSWA 5D3VA 4HB4B 3AU5A 1U27A 3PVLA 1TXDA 4HAWB 4CYEA 3DXCA 1H4RA 2YT0A 2RUKB 3KY9A 1DDVA 2D9XA 4HDQA 5DHFB 3CXBB 4C0AA 5DH9B 2W2XC 1U5GA 1XR0B 1BTNA 1ZVRA 5JHGA 2PZ1A 5C5BB 4WSFA 4MY6A 4P7IA 2IFSA 2CODA 5KCVA 4HB0B 2CY4A 1QQGA 1Q67A 3AU4A 1EAZA 1BAKA 3D8DA 3GYPA 2COFA 2X18A 3P6AA 3ULBA 1J19A 3KSYA 4DX8A 1NU2A 1UEFA 1EGXA 1U5FA 2AEHA 2IYBA 1AQCA 2KCJA 1WI1A 2L2IA 5DIFB 2W2WA 2UZSA 5J3TA 3N7CA 5CLLB 4TYZA 1MAIA 1PFJA 1M7RA 1W1GA 2KUPA 2UZRA 1SGHA 2EMSA 2EC1A 1UPRA 5JLJB 2QKMA 4HHVA 4K2PA 4YL8A 3HQCA 4GPTB 2MWNB 2DHJA 5KQ1A 1GC7A 1WVHA 1FGZA 1MPHA 1I7AA 4TKNA 2LOZA 3IVFA 2LG1A 1XKEA 3PSCA 4EMOA 3U8ZA 1EF1A 2P0FA 1P3RA 1SHCA 2YS1A 2AL6A 2Y7BA 1BTKA 3PG7A 4A6HA 2COAA 1PLSA 4NY0A 2W2XD 3SV1A 2CRFA 2M38A 3RCPA 1IRSA 1X11A 5FI0A 1UNQA 5LONB 1BWNA 2P8VA 3KRWA 4A6KA 5C5BA 1MKEA 1U29A 3LJUX 3PZDA 4WJ7A 2QKLA 2DTCA 2MKRA 4YONA 1WJ1A 2HTHB 5FI1A 3AJ4A 4PQ0A 5C79A 4MT7A 1U2BA 2I5CA 2J0KA 2DX5A 2Z0PA 1P5TA 1QC6A 4BBKA 4GMVA 2DYNA 1GG3A 3P7ZA 3PP2A 2D9WA 3SNHA 2NZ8B 4EJNA 3TCAA 4GN1A 4EKUA 2COCA 1GC6A 2GCJA 4Z2MB 4A6FB 1P6SA 2BCJA 5JP4A 2VSZA 2DHKA 1EVHA 2J0JA 4Z2NA 1TJ6A 2D9ZA 3O96A 2RGNB 4WVFB 3GYOA 3TVVA 2K2JA 1KZ7A 1OQNA 2RSGA 4KHBB 1ZSQA 2DX1A 2UVMA 2VKIA 3A8PA 2GJYA 2ELBA 3MDBC 5D3XA 1OMWA 4ZRIA 4HAYB 2D9VA 1RJ2A 4HDOA 2N23A 2DHIA 2I1JA 2YT1A 1FHXA 1DROA 4B6HA 2HE7A 1W1HA 2RVBB 5DHAB 1DDWA 4IFSA 2RNRB 2YRYA 4HB2B 3PVWA 3TW1A 4CHJA 4DX90 4HB3B 3D8EA 1FGYA 1FB8A 4KVGB 1FAOA 1ZC4B 1FOEA 1V5MA 3TFMA 2Y8FA 2GS0A 2R0DA 1V5PA 4D0NB 1NTVA 4ZRKA 1V88A 5D3WA 3OANA 5GOWB 4IAPA 3DXDA 3HW2B 1UNPA 2P0HA 5J3QA 2R09A 3ULCA 1RRPB 4HAUB 4HATB 3PEGA 3HK0A 5J3YA 2YS5A 4GMXB 2L1CA 5KQ4A 1X1GA 3ZDTA 1M7EA 2V76A 3FM8C 1OY2A 3ZVRA 1U5EA 4CHMA 2I1KA 5DI9B 2XQNM 1MK7B 3ML4A 1ZC3B 4MK0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CAY A;  3UZT A;  2RLO A;  2LOX A;  1XOD A;  5HE1 A;  2DYQ A;  2ROV A;  1DYN A;  4GZU A;  2E2X A;  2Z0Q A;  3M1I B;  2D9Y A;  4F7U P;  3TO1 A;  1WG7 A;  4F7H A;  2G35 A;  1Y19 B;  2YSZ A;  2D10 A;  2YS3 A;  1NTY A;  3F0W A;  5D3Y A;  4ZRJ A;  2ROZ B;  3VOQ A;  1UNR A;  4XWX A;  3U7D A;  5LOP B;  3F5R A;  3FEH A;  1X86 A;  3VIA A;  2DKP A;  5C6R A;  3KZ1 A;  1J0W A;  2M14 A;  