4WJ7A

Ccm2 ptb domain in complex with krit1 npxy/f3
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
167
structure length
137
Chain Sequence
PDRLLSDYIEKEVKYLGQLTSIPGYLNPSSRTEILHFIDNAKRAHQLPGHLTQEHDAVLSLSAYNVKLAWRDGEDIILRVPIHDIAAVSYVRDDAAHLVVLKTAQDEACCLVILAAESKVAAEELCCLLGQVFQVVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for the Disruption of the Cerebral Cavernous Malformations 2 (CCM2) Interaction with Krev Interaction Trapped 1 (KRIT1) by Disease-associated Mutations.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Malcavernin
total genus 35
structure length 137
sequence length 167
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-09-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4wj7A00
2MFQA 3V5WA 5D27A 1ZSQA 3HW2B 1FHOA 5LONB 1SHCA 1X11A 4HAYB 1MKEA 4HATB 2COCA 1U5GA 1DDMA 3ULBA 3TVVA 3FM8C 2K2JA 2G35A 3PSCA 1RJ2A 3U8ZA 3VOQA 4HAZB 2D9ZA 1FGYA 2HTHB 1SGHA 4PQ0A 2EMSA 2MKRA 1XD4A 1XR0B 4IFSA 1OMWA 1XCGA 2YRYA 5D3WA 5KQ4A 2LKOA 1FAOA 2LG1A 4F7UP 1MIZB 4DX90 2PZ1A 4K2OA 1P5TA 1WGUA 3BJIA 5HE1A 4MK0A 2K2UA 2I1KA 2ELAA 2DHKA 2J0MA 2EMTA 3ULCA 2NZ8B 4HDOA 4EKUA 2P8VA 2Q13A 2UZSA 2ZPYA 3KRXA 2CODA 2W2XD 3O96A 2W2WA 5C5BA 1B55A 1UNPA 4L6EA 1FHWA 5J3QA 2I5FA 3TCAA 4CHMA 2D11A 5DHAB 2J0KA 2EJ8A 2DYQA 2YT0A 3F5RA 4YL8A 1IRSA 1U5FA 2QKLA 2KUPA 3X23A 2ADZA 2Y8FA 2EC1A 2MDXA 1QC6A 4DXAB 2D10A 4GXBA 4KHAA 2RVBB 5C79A 4TKNA 4Z2NA 5FI0A 4IAPA 4ZRKA 1I2HA 2CAYA 1PFJA 1U27A 2DHIA 1AQCA 2D9VA 3D8DA 4A6KA 3SV1A 3NSUA 2LOXA 4GPTB 3OANA 2NMBA 2GJYA 5C16A 2DA0A 1V88A 1P6SA 1GC7A 1N3HA 1BWNA 4MT7A 5FI1A 5C5BB 2BCJA 2KGXB 2YSZA 1NTVA 2OQBA 3IVFA 4H8SA 2E2XA 1V5UA 3AU5A 1FGZA 1X86A 2YF0A 1EAZA 2DX5A 2UVMA 1V5MA 2DYNA 3PVLA 2XQNM 3PP2A 5C6RA 3ODWA 2DKPA 1FOEA 1ZM0A 5CLQB 1FHXA 1XX0A 2ROVA 1H10A 1NTYA 2VKIA 4PNKA 2RLOA 4HDQA 2RSGA 2VSZA 4GMXB 3P7ZA 4KHBB 3D8FA 4D0NB 2I5CA 2RGNB 2GCJA 2YS5A 4HHVA 