4WJ7A

Ccm2 ptb domain in complex with krit1 npxy/f3
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
167
structure length
137
Chain Sequence
PDRLLSDYIEKEVKYLGQLTSIPGYLNPSSRTEILHFIDNAKRAHQLPGHLTQEHDAVLSLSAYNVKLAWRDGEDIILRVPIHDIAAVSYVRDDAAHLVVLKTAQDEACCLVILAAESKVAAEELCCLLGQVFQVVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Malcavernin
publication title Structural Basis for the Disruption of the Cerebral Cavernous Malformations 2 (CCM2) Interaction with Krev Interaction Trapped 1 (KRIT1) by Disease-associated Mutations.
pubmed doi rcsb
source organism Homo sapiens
total genus 35
structure length 137
sequence length 167
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-09-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4wj7A00
3PVUA 2YVCA 3ZVRA 3ULBA 3G9WA 2M38A 2YT1A 1FOEA 2MWNB 5JP4A 4A6HA 3IVFA 5DHFB 3D8EA 3DXEA 1X1GA 1KZ7A 2AL6A 1K5DB 2UZRA 4KHAA 4WSFA 1ISNA 2J0KA 2H7DA 5C79A 1IRSA 1MK9B 1BAKA 2DX5A 5J3TA 1P5TA 2OTXA 1NTYA 2EMSA 5KQ4A 1Q67A 2D10A 2AEHA 4PQ0A 2KGXB 4KHBB 1TQZA 1ZSQA 2QKLA 1FHXA 1UNRA 1FGZA 4GMXB 3AU4A 4F7UP 5HE1A 3TVVA 1MIZB 3X23A 2EMTA 2I5CA 1M7RA 1Y19B 4HHVA 5CLQB 3U7DA 2Z0OA 1EVHA 2HE7A 3TFMA 5HE0A 3ULCA 4YONA 2DHJA 1WJMA 1DBHA 1V5MA 1J19A 2DYQA 4GPTB 2RNRB 2D9XA 5HE3A 2RSGA 3SO6A 1MIXA 3HK0A 1MK7B 1WJ1A 2NMBA 2P8VA 3FSSA 3KRWA 1LB1A 1U5FA 1M7EA 2MKRA 3D8FA 3PVWA 5C16A 1XR0B 1FHWA 4HAYB 3TW1A 1UEFA 2MDXA 1H4RA 4MY6A 2YS3A 4NSWA 5D3XA 2DKQA 2W2XC 3MPXA 3N7CA 4GN1A 4HAWB 4H8SA 1MPHA 2GJYA 2K00A 3TCAA 4C0AA 1Y5OA 3SUZA 2RVBB 2I5FA 2CAYA 5KQ1A 5JHHA 2UZSA 1N3HA 1X05A 1XODA 3CIKA 1OY2A 2YS1A 4GMVA 4B6HA 4DXAB 1V61A 2DYNA 1KI1B 3P7ZA 4F7GA 4DX8A 1RJ2A 1NU2A 3DXCA 1AWEA 4HAVB 2HTHB 3NSUA 5CLLB 2COAA 3ZDTA 2N23A 4K2PA 1TJ6A 4HDOA 3GYOA 5EFXA 4HB2B 4DX90 2D2QA 2L1CA 1XCGA 3ODOA 3RCPA 1BTNA 2Z0QA 4IFSA 1X11A 2DTCA 1FB8A 1B55A 4F7HA 2VRWB 2EJ8A 2GS0A 3KZ1A 3F5RA 1V89A 3D8DA 5LOPB 1DYNA 2LOZA 4HB4B 4HAUB 5JHGA 3PSCA 2YRYA 1LW3A 2Z0PA 2BCJA 2DHIA 2COFA 3A98B 2LYDA 5HE2A 1DDWA 3PP2A 1XKEA 5FI0A 4KAXB 1X86A 3PVLA 2CRFA 2YSZA 2LULA 3V5WA 2ROZB 2XQNM 2CY4A 2DN6A 3ML4A 4ZRJA 5DI9B 4DBBA 1U27A 4K81A 2IFSA 2R0DA 1P6SA 1I2HA 1QC6A 4GXBA 4MT7A 2J0JA 3SYXA 1U5EA 3QIJA 1WG7A 4A6KA 2K2UA 1SGHA 3FM8C 2H7EA 2ADZA 2K2JA 5C6RA 5J3YA 2D9VA 5DHAB 2LG1A 1NI2A 2M14A 1W1HA 2J59M 5FI1A 2UVMA 1MKEA 1XX0A 2D9YA 2L2IA 2KCJA 1ZC3B 3VOQA 4EMOA 3F0WA 4WJ7A 2IYBA 3KSYA 1KZGA 4IAPA 4BBKA 2RUKB 1PFJA 1P3RA 2ELAA 3OANA 4WVFB 1GG3A 1WVHA 3M1IB 3CXBB 1WI1A 4A6FB 1K5GB 2Q13A 2LKOA 2VSZA 5D27A 1UNPA 3QBVB 2ROVA 1EGXA 2CODA 3P6AA 5C5BB 2YF0A 2D4QA 1ZM0A 1FAOA 3FEHA 4Z2MB 1E5WA 3GYPA 4HAZB 4PNKA 3PZDA 3ODWA 4EKUA 2G35A 4ZRIA 1RRPB 4MK0A 2DLWA 1H10A 2COCA 2P0HA 1W1GA 3VIAA 2MFQA 1GC7A 5L81A 2N0YA 2QKMA 3UZTA 1V5PA 1WGUA 1ZC4B 4D0NB 3SNHA 2D11A 3AJ4A 2W2WA 3U8ZA 1MAIA 3WYFB 2Y8FA 2Y8GA 5GOWB 2KUPA 4IOYX 4NY0A 4K2OA 4KHOA 4K17A 2I1KA 2V76A 1GC6A 1DDVA 3HW2B 4A6FA 1OMWA 2J0MA 