5C16 A;  2N0Y A;  4K2O A;  1X05 A;  2D2Q A;  2OTX A;  2J0M A;  1Z87 A;  2DN6 A;  3X23 A;  4KHO A;  3NSU A;  4DXA B;  3PVU A;  2EJ8 A;  4PNK A;  2VRW B;  1LW3 A;  4K81 A;  3SO6 A;  5HE2 A;  1K5D B;  2LKO A;  2YF0 A;  5D27 A;  3QIJ A;  3QWM A;  2OQB A;  3SYX A;  1MIZ B;  1DBH A;  1MIX A;  1H10 A;  1KI1 B;  3A98 B;  3V5W A;  2Z0O A;  4GXB A;  3DXE A;  3MPX A;  2DLW A;  2DFK A;  2D11 A;  3WYF B;  3SUZ A;  3QBV B;  1X1F A;  2D4Q A;  1UPQ A;  4KAX B;  5CLQ B;  3D8F A;  2J59 M;  1AWE A;  3BJI A;  2ADZ A;  4K17 A;  1K5G B;  1MK9 B;  2Q13 A;  2ELA A;  3BIN A;  1XD4 A;  4HAZ B;  4KHA A;  2CY5 A;  5HE0 A;  3ODW A;  1W1D A;  4DBB A;  2YVC A;  4IOY X;  4HAV B;  2H7E A;  2MFQ A;  1WGU A;  4A5K A;  1N3H A;  2DA0 A;  1LB1 A;  1TQZ A;  4Y94 A;  1DDM A;  1NI2 A;  3CIK A;  2LUL A;  1Y5O A;  3T06 A;  1KZG A;  3FSS A;  2I5F A;  3G9W A;  2H7D A;  2KGX B;  2FJL A;  1WJM A;  2JP2 A;  1XCG A;  1PMS A;  3ODO A;  5JHH A;  1ISN A;  2K2U A;  5L81 A;  1FHO A;  4H8S A;  1WGQ A;  1FHW A;  4L6E A;  1E5W A;  2DKQ A;  5HE3 A;  2K00 A;  2GCL A;  4A6F A;  1XX0 A;  1V5U A;  2EMT A;  4F7G A;  1V89 A;  2LYD A;  2ZPY A;  5EFX A;  1I2H A;  2NMB A;  2P0D A;  4HAX B;  3KRX A;  3ODX A;  3A8Q A;  3WA0 A;  2Y8G A;  2MDX A;  1ZM0 A;  1U5D A;  1B55 A;  1V61 A;  4NSW A;  5D3V A;  4HB4 B;  3AU5 A;  1U27 A;  3PVL A;  1TXD A;  4HAW B;  4CYE A;  3DXC A;  1H4R A;  2YT0 A;  2RUK B;  3KY9 A;  1DDV A;  2D9X A;  4HDQ A;  5DHF B;  3CXB B;  4C0A A;  5DH9 B;  2W2X C;  1U5G A;  1XR0 B;  1BTN A;  1ZVR A;  5JHG A;  2PZ1 A;  5C5B B;  4WSF A;  4MY6 A;  4P7I A;  2IFS A;  2COD A;  5KCV A;  4HB0 B;  2CY4 A;  1QQG A;  1Q67 A;  3AU4 A;  1EAZ A;  1BAK A;  3D8D A;  3GYP A;  2COF A;  2X18 A;  3P6A A;  3ULB A;  1J19 A;  3KSY A;  4DX8 A;  1NU2 A;  1UEF A;  1EGX A;  1U5F A;  2AEH A;  2IYB A;  1AQC A;  2KCJ A;  1WI1 A;  2L2I A;  5DIF B;  2W2W A;  2UZS A;  5J3T A;  3N7C A;  5CLL B;  4TYZ A;  1MAI A;  1PFJ A;  1M7R A;  1W1G A;  2KUP A;  2UZR A;  1SGH A;  2EMS A;  2EC1 A;  1UPR A;  5JLJ B;  2QKM A;  4HHV A;  4K2P A;  4YL8 A;  3HQC A;  4GPT B;  2MWN B;  2DHJ A;  5KQ1 A;  1GC7 A;  1WVH A;  1FGZ A;  1MPH A;  1I7A A;  4TKN A;  2LOZ A;  3IVF A;  2LG1 A;  