2LULA 1MAIA 4EJNA 4P7IA 2R09A 5D3XA 1KZGA 2RUKB 1ISNA 2DX1A 4A6FB 3PEGA 4NSWA 1TJ6A 2AL6A 5GOWB 4MY6A 4YONA 3VIAA 2D9YA 1OQNA 4WJ7A 3KZ1A 5J3YA 1BAKA 2R0DA 3KSYA 4Y94A 1V5PA 4HB0B 2M38A 4XWXA 4K2PA 4A6FA 4B6HA 1GC6A 2I1JA 3CIKA 1P3RA 1EGXA 1WG7A 2CRFA 4F7HA 4IOYX 1GG3A 1DYNA 5JP4A 3AU4A 1UEFA 3P6AA 2CY4A 1W1HA 2H7EA 2X18A 2YS3A 2Z0OA 1UPQA 3SYXA 5JHHA 1MPHA 1RRPB 1WVHA 1LW3A 1TQZA 1TXDA 2YVCA 2J0JA 4ZRJA 3MDBC 2RNRB 3T06A 2L2IA 4KHOA 2IYBA 4ZRIA 1X1FA 5CLLB 3A98B 1UNQA 2GS0A 1I7AA 2LYDA 4DBBA 1DDWA 3QWMA 5LOPB 5DIFB 1U29A 2KCJA 5DHFB 3ZVRA 2OTXA 1M7EA 2YS1A 3F0WA 2N23A 3DXCA 1J0WA 2L1CA 5D3VA 1WI1A 5J3TA 2J59M 2AEHA 4HB3B 4HAWB 1ZC3B 3QIJA 2W2XC 2DFKA 3ZDTA 1LB1A 1BTKA 3ODOA 3KY9A 2D2QA 5L81A 2Z0PA 3SNHA 3UZTA 4DX8A 4HB4B 4NY0A 4A6HA 1MIXA 1EVHA 3QBVB 3TFMA 5JHGA 2DN6A 2DKQA 2GCLA 3RCPA 2ROZB 1X05A 1U5EA 2Y8GA 4WVFB 5D3YA 5KCVA 2D9WA 2V76A 3FSSA 1UPRA 1H4RA 2M14A 1XODA 3AJ4A 3GYPA 5HE3A 3TO1A 3PVUA 2Z0QA 3SUZA 3N7CA 1M7RA 1WGQA 1X1GA 1Y19B 2N0YA 5DI9B 1NU2A 3PZDA 4GN1A 3D8EA 2K00A 1KI1B 2COFA 1Q67A 3GYOA 1U2BA 2YT1A 1EF1A 1NI2A 2LOZA 1DBHA 1PLSA 1K5GB 1BTNA 4BBKA 4C0AA 1Y5OA 2UZRA 1MK9B 4WSFA 3DXDA 4KAXB 1Z87A 3SO6A 3PG7A 4HAXB 1ZC4B 5HE0A 3BINA 2COAA 2JP2A 3M1IB 1UNRA 2FJLA 4HAVB 1PMSA 3A8PA 3HK0A 3A8QA 4KVGB 2P0HA 1AWEA 1OY2A 3FEHA 1FB8A 1XKEA 4TYZA 1WJMA 2P0FA 2P0DA 4GMVA 1QQGA 5KQ1A 2CY5A 1V89A 2DLWA 1KZ7A 2D9XA 3G9WA 3PVWA 3U7DA 3TW1A 1DDVA 2DHJA 4K81A 1E5WA 4F7GA 4HB2B 2DTCA 3ML4A 1DROA 1U5DA 1ZVRA 1K5DB 3DXEA 5JLJB 3LJUX 3HQCA 5DH9B 2Y7BA 2D4QA 2MWNB 4A5KA 3CXBB 3WYFB 2IFSA 4EMOA 2HE7A 1MK7B 1J19A 1WJ1A 2H7DA 1W1DA 4K17A 2QKMA 4HAUB 4Z2MB 4CYEA 2ELBA 5HE2A 4GZUA 1W1GA 5EFXA 4CHJA 3ODXA 3MPXA 3KRWA 3WA0A 2VRWB 1V61A
chains in the Genus database with same CATH superfamily