1DDMA 1BTKA 1PMSA 3MDBC 4Z2NA 4HATB 1PLSA 5D3YA 2YT0A 4CHJA 4EJNA 1J0WA 2DHKA 4TYZA 2CY5A 4TKNA 5C5BA 3LJUX 3BINA 2W2XD 2ZPYA 2E2XA 2JP2A 2RGNB 3DXDA 1U5DA 4Y94A 3AU5A 4HDQA 4P7IA 2VKIA 2DX1A 2D9ZA 1UPQA 1X1FA 1ZVRA 2GCJA 1WGQA 2P0DA 3BJIA 3O96A 4XWXA 4CYEA 2ELBA 3HQCA 5D3WA 1TXDA 5DIFB 2RLOA 4HAXB 1XD4A 1OQNA 1W1DA 3KY9A 1SHCA 4CHMA 4HB0B 2R09A 1UNQA 2NZ8B 1EAZA 2X18A 1FGYA 3KRXA 1UPRA 1AQCA 1U2BA 2YS5A 5KCVA 2LOXA 2Y7BA 2PZ1A 4A5KA 2D9WA 4YL8A 1U5GA 1I7AA 1NTVA 2EC1A 3A8QA 2OQBA 3QWMA 4KVGB 2DFKA 1U29A 4GZUA 4HB3B 3TO1A 2FJLA 4L6EA 5DH9B 2I1JA 2DKPA 5D3VA 2DA0A 3PEGA 3T06A 5J3QA 3ODXA 1QQGA 3PG7A 3SV1A 1Z87A 5JLJB 1FHOA 1BWNA 2P0FA 4ZRKA 2GCLA 5LONB 1EF1A 3A8PA 1V5UA 3WA0A 1V88A 1DROA
chains in the Genus database with same CATH superfamily
3PVUA 2YVCA 4L1RA 3ZVRA 3ULBA 2ZKMX 4GNKB 3G9WA 2M38A 2YT1A 1FOEA 2MWNB 5JP4A 4A6HA 3IVFA 5DHFB 3D8EA 3DXEA 1X1GA 1KZ7A 2AL6A 1K5DB 2RRFA 2UZRA 5LG4B 4KHAA 4WSFA 1ISNA 2J0KA 2H7DA 4GOUA 5C79A 1IRSA 1MK9B 2K8EA 1BAKA 2DX5A 5J3TA 1P5TA 2OTXA 1NTYA 2EMSA 5KQ4A 1Q67A 2D10A 2AEHA 3B77A 4PQ0A 2KGXB 4KHBB 1TQZA 1ZSQA 2QKLA 1FHXA 1UNRA 1FGZA 4GMXB 3AU4A 4F7UP 5HE1A 3TVVA 1MIZB 3X23A 2EMTA 2I5CA 1M7RA 1Y19B 4HHVA 5CLQB 3U7DA 2Z0OA 1EVHA 2HE7A 3TFMA 5HE0A 3ULCA 4YONA 2DHJA 1WJMA 1DBHA 4OT1A 1V5MA 1J19A 2DYQA 4GPTB 2RNRB 2D9XA 2NBVA 5HE3A 2RSGA 3HIEA 3SO6A 1MIXA 3HK0A 1MK7B 1WJ1A 2NMBA 2P8VA 2Z4DA 3FSSA 3KRWA 3NW8A 1LB1A 1U5FA 1M7EA 2MKRA 3D8FA 3PVWA 5C16A 1XR0B 1FHWA 4HAYB 3TW1A 1UEFA 2MDXA 1H4RA 4MY6A 2YS3A 4NSWA 5D3XA 3NWFA 2FJUB 2DKQA 2W2XC 3MPXA 1ZYIA 3N7CA 4GN1A 4HAWB 4H8SA 4KHBA 1MPHA 2GJYA 2K00A 3TCAA 4C0AA 1Y5OA 3SUZA 2RVBB 2I5FA 2CAYA 5KQ1A 5JHHA 2UZSA 1N3HA 1X05A 1XODA 3CIKA 1OY2A 2YS1A 4GMVA 4B6HA 4DXAB 1V61A 2DYNA 1KI1B 2KR0A 3P7ZA 4F7GA 4DX8A 1RJ2A 1NU2A 3DXCA 1AWEA 2KUQA 4HAVB 2HTHB 3NSUA 5CLLB 2COAA 2KIGA 3ZDTA 2N23A 4K2PA 5I2SA 1TJ6A 4HDOA 3GYOA 5EFXA 4HB2B 4DX90 2D2QA 2L1CA 1XCGA 3ODOA 3RCPA 1BTNA 2Z0QA 4IFSA 3FVCA 1X11A 2DTCA 1FB8A 1B55A 4F7HA 2VRWB 2EJ8A 2GS0A 3KZ1A 3F5RA 1V89A 3D8DA 5LOPB 1DYNA 2LOZA 4HB4B 1MI1A 4HAUB 5JHGA 3PSCA 2Z59A 2YRYA 1LW3A 2Z0PA 2BCJA 2DHIA 3A58A 2COFA 3A98B 4D6WA 2LYDA 5HE2A 1DDWA 3PP2A 1XKEA 5FI0A 4KAXB 1X86A 3PVLA 2CRFA 5I2MA 2R2YA 2YSZA 2LULA 3V5WA 2ROZB 2XQNM 2CY4A 2DN6A 3ML4A 4ZRJA 5DI9B 4DBBA 1U27A 4K81A 2IFSA 2R0DA 1P6SA 1I2HA 1QC6A 4GXBA 4MT7A 2J0JA 3HSAA 3SYXA 1U5EA 3QIJA 1WG7A 4A6KA 2K2UA 1SGHA 3FM8C 2H7EA 2ADZA 2K2JA 5C6RA 5J3YA 2KIEA 2D9VA 5DHAB 2LG1A 1NI2A 2M14A 5M4YB 1W1HA 3U12A 2J59M 5FI1A 2UVMA 1MKEA 1XX0A 2D9YA 2L2IA 2KCJA 1ZC3B 3VOQA 4EMOA 3F0WA 4WJ7A 2IYBA 3NWDA 3KSYA 1KZGA 4IAPA 4BBKA 2RUKB 1PFJA 1P3RA 2ELAA 3OANA 4WVFB 1GG3A 1WVHA 3M1IB 3CXBB 1WI1A 3OHMB 4A6FB 2Z13A 1K5GB 2Q13A 2LKOA 2VSZA 5D27A 1UNPA 3QBVB 2ROVA 1EGXA 2CODA 2Z14A 3P6AA 5C5BB 2YF0A 2D4QA 1ZM0A 1FAOA 3FEHA 4Z2MB 1E5WA 3GYPA 4HAZB 4PNKA 3PZDA 3ODWA 4EKUA 4QJ4B 2G35A 4CSQA 4ZRIA 1RRPB 4MK0A 2DLWA 4QJ3B 