1XKE A;  3PSC A;  4EMO A;  3U8Z A;  1EF1 A;  2P0F A;  1P3R A;  1SHC A;  2YS1 A;  2AL6 A;  2Y7B A;  1BTK A;  3PG7 A;  4A6H A;  2COA A;  1PLS A;  4NY0 A;  2W2X D;  3SV1 A;  2CRF A;  2M38 A;  3RCP A;  1IRS A;  1X11 A;  5FI0 A;  1UNQ A;  5LON B;  1BWN A;  2P8V A;  3KRW A;  4A6K A;  5C5B A;  1MKE A;  1U29 A;  3LJU X;  3PZD A;  4WJ7 A;  2QKL A;  2DTC A;  2MKR A;  4YON A;  1WJ1 A;  2HTH B;  5FI1 A;  3AJ4 A;  4PQ0 A;  5C79 A;  4MT7 A;  1U2B A;  2I5C A;  2J0K A;  2DX5 A;  2Z0P A;  1P5T A;  1QC6 A;  4BBK A;  4GMV A;  2DYN A;  1GG3 A;  3P7Z A;  3PP2 A;  2D9W A;  3SNH A;  2NZ8 B;  4EJN A;  3TCA A;  4GN1 A;  4EKU A;  2COC A;  1GC6 A;  2GCJ A;  4Z2M B;  4A6F B;  1P6S A;  2BCJ A;  5JP4 A;  2VSZ A;  2DHK A;  1EVH A;  2J0J A;  4Z2N A;  1TJ6 A;  2D9Z A;  3O96 A;  2RGN B;  4WVF B;  3GYO A;  3TVV A;  2K2J A;  1KZ7 A;  1OQN A;  2RSG A;  4KHB B;  1ZSQ A;  2DX1 A;  2UVM A;  2VKI A;  3A8P A;  2GJY A;  2ELB A;  3MDB C;  5D3X A;  1OMW A;  4ZRI A;  4HAY B;  2D9V A;  1RJ2 A;  4HDO A;  2N23 A;  2DHI A;  2I1J A;  2YT1 A;  1FHX A;  1DRO A;  4B6H A;  2HE7 A;  1W1H A;  2RVB B;  5DHA B;  1DDW A;  4IFS A;  2RNR B;  2YRY A;  4HB2 B;  3PVW A;  3TW1 A;  4CHJ A;  4DX9 0;  4HB3 B;  3D8E A;  1FGY A;  1FB8 A;  4KVG B;  1FAO A;  1ZC4 B;  1FOE A;  1V5M A;  3TFM A;  2Y8F A;  2GS0 A;  2R0D A;  1V5P A;  4D0N B;  1NTV A;  4ZRK A;  1V88 A;  5D3W A;  3OAN A;  5GOW B;  4IAP A;  3DXD A;  3HW2 B;  1UNP A;  2P0H A;  5J3Q A;  2R09 A;  3ULC A;  1RRP B;  4HAU B;  4HAT B;  3PEG A;  3HK0 A;  5J3Y A;  2YS5 A;  4GMX B;  2L1C A;  5KQ4 A;  1X1G A;  3ZDT A;  1M7E A;  2V76 A;  3FM8 C;  1OY2 A;  3ZVR A;  1U5E A;  4CHM A;  2I1K A;  5DI9 B;  2XQN M;  1MK7 B;  3ML4 A;  1ZC3 B;  4MK0 A; 
#chains in the Genus database with same CATH topology
 4L1R A;  2CAY A;  2ZKM X;  3UZT A;  2RLO A;  2LOX A;  4D6W A;  1XOD A;  5HE1 A;  2DYQ A;  3A58 A;  2ROV A;  1DYN A;  4GZU A;  2E2X A;  2Z0Q A;  3M1I B;  2D9Y A;  4F7U P;  3TO1 A;  4DIX A;  1WG7 A;  4F7H A;  2G35 A;  1Y19 B;  2YSZ A;  2D10 A;  3FVC A;  2YS3 A;  1NTY A;  3F0W A;  5D3Y A;  4ZRJ A;  3U12 A;  2FJU B;  2ROZ B;  3VOQ A;  1UNR A;  4XWX A;  3U7D A;  5LOP B;  3F5R A;  4KHB A;  3FEH A;  1X86 A;  