1H10A 2COCA 2P0HA 1W1GA 3VIAA 2MFQA 1GC7A 5L81A 2N0YA 2QKMA 3UZTA 1V5PA 1WGUA 1ZC4B 4D0NB 3SNHA 2D11A 3AJ4A 2W2WA 3U8ZA 1MAIA 3WYFB 2Y8FA 2Y8GA 5GOWB 4QXAB 4QJ5B 2KUPA 4IOYX 4NY0A 4K2OA 4KHOA 4K17A 2I1KA 5IRSA 2V76A 1GC6A 1DDVA 3HW2B 4A6FA 1OMWA 2J0MA 1DDMA 1BTKA 2K49A 1PMSA 3MDBC 4Z2NA 4HATB 1PLSA 5D3YA 2YT0A 4CHJA 4EJNA 1J0WA 2DHKA 3DCXA 4TYZA 2CY5A 4TKNA 5C5BA 3LJUX 3BINA 2W2XD 2ZPYA 2E2XA 2JP2A 2RGNB 3DXDA 1U5DA 4Y94A 3AU5A 4HDQA 4DIXA 4P7IA 2VKIA 2DX1A 2GUMA 2D9ZA 1UPQA 1X1FA 1ZVRA 2GCJA 1WGQA 2P0DA 3BJIA 3O96A 4XWXA 4CYEA 2ELBA 3HQCA 5D3WA 1TXDA 5DIFB 2RLOA 4HAXB 1XD4A 1OQNA 1W1DA 3KY9A 1SHCA 4CHMA 4HB0B 2R09A 1UNQA 2NZ8B 1EAZA 2X18A 1FGYA 3KRXA 1UPRA 1AQCA 1U2BA 2YS5A 1T77A 5KCVA 2LOXA 2Y7BA 2PZ1A 4A5KA 2D9WA 4YL8A 1U5GA 1I7AA 1NTVA 2EC1A 2YT2A 4OSNA 4HSIA 3A8QA 2OQBA 3QWMA 4KVGB 2DFKA 1U29A 4GZUA 4HB3B 3TO1A 2FJLA 4L6EA 5DH9B 2I1JA 2DKPA 5D3VA 2DA0A 3NWAA 3PEGA 3T06A 5J3QA 3ODXA 1QQGA 3PG7A 3SV1A 1Z87A 5JLJB 1FHOA 1BWNA 2P0FA 4ZRKA 2GCLA 5LONB 1EF1A 3A8PA 1V5UA 3WA0A 1V88A 1DROA
chains in the Genus database with same CATH topology
3PVUA 2YVCA 3ZVRA 3ULBA 3G9WA 2M38A 2YT1A 1FOEA 2MWNB 5JP4A 4A6HA 3IVFA 5DHFB 3D8EA 3DXEA 1X1GA 1KZ7A 2AL6A 1K5DB 2UZRA 4KHAA 4WSFA 1ISNA 2J0KA 2H7DA 5C79A 1IRSA 1MK9B 1BAKA 2DX5A 5J3TA 1P5TA 2OTXA 1NTYA 2EMSA 5KQ4A 1Q67A 2D10A 2AEHA 4PQ0A 2KGXB 4KHBB 1TQZA 1ZSQA 2QKLA 1FHXA 1UNRA 1FGZA 4GMXB 3AU4A 4F7UP 5HE1A 3TVVA 1MIZB 3X23A 2EMTA 2I5CA 1M7RA 1Y19B 4HHVA 5CLQB 3U7DA 2Z0OA 1EVHA 2HE7A 3TFMA 5HE0A 3ULCA 4YONA 2DHJA 1WJMA 1DBHA 1V5MA 1J19A 2DYQA 4GPTB 2RNRB 2D9XA 5HE3A 2RSGA 3SO6A 1MIXA 3HK0A 1MK7B 1WJ1A 2NMBA 2P8VA 3FSSA 3KRWA 1LB1A 1U5FA 1M7EA 2MKRA 3D8FA 3PVWA 5C16A 1XR0B 1FHWA 4HAYB 3TW1A 1UEFA 2MDXA 1H4RA 4MY6A 2YS3A 4NSWA 5D3XA 2DKQA 2W2XC 3MPXA 3N7CA 4GN1A 4HAWB 4H8SA 1MPHA 2GJYA 2K00A 3TCAA 4C0AA 1Y5OA 3SUZA 2RVBB 2I5FA 2CAYA 5KQ1A 5JHHA 2UZSA 1N3HA 1X05A 1XODA 3CIKA 1OY2A 2YS1A 4GMVA 4B6HA 4DXAB 1V61A 2DYNA 1KI1B 3P7ZA 4F7GA 4DX8A 1RJ2A 1NU2A 3DXCA 1AWEA 4HAVB 2HTHB 3NSUA 5CLLB 2COAA 3ZDTA 2N23A 4K2PA 1TJ6A 4HDOA 3GYOA 5EFXA 4HB2B 4DX90 2D2QA 2L1CA 1XCGA 3ODOA 3RCPA 1BTNA 2Z0QA 4IFSA 1X11A 2DTCA 1FB8A 1B55A 4F7HA 2VRWB 2EJ8A 2GS0A 3KZ1A 3F5RA 1V89A 3D8DA 5LOPB 1DYNA 2LOZA 4HB4B 4HAUB 5JHGA 3PSCA 2YRYA 1LW3A 2Z0PA 2BCJA 2DHIA 2COFA 3A98B 2LYDA 5HE2A 1DDWA 3PP2A 1XKEA 5FI0A 4KAXB 1X86A 3PVLA 2CRFA 2YSZA 2LULA 3V5WA 2ROZB 2XQNM 2CY4A 2DN6A 3ML4A 4ZRJA 5DI9B 4DBBA 1U27A 4K81A 2IFSA 2R0DA 1P6SA 1I2HA 1QC6A 4GXBA 4MT7A 2J0JA 3SYXA 1U5EA 3QIJA 1WG7A 4A6KA 2K2UA 1SGHA 3FM8C 2H7EA 2ADZA 2K2JA 5C6RA 5J3YA 2D9VA 5DHAB 2LG1A 1NI2A 2M14A 1W1HA 2J59M 5FI1A 2UVMA 1MKEA 1XX0A 2D9YA 2L2IA 2KCJA 1ZC3B 3VOQA 4EMOA 3F0WA 4WJ7A 2IYBA 3KSYA 1KZGA 4IAPA 4BBKA 2RUKB 1PFJA 1P3RA 2ELAA 3OANA 4WVFB 1GG3A 1WVHA 3M1IB 3CXBB 1WI1A 4A6FB 1K5GB 2Q13A 2LKOA 2VSZA 5D27A 1UNPA 3QBVB 2ROVA 1EGXA 2CODA 3P6AA 5C5BB 2YF0A 2D4QA 1ZM0A 1FAOA 3FEHA 4Z2MB 1E5WA 3GYPA 4HAZB 4PNKA 3PZDA 3ODWA 4EKUA 2G35A 4ZRIA 1RRPB 4MK0A 2DLWA 1H10A 2COCA 2P0HA 1W1GA 3VIAA 2MFQA 1GC7A 5L81A 2N0YA 2QKMA 3UZTA 1V5PA 1WGUA 1ZC4B 4D0NB 3SNHA 2D11A 3AJ4A 2W2WA 3U8ZA 1MAIA 3WYFB 2Y8FA 2Y8GA 5GOWB 2KUPA 4IOYX 4NY0A 4K2OA 4KHOA 4K17A 2I1KA 2V76A 1GC6A 1DDVA 3HW2B 4A6FA 1OMWA 2J0MA 1DDMA 1BTKA 1PMSA 3MDBC 4Z2NA 4HATB 1PLSA 5D3YA 2YT0A 4CHJA 4EJNA 1J0WA 2DHKA 4TYZA 2CY5A 4TKNA 5C5BA 3LJUX 3BINA 2W2XD 2ZPYA 2E2XA 2JP2A 2RGNB 3DXDA 1U5DA 4Y94A 3AU5A 4HDQA 4P7IA 2VKIA 2DX1A 2D9ZA 1UPQA 1X1FA 1ZVRA 2GCJA 1WGQA 2P0DA 3BJIA 3O96A 4XWXA 4CYEA 2ELBA 3HQCA 5D3WA 1TXDA 5DIFB 2RLOA 4HAXB 1XD4A 1OQNA 1W1DA 3KY9A 1SHCA 4CHMA 4HB0B 2R09A 1UNQA 2NZ8B 1EAZA 2X18A 1FGYA 3KRXA 1UPRA 1AQCA 1U2BA 2YS5A 5KCVA 2LOXA 2Y7BA 2PZ1A 4A5KA 2D9WA 4YL8A 1U5GA 1I7AA 1NTVA 2EC1A 3A8QA 2OQBA 3QWMA 4KVGB 2DFKA 1U29A 4GZUA 4HB3B 3TO1A 2FJLA 4L6EA 5DH9B 2I1JA 2DKPA 5D3VA 2DA0A 3PEGA 3T06A 5J3QA 3ODXA 1QQGA 3PG7A 3SV1A 1Z87A 5JLJB 1FHOA 1BWNA 2P0FA 4ZRKA 2GCLA 5LONB 1EF1A 3A8PA 1V5UA 3WA0A 1V88A 1DROA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PVU A;  2YVC A;  3ZVR A;  3ULB A;  3G9W A;  2M38 A;  2YT1 A;  1FOE A;  2MWN B;  5JP4 A;  4A6H A;  3IVF A;  5DHF B;  3D8E A;  3DXE A;  1X1G A;  1KZ7 A;  2AL6 A;  1K5D B;  2UZR A;  4KHA A;  4WSF A;  1ISN A;  2J0K A;  2H7D A;  5C79 A;  1IRS A;  1MK9 B;  1BAK A;  2DX5 A;  5J3T A;  1P5T A;  2OTX A;  1NTY A;  2EMS A;  5KQ4 A;  1Q67 A;  2D10 A;  2AEH A;  4PQ0 A;  2KGX B;  4KHB B;  1TQZ A;  1ZSQ A;  2QKL A;  1FHX A;  1UNR A;  1FGZ A;  4GMX B;  3AU4 A;  4F7U P;  5HE1 A;  3TVV A;  1MIZ B;  3X23 A;  2EMT A;  2I5C A;  1M7R A;  1Y19 B;  4HHV A;  5CLQ B;  3U7D A;  2Z0O A;  1EVH A;  2HE7 A;  3TFM A;  5HE0 A;  3ULC A;  4YON A;  2DHJ A;  1WJM A;  1DBH A;  1V5M A;  1J19 A;  2DYQ A;  4GPT B;  2RNR B;  2D9X A;  5HE3 A;  2RSG A;  3SO6 A;  1MIX A;  3HK0 A;  1MK7 B;  1WJ1 A;  2NMB A;  2P8V A;  3FSS A;  3KRW A;  1LB1 A;  1U5F A;  1M7E A;  2MKR A;  3D8F A;  3PVW A;  5C16 A;  1XR0 B;  1FHW A;  4HAY B;  3TW1 A;  1UEF A;  2MDX A;  1H4R A;  4MY6 A;  2YS3 A;  4NSW A;  5D3X A;  2DKQ A;  2W2X C;  3MPX A;  3N7C A;  4GN1 A;  4HAW B;  4H8S A;  1MPH A;  2GJY A;  2K00 A;  3TCA A;  4C0A A;  1Y5O A;  3SUZ A;  2RVB B;  2I5F A;  2CAY A;  5KQ1 A;  5JHH A;  2UZS A;  1N3H A;  1X05 A;  1XOD A;  3CIK A;  1OY2 A;  2YS1 A;  4GMV A;  4B6H A;  4DXA B;  1V61 A;  2DYN A;  1KI1 B;  3P7Z A;  4F7G A;  4DX8 A;  1RJ2 A;  1NU2 A;  3DXC A;  1AWE A;  4HAV B;  2HTH B;  3NSU A;  5CLL B;  2COA A;  3ZDT A;  2N23 A;  4K2P A;  1TJ6 A;  4HDO A;  3GYO A;  5EFX A;  4HB2 B;  4DX9 0;  2D2Q A;  2L1C A;  1XCG A;  3ODO A;  3RCP A;  1BTN A;  2Z0Q A;  4IFS A;  1X11 A;  2DTC A;  1FB8 A;  1B55 A;  4F7H A;  2VRW B;  2EJ8 A;  2GS0 A;  3KZ1 A;  3F5R A;  1V89 A;  3D8D A;  5LOP B;  1DYN A;  2LOZ A;  4HB4 B;  4HAU B;  5JHG A;  3PSC A;  2YRY A;  1LW3 A;  2Z0P A;  2BCJ A;  2DHI A;  2COF A;  3A98 B;  2LYD A;  5HE2 A;  