3VIA A;  2DKP A;  5C6R A;  3KZ1 A;  1J0W A;  2M14 A;  5C16 A;  2N0Y A;  4K2O A;  1X05 A;  2D2Q A;  2OTX A;  2J0M A;  1Z87 A;  2DN6 A;  3X23 A;  5I2S A;  4KHO A;  3NSU A;  4DXA B;  5M4Y B;  3NWF A;  3PVU A;  2EJ8 A;  4PNK A;  2VRW B;  1LW3 A;  4K81 A;  3SO6 A;  5HE2 A;  1K5D B;  2LKO A;  2KIG A;  2YF0 A;  5D27 A;  3QIJ A;  4OSN A;  3QWM A;  2OQB A;  3SYX A;  1MIZ B;  1DBH A;  2Z14 A;  1MIX A;  1H10 A;  1KI1 B;  3A98 B;  3V5W A;  2Z0O A;  4GXB A;  3DXE A;  3MPX A;  2DLW A;  2DFK A;  2D11 A;  3WYF B;  5LG4 B;  3SUZ A;  3QBV B;  1X1F A;  2D4Q A;  1UPQ A;  4KAX B;  5CLQ B;  3D8F A;  2J59 M;  1AWE A;  3BJI A;  2ADZ A;  4K17 A;  1K5G B;  1MK9 B;  2Q13 A;  2ELA A;  3BIN A;  4HSI A;  1XD4 A;  4HAZ B;  4KHA A;  2CY5 A;  5HE0 A;  2R2Y A;  3ODW A;  1W1D A;  4DBB A;  2YVC A;  4IOY X;  4HAV B;  2H7E A;  2MFQ A;  1WGU A;  4A5K A;  1N3H A;  2DA0 A;  1LB1 A;  1TQZ A;  4Y94 A;  1DDM A;  1NI2 A;  3CIK A;  2LUL A;  1Y5O A;  2KR0 A;  3T06 A;  1KZG A;  3FSS A;  4GOU A;  2I5F A;  3G9W A;  2H7D A;  2KGX B;  2FJL A;  1WJM A;  2JP2 A;  1XCG A;  1PMS A;  3ODO A;  5JHH A;  1ISN A;  2K2U A;  5L81 A;  1FHO A;  4OT1 A;  4H8S A;  1WGQ A;  1FHW A;  4L6E A;  1E5W A;  2DKQ A;  5HE3 A;  2K00 A;  2GCL A;  4A6F A;  1XX0 A;  1V5U A;  2EMT A;  4F7G A;  1V89 A;  2LYD A;  2ZPY A;  2RRF A;  5EFX A;  1I2H A;  2NMB A;  2P0D A;  4HAX B;  3KRX A;  3ODX A;  3A8Q A;  3WA0 A;  2Y8G A;  2MDX A;  1ZM0 A;  1U5D A;  1B55 A;  1V61 A;  4NSW A;  5D3V A;  4HB4 B;  3AU5 A;  1U27 A;  5I2M A;  3PVL A;  1TXD A;  4HAW B;  4CYE A;  2YT2 A;  3DXC A;  1H4R A;  2YT0 A;  2RUK B;  3KY9 A;  1DDV A;  2D9X A;  4HDQ A;  5DHF B;  3CXB B;  4C0A A;  5DH9 B;  2W2X C;  1U5G A;  1XR0 B;  2NBV A;  1BTN A;  1ZVR A;  3NW8 A;  5JHG A;  2PZ1 A;  5C5B B;  4WSF A;  4MY6 A;  1T77 A;  4P7I A;  2IFS A;  2COD A;  5KCV A;  4HB0 B;  2CY4 A;  1QQG A;  1Q67 A;  3AU4 A;  1EAZ A;  1BAK A;  3D8D A;  3GYP A;  2COF A;  2GUM A;  2X18 A;  3P6A A;  3ULB A;  1J19 A;  3KSY A;  4DX8 A;  1NU2 A;  3HSA A;  1UEF A;  1EGX A;  1U5F A;  2AEH A;  2IYB A;  2KIE A;  1AQC A;  2KCJ A;  1WI1 A;  2L2I A;  5DIF B;  2W2W A;  2UZS A;  5J3T A;  3N7C A;  5CLL B;  4TYZ A;  1MAI A;  1PFJ A;  