1DDW A;  3PP2 A;  1XKE A;  5FI0 A;  4KAX B;  1X86 A;  3PVL A;  2CRF A;  2YSZ A;  2LUL A;  3V5W A;  2ROZ B;  2XQN M;  2CY4 A;  2DN6 A;  3ML4 A;  4ZRJ A;  5DI9 B;  4DBB A;  1U27 A;  4K81 A;  2IFS A;  2R0D A;  1P6S A;  1I2H A;  1QC6 A;  4GXB A;  4MT7 A;  2J0J A;  3SYX A;  1U5E A;  3QIJ A;  1WG7 A;  4A6K A;  2K2U A;  1SGH A;  3FM8 C;  2H7E A;  2ADZ A;  2K2J A;  5C6R A;  5J3Y A;  2D9V A;  5DHA B;  2LG1 A;  1NI2 A;  2M14 A;  1W1H A;  2J59 M;  5FI1 A;  2UVM A;  1MKE A;  1XX0 A;  2D9Y A;  2L2I A;  2KCJ A;  1ZC3 B;  3VOQ A;  4EMO A;  3F0W A;  4WJ7 A;  2IYB A;  3KSY A;  1KZG A;  4IAP A;  4BBK A;  2RUK B;  1PFJ A;  1P3R A;  2ELA A;  3OAN A;  4WVF B;  1GG3 A;  1WVH A;  3M1I B;  3CXB B;  1WI1 A;  4A6F B;  1K5G B;  2Q13 A;  2LKO A;  2VSZ A;  5D27 A;  1UNP A;  3QBV B;  2ROV A;  1EGX A;  2COD A;  3P6A A;  5C5B B;  2YF0 A;  2D4Q A;  1ZM0 A;  1FAO A;  3FEH A;  4Z2M B;  1E5W A;  3GYP A;  4HAZ B;  4PNK A;  3PZD A;  3ODW A;  4EKU A;  2G35 A;  4ZRI A;  1RRP B;  4MK0 A;  2DLW A;  1H10 A;  2COC A;  2P0H A;  1W1G A;  3VIA A;  2MFQ A;  1GC7 A;  5L81 A;  2N0Y A;  2QKM A;  3UZT A;  1V5P A;  1WGU A;  1ZC4 B;  4D0N B;  3SNH A;  2D11 A;  3AJ4 A;  2W2W A;  3U8Z A;  1MAI A;  3WYF B;  2Y8F A;  2Y8G A;  5GOW B;  2KUP A;  4IOY X;  4NY0 A;  4K2O A;  4KHO A;  4K17 A;  2I1K A;  2V76 A;  1GC6 A;  1DDV A;  3HW2 B;  4A6F A;  1OMW A;  2J0M A;  1DDM A;  1BTK A;  1PMS A;  3MDB C;  4Z2N A;  4HAT B;  1PLS A;  5D3Y A;  2YT0 A;  4CHJ A;  4EJN A;  1J0W A;  2DHK A;  4TYZ A;  2CY5 A;  4TKN A;  5C5B A;  3LJU X;  3BIN A;  2W2X D;  2ZPY A;  2E2X A;  2JP2 A;  2RGN B;  3DXD A;  1U5D A;  4Y94 A;  3AU5 A;  4HDQ A;  4P7I A;  2VKI A;  2DX1 A;  2D9Z A;  1UPQ A;  1X1F A;  1ZVR A;  2GCJ A;  1WGQ A;  2P0D A;  3BJI A;  3O96 A;  4XWX A;  4CYE A;  2ELB A;  3HQC A;  5D3W A;  1TXD A;  5DIF B;  2RLO A;  4HAX B;  1XD4 A;  1OQN A;  1W1D A;  3KY9 A;  1SHC A;  4CHM A;  4HB0 B;  2R09 A;  1UNQ A;  2NZ8 B;  1EAZ A;  2X18 A;  1FGY A;  3KRX A;  1UPR A;  1AQC A;  1U2B A;  2YS5 A;  5KCV A;  2LOX A;  2Y7B A;  2PZ1 A;  4A5K A;  2D9W A;  4YL8 A;  1U5G A;  1I7A A;  1NTV A;  2EC1 A;  3A8Q A;  2OQB A;  3QWM A;  4KVG B;  2DFK A;  1U29 A;  4GZU A;  4HB3 B;  3TO1 A;  2FJL A;  4L6E A;  5DH9 B;  2I1J A;  2DKP A;  5D3V A;  2DA0 A;  3PEG A;  3T06 A;  5J3Q A;  3ODX A;  1QQG A;  3PG7 A;  3SV1 A;  1Z87 A;  5JLJ B;  1FHO A;  1BWN A;  2P0F A;  4ZRK A;  2GCL A;  5LON B;  1EF1 A;  3A8P A;  1V5U A;  3WA0 A;  1V88 A;  1DRO A; 
#chains in the Genus database with same CATH topology