1M7R A;  1W1G A;  2KUP A;  2UZR A;  1SGH A;  2EMS A;  2EC1 A;  1MI1 A;  1UPR A;  5JLJ B;  2QKM A;  4HHV A;  4K2P A;  4YL8 A;  3HQC A;  4GPT B;  2MWN B;  2DHJ A;  5KQ1 A;  1GC7 A;  1WVH A;  1FGZ A;  1MPH A;  1I7A A;  4TKN A;  2LOZ A;  3IVF A;  2LG1 A;  1XKE A;  3PSC A;  4EMO A;  3U8Z A;  3NWD A;  1EF1 A;  2P0F A;  1P3R A;  4GNK B;  1SHC A;  2YS1 A;  2AL6 A;  2Y7B A;  1BTK A;  3PG7 A;  4A6H A;  2COA A;  1PLS A;  1ZYI A;  4QJ4 B;  4NY0 A;  2W2X D;  3SV1 A;  2CRF A;  2M38 A;  3RCP A;  1IRS A;  1X11 A;  5FI0 A;  1UNQ A;  5LON B;  1BWN A;  2P8V A;  3KRW A;  4A6K A;  5C5B A;  1MKE A;  1U29 A;  2K8E A;  4QJ5 B;  3LJU X;  3PZD A;  4WJ7 A;  2QKL A;  2DTC A;  3NWA A;  2MKR A;  4YON A;  1WJ1 A;  2HTH B;  5FI1 A;  3AJ4 A;  4PQ0 A;  5C79 A;  4MT7 A;  1U2B A;  2I5C A;  2J0K A;  2Z13 A;  2DX5 A;  2Z0P A;  1P5T A;  1QC6 A;  4BBK A;  4GMV A;  2DYN A;  1GG3 A;  3P7Z A;  3PP2 A;  2D9W A;  3SNH A;  2NZ8 B;  4EJN A;  3TCA A;  4GN1 A;  4EKU A;  2COC A;  1GC6 A;  2GCJ A;  4Z2M B;  4A6F B;  1P6S A;  2BCJ A;  5JP4 A;  2VSZ A;  2DHK A;  1EVH A;  2J0J A;  4Z2N A;  1TJ6 A;  2D9Z A;  3O96 A;  2RGN B;  3B77 A;  4WVF B;  3GYO A;  3TVV A;  2K2J A;  1KZ7 A;  1OQN A;  2RSG A;  4QJ3 B;  4KHB B;  1ZSQ A;  2DX1 A;  2UVM A;  2VKI A;  3A8P A;  3HIE A;  2GJY A;  4QXA B;  2ELB A;  3MDB C;  5D3X A;  1OMW A;  2KUQ A;  4ZRI A;  4HAY B;  2D9V A;  1RJ2 A;  4HDO A;  2N23 A;  2DHI A;  2I1J A;  2YT1 A;  1FHX A;  1DRO A;  4B6H A;  2HE7 A;  1W1H A;  2RVB B;  5DHA B;  1DDW A;  4IFS A;  2RNR B;  2YRY A;  4HB2 B;  3PVW A;  3TW1 A;  4CHJ A;  4DX9 0;  5IRS A;  4HB3 B;  3D8E A;  1FGY A;  1FB8 A;  4KVG B;  1FAO A;  1ZC4 B;  1FOE A;  1V5M A;  3TFM A;  2Y8F A;  4CSQ A;  2GS0 A;  2R0D A;  1V5P A;  4D0N B;  1NTV A;  4ZRK A;  1V88 A;  3OHM B;  5D3W A;  3OAN A;  5GOW B;  4IAP A;  3DXD A;  2K49 A;  1UNP A;  3HW2 B;  2P0H A;  5J3Q A;  2R09 A;  3ULC A;  1RRP B;  4HAU B;  4HAT B;  3PEG A;  3HK0 A;  3DCX A;  5J3Y A;  2YS5 A;  4GMX B;  2Z59 A;  2L1C A;  5KQ4 A;  2Z4D A;  1X1G A;  3ZDT A;  1M7E A;  2V76 A;  3FM8 C;  1OY2 A;  3ZVR A;  1U5E A;  4CHM A;  2I1K A;  5DI9 B;  2XQN M;  1MK7 B;  3ML4 A;  1ZC3 B;  4MK0 A; 
#chains in the Genus database with same CATH homology
 2CAY A;  3UZT A;  2RLO A;  2LOX A;  1XOD A;  5HE1 A;  2DYQ A;  2ROV A;  1DYN A;  4GZU A;  2E2X A;  2Z0Q A;  3M1I B;  2D9Y A;  4F7U P;  3TO1 A;  1WG7 A;  4F7H A;  2G35 A;  1Y19 B;  2YSZ A;  2D10 A;  2YS3 A;  1NTY A;  3F0W A;  5D3Y A;  4ZRJ A;  2ROZ B;  3VOQ A;  1UNR A;  4XWX A;  3U7D A;  5LOP B;  3F5R A;  3FEH A;  1X86 A;  3VIA A;  2DKP A;  5C6R A;  3KZ1 A;  1J0W A;  2M14 A;  5C16 A;  2N0Y A;  4K2O A;  1X05 A;  2D2Q A;  2OTX A;  2J0M A;  1Z87 A;  2DN6 A;  3X23 A;  4KHO A;  3NSU A;  4DXA B;  3PVU A;  2EJ8 A;  4PNK A;  2VRW B;  1LW3 A;  4K81 A;  3SO6 A;  5HE2 A;  1K5D B;  2LKO A;  2YF0 A;  5D27 A;  3QIJ A;  3QWM A;  2OQB A;  3SYX A;  1MIZ B;  1DBH A;  1MIX A;  1H10 A;  1KI1 B;  3A98 B;  3V5W A;  2Z0O A;  4GXB A;  3DXE A;  3MPX A;  2DLW A;  2DFK A;  2D11 A;  3WYF B;  3SUZ A;  3QBV B;  1X1F A;  2D4Q A;  1UPQ A;  4KAX B;  5CLQ B;  3D8F A;  2J59 M;  1AWE A;  3BJI A;  2ADZ A;  4K17 A;  1K5G B;  1MK9 B;  2Q13 A;  2ELA A;  3BIN A;  1XD4 A;  4HAZ B;  4KHA A;  2CY5 A;  5HE0 A;  3ODW A;  1W1D A;  4DBB A;  2YVC A;  4IOY X;  4HAV B;  2H7E A;  2MFQ A;  1WGU A;  4A5K A;  1N3H A;  2DA0 A;  1LB1 A;  1TQZ A;  4Y94 A;  1DDM A;  1NI2 A;  3CIK A;  2LUL A;  1Y5O A;  3T06 A;  1KZG A;  3FSS A;  2I5F A;  3G9W A;  2H7D A;  2KGX B;  2FJL A;  1WJM A;  2JP2 A;  1XCG A;  1PMS A;  3ODO A;  5JHH A;  1ISN A;  2K2U A;  5L81 A;  1FHO A;  4H8S A;  1WGQ A;  1FHW A;  4L6E A;  1E5W A;  2DKQ A;  5HE3 A;  2K00 A;  2GCL A;  4A6F A;  1XX0 A;  1V5U A;  2EMT A;  4F7G A;  1V89 A;  2LYD A;  2ZPY A;  5EFX A;  1I2H A;  2NMB A;  2P0D A;  4HAX B;  3KRX A;  3ODX A;  3A8Q A;  3WA0 A;  2Y8G A;  2MDX A;  1ZM0 A;  1U5D A;  1B55 A;  1V61 A;  4NSW A;  5D3V A;  4HB4 B;  3AU5 A;  1U27 A;  3PVL A;  1TXD A;  4HAW B;  4CYE A;  3DXC A;  1H4R A;  2YT0 A;  2RUK B;  3KY9 A;  1DDV A;  2D9X A;  4HDQ A;  5DHF B;  3CXB B;  4C0A A;  5DH9 B;  2W2X C;  1U5G A;  1XR0 B;  1BTN A;  1ZVR A;  5JHG A;  2PZ1 A;  5C5B B;  4WSF A;  4MY6 A;  4P7I A;  2IFS A;  2COD A;  5KCV A;  4HB0 B;  2CY4 A;  1QQG A;  1Q67 A;  3AU4 A;  1EAZ A;  1BAK A;  3D8D A;  3GYP A;  2COF A;  2X18 A;  3P6A A;  3ULB A;  1J19 A;  3KSY A;  4DX8 A;  1NU2 