 3PVU A;  2YVC A;  4L1R A;  3ZVR A;  3ULB A;  2ZKM X;  4GNK B;  3G9W A;  2M38 A;  2YT1 A;  1FOE A;  2MWN B;  5JP4 A;  4A6H A;  3IVF A;  5DHF B;  3D8E A;  3DXE A;  1X1G A;  1KZ7 A;  2AL6 A;  1K5D B;  2RRF A;  2UZR A;  5LG4 B;  4KHA A;  4WSF A;  1ISN A;  2J0K A;  2H7D A;  4GOU A;  5C79 A;  1IRS A;  1MK9 B;  2K8E A;  1BAK A;  2DX5 A;  5J3T A;  1P5T A;  2OTX A;  1NTY A;  2EMS A;  5KQ4 A;  1Q67 A;  2D10 A;  2AEH A;  3B77 A;  4PQ0 A;  2KGX B;  4KHB B;  1TQZ A;  1ZSQ A;  2QKL A;  1FHX A;  1UNR A;  1FGZ A;  4GMX B;  3AU4 A;  4F7U P;  5HE1 A;  3TVV A;  1MIZ B;  3X23 A;  2EMT A;  2I5C A;  1M7R A;  1Y19 B;  4HHV A;  5CLQ B;  3U7D A;  2Z0O A;  1EVH A;  2HE7 A;  3TFM A;  5HE0 A;  3ULC A;  4YON A;  2DHJ A;  1WJM A;  1DBH A;  4OT1 A;  1V5M A;  1J19 A;  2DYQ A;  4GPT B;  2RNR B;  2D9X A;  2NBV A;  5HE3 A;  2RSG A;  3HIE A;  3SO6 A;  1MIX A;  3HK0 A;  1MK7 B;  1WJ1 A;  2NMB A;  2P8V A;  2Z4D A;  3FSS A;  3KRW A;  3NW8 A;  1LB1 A;  1U5F A;  1M7E A;  2MKR A;  3D8F A;  3PVW A;  5C16 A;  1XR0 B;  1FHW A;  4HAY B;  3TW1 A;  1UEF A;  2MDX A;  1H4R A;  4MY6 A;  2YS3 A;  4NSW A;  5D3X A;  3NWF A;  2FJU B;  2DKQ A;  2W2X C;  3MPX A;  1ZYI A;  3N7C A;  4GN1 A;  4HAW B;  4H8S A;  4KHB A;  1MPH A;  2GJY A;  2K00 A;  3TCA A;  4C0A A;  1Y5O A;  3SUZ A;  2RVB B;  2I5F A;  2CAY A;  5KQ1 A;  5JHH A;  2UZS A;  1N3H A;  1X05 A;  1XOD A;  3CIK A;  1OY2 A;  2YS1 A;  4GMV A;  4B6H A;  4DXA B;  1V61 A;  2DYN A;  1KI1 B;  2KR0 A;  3P7Z A;  4F7G A;  4DX8 A;  1RJ2 A;  1NU2 A;  3DXC A;  1AWE A;  2KUQ A;  4HAV B;  2HTH B;  3NSU A;  5CLL B;  2COA A;  2KIG A;  3ZDT A;  2N23 A;  4K2P A;  5I2S A;  1TJ6 A;  4HDO A;  3GYO A;  5EFX A;  4HB2 B;  4DX9 0;  2D2Q A;  2L1C A;  1XCG A;  3ODO A;  3RCP A;  1BTN A;  2Z0Q A;  4IFS A;  3FVC A;  1X11 A;  2DTC A;  1FB8 A;  1B55 A;  4F7H A;  2VRW B;  2EJ8 A;  2GS0 A;  3KZ1 A;  3F5R A;  1V89 A;  3D8D A;  5LOP B;  1DYN A;  2LOZ A;  4HB4 B;  1MI1 A;  4HAU B;  5JHG A;  3PSC A;  2Z59 A;  2YRY A;  1LW3 A;  2Z0P A;  2BCJ A;  2DHI A;  3A58 A;  2COF A;  3A98 B;  4D6W A;  2LYD A;  5HE2 A;  1DDW A;  3PP2 A;  1XKE A;  5FI0 A;  4KAX B;  1X86 A;  3PVL A;  2CRF A;  5I2M A;  2R2Y A;  2YSZ A;  2LUL A;  3V5W A;  2ROZ B;  2XQN M;  2CY4 A;  2DN6 A;  3ML4 A;  4ZRJ A;  5DI9 B;  4DBB A;  1U27 A;  4K81 A;  2IFS A;  2R0D A;  1P6S A;  1I2H A;  1QC6 A;  4GXB A;  4MT7 A;  2J0J A;  3HSA A;  3SYX A;  1U5E A;  3QIJ A;  1WG7 A;  4A6K A;  2K2U A;  1SGH A;  3FM8 C;  2H7E A;  2ADZ A;  2K2J A;  5C6R A;  5J3Y A;  2KIE A;  2D9V A;  5DHA B;  2LG1 A;  1NI2 A;  2M14 A;  5M4Y B;  1W1H A;  3U12 A;  2J59 M;  5FI1 A;  2UVM A;  1MKE A;  1XX0 A;  2D9Y A;  2L2I A;  2KCJ A;  1ZC3 B;  3VOQ A;  4EMO A;  3F0W A;  4WJ7 A;  2IYB A;  3NWD A;  3KSY A;  1KZG A;  4IAP A;  4BBK A;  2RUK B;  1PFJ A;  1P3R A;  2ELA A;  3OAN A;  4WVF B;  1GG3 A;  1WVH A;  3M1I B;  3CXB B;  1WI1 A;  3OHM B;  4A6F B;  2Z13 A;  1K5G B;  2Q13 A;  2LKO A;  2VSZ A;  5D27 A;  1UNP A;  3QBV B;  2ROV A;  1EGX A;  2COD A;  2Z14 A;  3P6A A;  5C5B B;  2YF0 A;  2D4Q A;  1ZM0 A;  1FAO A;  3FEH A;  4Z2M B;  1E5W A;  3GYP A;  4HAZ B;  4PNK A;  3PZD A;  3ODW A;  4EKU A;  4QJ4 B;  2G35 A;  4CSQ A;  4ZRI A;  1RRP B;  4MK0 A;  2DLW A;  4QJ3 B;  1H10 A;  2COC A;  2P0H A;  1W1G A;  3VIA A;  2MFQ A;  1GC7 A;  5L81 A;  2N0Y A;  2QKM A;  3UZT A;  1V5P A;  1WGU A;  