A;  1UEF A;  1EGX A;  1U5F A;  2AEH A;  2IYB A;  1AQC A;  2KCJ A;  1WI1 A;  2L2I A;  5DIF B;  2W2W A;  2UZS A;  5J3T A;  3N7C A;  5CLL B;  4TYZ A;  1MAI A;  1PFJ A;  1M7R A;  1W1G A;  2KUP A;  2UZR A;  1SGH A;  2EMS A;  2EC1 A;  1UPR A;  5JLJ B;  2QKM A;  4HHV A;  4K2P A;  4YL8 A;  3HQC A;  4GPT B;  2MWN B;  2DHJ A;  5KQ1 A;  1GC7 A;  1WVH A;  1FGZ A;  1MPH A;  1I7A A;  4TKN A;  2LOZ A;  3IVF A;  2LG1 A;  1XKE A;  3PSC A;  4EMO A;  3U8Z A;  1EF1 A;  2P0F A;  1P3R A;  1SHC A;  2YS1 A;  2AL6 A;  2Y7B A;  1BTK A;  3PG7 A;  4A6H A;  2COA A;  1PLS A;  4NY0 A;  2W2X D;  3SV1 A;  2CRF A;  2M38 A;  3RCP A;  1IRS A;  1X11 A;  5FI0 A;  1UNQ A;  5LON B;  1BWN A;  2P8V A;  3KRW A;  4A6K A;  5C5B A;  1MKE A;  1U29 A;  3LJU X;  3PZD A;  4WJ7 A;  2QKL A;  2DTC A;  2MKR A;  4YON A;  1WJ1 A;  2HTH B;  5FI1 A;  3AJ4 A;  4PQ0 A;  5C79 A;  4MT7 A;  1U2B A;  2I5C A;  2J0K A;  2DX5 A;  2Z0P A;  1P5T A;  1QC6 A;  4BBK A;  4GMV A;  2DYN A;  1GG3 A;  3P7Z A;  3PP2 A;  2D9W A;  3SNH A;  2NZ8 B;  4EJN A;  3TCA A;  4GN1 A;  4EKU A;  2COC A;  1GC6 A;  2GCJ A;  4Z2M B;  4A6F B;  1P6S A;  2BCJ A;  5JP4 A;  2VSZ A;  2DHK A;  1EVH A;  2J0J A;  4Z2N A;  1TJ6 A;  2D9Z A;  3O96 A;  2RGN B;  4WVF B;  3GYO A;  3TVV A;  2K2J A;  1KZ7 A;  1OQN A;  2RSG A;  4KHB B;  1ZSQ A;  2DX1 A;  2UVM A;  2VKI A;  3A8P A;  2GJY A;  2ELB A;  3MDB C;  5D3X A;  1OMW A;  4ZRI A;  4HAY B;  2D9V A;  1RJ2 A;  4HDO A;  2N23 A;  2DHI A;  2I1J A;  2YT1 A;  1FHX A;  1DRO A;  4B6H A;  2HE7 A;  1W1H A;  2RVB B;  5DHA B;  1DDW A;  4IFS A;  2RNR B;  2YRY A;  4HB2 B;  3PVW A;  3TW1 A;  4CHJ A;  4DX9 0;  4HB3 B;  3D8E A;  1FGY A;  1FB8 A;  4KVG B;  1FAO A;  1ZC4 B;  1FOE A;  1V5M A;  3TFM A;  2Y8F A;  2GS0 A;  2R0D A;  1V5P A;  4D0N B;  1NTV A;  4ZRK A;  1V88 A;  5D3W A;  3OAN A;  5GOW B;  4IAP A;  3DXD A;  3HW2 B;  1UNP A;  2P0H A;  5J3Q A;  2R09 A;  3ULC A;  1RRP B;  4HAU B;  4HAT B;  3PEG A;  3HK0 A;  5J3Y A;  2YS5 A;  4GMX B;  2L1C A;  5KQ4 A;  1X1G A;  3ZDT A;  1M7E A;  2V76 A;  3FM8 C;  1OY2 A;  3ZVR A;  1U5E A;  4CHM A;  2I1K A;  5DI9 B;  2XQN M;  1MK7 B;  3ML4 A;  1ZC3 B;  4MK0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...