1ZC4 B;  4D0N B;  3SNH A;  2D11 A;  3AJ4 A;  2W2W A;  3U8Z A;  1MAI A;  3WYF B;  2Y8F A;  2Y8G A;  5GOW B;  4QXA B;  4QJ5 B;  2KUP A;  4IOY X;  4NY0 A;  4K2O A;  4KHO A;  4K17 A;  2I1K A;  5IRS A;  2V76 A;  1GC6 A;  1DDV A;  3HW2 B;  4A6F A;  1OMW A;  2J0M A;  1DDM A;  1BTK A;  2K49 A;  1PMS A;  3MDB C;  4Z2N A;  4HAT B;  1PLS A;  5D3Y A;  2YT0 A;  4CHJ A;  4EJN A;  1J0W A;  2DHK A;  3DCX A;  4TYZ A;  2CY5 A;  4TKN A;  5C5B A;  3LJU X;  3BIN A;  2W2X D;  2ZPY A;  2E2X A;  2JP2 A;  2RGN B;  3DXD A;  1U5D A;  4Y94 A;  3AU5 A;  4HDQ A;  4DIX A;  4P7I A;  2VKI A;  2DX1 A;  2GUM A;  2D9Z A;  1UPQ A;  1X1F A;  1ZVR A;  2GCJ A;  1WGQ A;  2P0D A;  3BJI A;  3O96 A;  4XWX A;  4CYE A;  2ELB A;  3HQC A;  5D3W A;  1TXD A;  5DIF B;  2RLO A;  4HAX B;  1XD4 A;  1OQN A;  1W1D A;  3KY9 A;  1SHC A;  4CHM A;  4HB0 B;  2R09 A;  1UNQ A;  2NZ8 B;  1EAZ A;  2X18 A;  1FGY A;  3KRX A;  1UPR A;  1AQC A;  1U2B A;  2YS5 A;  1T77 A;  5KCV A;  2LOX A;  2Y7B A;  2PZ1 A;  4A5K A;  2D9W A;  4YL8 A;  1U5G A;  1I7A A;  1NTV A;  2EC1 A;  2YT2 A;  4OSN A;  4HSI A;  3A8Q A;  2OQB A;  3QWM A;  4KVG B;  2DFK A;  1U29 A;  4GZU A;  4HB3 B;  3TO1 A;  2FJL A;  4L6E A;  5DH9 B;  2I1J A;  2DKP A;  5D3V A;  2DA0 A;  3NWA A;  3PEG A;  3T06 A;  5J3Q A;  3ODX A;  1QQG A;  3PG7 A;  3SV1 A;  1Z87 A;  5JLJ B;  1FHO A;  1BWN A;  2P0F A;  4ZRK A;  2GCL A;  5LON B;  1EF1 A;  3A8P A;  1V5U A;  3WA0 A;  1V88 A;  1DRO A; 
#chains in the Genus database with same CATH homology
 3PVU A;  2YVC A;  3ZVR A;  3ULB A;  3G9W A;  2M38 A;  2YT1 A;  1FOE A;  2MWN B;  5JP4 A;  4A6H A;  3IVF A;  5DHF B;  3D8E A;  3DXE A;  1X1G A;  1KZ7 A;  2AL6 A;  1K5D B;  2UZR A;  4KHA A;  4WSF A;  1ISN A;  2J0K A;  2H7D A;  5C79 A;  1IRS A;  1MK9 B;  1BAK A;  2DX5 A;  5J3T A;  1P5T A;  2OTX A;  1NTY A;  2EMS A;  5KQ4 A;  1Q67 A;  2D10 A;  2AEH A;  4PQ0 A;  2KGX B;  4KHB B;  1TQZ A;  1ZSQ A;  2QKL A;  1FHX A;  1UNR A;  1FGZ A;  4GMX B;  3AU4 A;  4F7U P;  5HE1 A;  3TVV A;  1MIZ B;  3X23 A;  2EMT A;  2I5C A;  1M7R A;  1Y19 B;  4HHV A;  5CLQ B;  3U7D A;  2Z0O A;  1EVH A;  2HE7 A;  3TFM A;  5HE0 A;  3ULC A;  4YON A;  2DHJ A;  1WJM A;  1DBH A;  1V5M A;  1J19 A;  2DYQ A;  4GPT B;  2RNR B;  2D9X A;  5HE3 A;  2RSG A;  3SO6 A;  1MIX A;  3HK0 A;  1MK7 B;  1WJ1 A;  2NMB A;  2P8V A;  3FSS A;  3KRW A;  1LB1 A;  1U5F A;  1M7E A;  2MKR A;  3D8F A;  3PVW A;  5C16 A;  1XR0 B;  1FHW A;  4HAY B;  3TW1 A;  1UEF A;  2MDX A;  1H4R A;  4MY6 A;  2YS3 A;  4NSW A;  5D3X A;  2DKQ A;  2W2X C;  3MPX A;  3N7C A;  4GN1 A;  4HAW B;  4H8S A;  1MPH A;  2GJY A;  2K00 A;  3TCA A;  4C0A A;  1Y5O A;  3SUZ A;  2RVB B;  2I5F A;  2CAY A;  5KQ1 A;  5JHH A;  2UZS A;  1N3H A;  1X05 A;  1XOD A;  3CIK A;  1OY2 A;  2YS1 A;  4GMV A;  4B6H A;  4DXA B;  1V61 A;  2DYN A;  1KI1 B;  3P7Z A;  4F7G A;  4DX8 A;  1RJ2 A;  1NU2 A;  3DXC A;  1AWE A;  4HAV B;  2HTH B;  3NSU A;  5CLL B;  2COA A;  3ZDT A;  2N23 A;  4K2P A;  1TJ6 A;  4HDO A;  3GYO A;  5EFX A;  4HB2 B;  4DX9 0;  2D2Q A;  2L1C A;  1XCG A;  3ODO A;  3RCP A;  1BTN A;  2Z0Q A;  4IFS A;  1X11 A;  2DTC A;  1FB8 A;  1B55 A;  4F7H A;  2VRW B;  2EJ8 A;  2GS0 A;  3KZ1 A;  3F5R A;  1V89 A;  3D8D A;  5LOP B;  1DYN A;  2LOZ A;  4HB4 B;  4HAU B;  5JHG A;  3PSC A;  2YRY A;  1LW3 A;  2Z0P A;  2BCJ A;  2DHI A;  2COF A;  3A98 B;  2LYD A;  5HE2 A;  1DDW A;  3PP2 A;  1XKE A;  5FI0 A;  4KAX B;  1X86 A;  3PVL A;  2CRF A;  2YSZ A;  2LUL A;  3V5W A;  2ROZ B;  2XQN M;  2CY4 A;  2DN6 A;  3ML4 A;  4ZRJ A;  5DI9 B;  4DBB A;  1U27 A;  4K81 A;  2IFS A;  2R0D A;  1P6S A;  1I2H A;  1QC6 A;  4GXB A;  4MT7 A;  2J0J A;  3SYX A;  1U5E A;  3QIJ A;  1WG7 A;  4A6K A;  2K2U A;  1SGH A;  3FM8 C;  2H7E A;  2ADZ A;  2K2J A;  5C6R A;  5J3Y A;  2D9V A;  5DHA B;  2LG1 A;  1NI2 A;  2M14 A;  1W1H A;  2J59 M;  5FI1 A;  2UVM A;  1MKE A;  1XX0 A;  2D9Y A;  2L2I A;  2KCJ A;  1ZC3 B;  3VOQ A;  4EMO A;  3F0W A;  4WJ7 A;  2IYB A;  3KSY A;  1KZG A;  4IAP A;  4BBK A;  2RUK B;  1PFJ A;  1P3R A;  2ELA A;  3OAN A;  4WVF B;  1GG3 A;  1WVH A;  3M1I B;  3CXB B;  1WI1 A;  4A6F B;  1K5G B;  2Q13 A;  2LKO A;  2VSZ A;  5D27 A;  1UNP A;  3QBV B;  2ROV A;  1EGX A;  2COD A;  3P6A A;  5C5B B;  2YF0 A;  2D4Q A;  1ZM0 A;  1FAO A;  3FEH A;  4Z2M B;  1E5W A;  3GYP A;  4HAZ B;  4PNK A;  3PZD A;  3ODW A;  4EKU A;  2G35 A;  4ZRI A;  1RRP B;  4MK0 A;  2DLW A;  1H10 A;  2COC A;  2P0H A;  1W1G A;  3VIA A;  2MFQ A;  1GC7 A;  5L81 A;  2N0Y A;  2QKM A;  3UZT A;  1V5P A;  1WGU A;  1ZC4 B;  4D0N B;  3SNH A;  2D11 A;  3AJ4 A;  2W2W A;  3U8Z A;  1MAI A;  3WYF B;  2Y8F A;  2Y8G A;  5GOW B;  2KUP A;  4IOY X;  4NY0 A;  4K2O A;  4KHO A;  4K17 A;  2I1K A;  2V76 A;  1GC6 A;  1DDV A;  3HW2 B;  4A6F A;  1OMW A;  2J0M A;  1DDM A;  1BTK A;  1PMS A;  3MDB C;  4Z2N A;  4HAT B;  1PLS A;  5D3Y A;  2YT0 A;  4CHJ A;  4EJN A;  1J0W A;  2DHK A;  4TYZ A;  2CY5 A;  4TKN A;  5C5B A;  3LJU X;  3BIN A;  2W2X D;  2ZPY A;  2E2X A;  2JP2 A;  2RGN B;  3DXD A;  1U5D A;  4Y94 A;  3AU5 A;  4HDQ A;  4P7I A;  2VKI A;  2DX1 A;  2D9Z A;  1UPQ A;  1X1F A;  1ZVR A;  2GCJ A;  1WGQ A;  2P0D A;  3BJI A;  3O96 A;  4XWX A;  4CYE A;  2ELB A;  3HQC A;  5D3W A;  1TXD A;  5DIF B;  2RLO A;  4HAX B;  1XD4 A;  1OQN A;  1W1D A;  3KY9 A;  1SHC A;  4CHM A;  4HB0 B;  2R09 A;  1UNQ A;  2NZ8 B;  1EAZ A;  2X18 A;  1FGY A;  3KRX A;  1UPR A;  1AQC A;  1U2B A;  2YS5 A;  5KCV A;  2LOX A;  2Y7B A;  2PZ1 A;  4A5K A;  2D9W A;  4YL8 A;  1U5G A;  1I7A A;  1NTV A;  2EC1 A;  3A8Q A;  2OQB A;  3QWM A;  4KVG B;  2DFK A;  1U29 A;  4GZU A;  4HB3 B;  3TO1 A;  2FJL A;  4L6E A;  5DH9 B;  2I1J A;  2DKP A;  5D3V A;  2DA0 A;  3PEG A;  3T06 A;  5J3Q A;  3ODX A;  1QQG A;  3PG7 A;  3SV1 A;  1Z87 A;  5JLJ B;  1FHO A;  1BWN A;  2P0F A;  4ZRK A;  2GCL A;  5LON B;  1EF1 A;  3A8P A;  1V5U A;  3WA0 A;  1V88 A;  1DRO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...