2MFQA 3V5WA 5D27A 1ZSQA 3HW2B 1FHOA 5LONB 1SHCA 1X11A 4HAYB 4QJ5B 1MKEA 4HATB 2COCA 1U5GA 1DDMA 3ULBA 3TVVA 3FM8C 2GUMA 2K2JA 3HIEA 2G35A 3PSCA 1RJ2A 3U8ZA 3VOQA 4HAZB 2D9ZA 1FGYA 4QJ4B 2HTHB 1SGHA 4PQ0A 2EMSA 2MKRA 1XD4A 2ZKMX 1XR0B 4IFSA 1OMWA 1XCGA 3NWAA 2YRYA 5D3WA 5KQ4A 2LKOA 1FAOA 2LG1A 4F7UP 1MIZB 4DX90 2PZ1A 4K2OA 1P5TA 1WGUA 3BJIA 5HE1A 4MK0A 2K2UA 2I1KA 2ELAA 2DHKA 2J0MA 2EMTA 3ULCA 2NZ8B 5I2SA 4HDOA 4EKUA 2KR0A 2P8VA 2Q13A 2UZSA 2ZPYA 3KRXA 2CODA 2W2XD 3O96A 2W2WA 5C5BA 1B55A 1UNPA 4L6EA 1FHWA 5J3QA 2I5FA 3TCAA 4CHMA 2D11A 5DHAB 2J0KA 2EJ8A 2DYQA 2YT0A 3F5RA 4YL8A 1IRSA 1U5FA 2QKLA 2KUPA 3X23A 2ADZA 2Y8FA 2EC1A 2MDXA 1QC6A 4DXAB 2D10A 4GXBA 3B77A 2RRFA 4KHAA 2RVBB 2FJUB 5C79A 4TKNA 4Z2NA 5FI0A 4IAPA 4ZRKA 1I2HA 2CAYA 1PFJA 1U27A 2DHIA 1AQCA 2D9VA 3D8DA 4A6KA 3SV1A 5I2MA 3NSUA 2LOXA 4GPTB 3OANA 2NMBA 2GJYA 2NBVA 5IRSA 5C16A 2DA0A 1V88A 1P6SA 1GC7A 1N3HA 1BWNA 3U12A 4MT7A 5FI1A 5C5BB 2BCJA 2KGXB 2YSZA 1NTVA 2OQBA 3IVFA 4H8SA 2E2XA 1V5UA 3AU5A 1FGZA 1X86A 4KHBA 2YF0A 1EAZA 2DX5A 2UVMA 1V5MA 2DYNA 4D6WA 3PVLA 2XQNM 3PP2A 5C6RA 3ODWA 2DKPA 1FOEA 1ZM0A 5CLQB 1FHXA 1XX0A 2ROVA 1H10A 1NTYA 2VKIA 4PNKA 2RLOA 4HDQA 2RSGA 2VSZA 4GMXB 3P7ZA 4KHBB 3D8FA 4D0NB 2I5CA 2RGNB 2GCJA 2YS5A 4HHVA 2LULA 1MAIA 4EJNA 4P7IA 2R09A 5D3XA 1KZGA 2RUKB 1ISNA 2DX1A 4A6FB 2K8EA 3PEGA 4NSWA 2KUQA 1TJ6A 2AL6A 5GOWB 4MY6A 4YONA 3VIAA 2Z59A 2D9YA 1OQNA 4WJ7A 3KZ1A 5J3YA 3NW8A 1BAKA 2R0DA 3KSYA 4Y94A 1V5PA 4HB0B 2M38A 4XWXA 4K2PA 4A6FA 4B6HA 1GC6A 2I1JA 3CIKA 1P3RA 1EGXA 1WG7A 2CRFA 4F7HA 4IOYX 1GG3A 1DYNA 5JP4A 3AU4A 1UEFA 3P6AA 2CY4A 1W1HA 2H7EA 2X18A 2YS3A 2Z0OA 1UPQA 3SYXA 5JHHA 1MPHA 1RRPB 1WVHA 1LW3A 1TQZA 1TXDA 2YVCA 5LG4B 4OSNA 2J0JA 4ZRJA 3MDBC 2KIEA 2RNRB 3T06A 2L2IA 3NWFA 4KHOA 2IYBA 1T77A 4ZRIA 1X1FA 5CLLB 3A98B 1UNQA 2GS0A 1I7AA 2LYDA 4DBBA 1MI1A 1DDWA 3QWMA 3DCXA 5LOPB 5DIFB 4GNKB 1U29A 2KCJA 5DHFB 3ZVRA 2OTXA 1M7EA 2YS1A 5M4YB 3F0WA 2N23A 3DXCA 1J0WA 2L1CA 2YT2A 4DIXA 5D3VA 1WI1A 5J3TA 2J59M 2AEHA 4HB3B 3NWDA 4HAWB 1ZC3B 3QIJA 2W2XC 2DFKA 3ZDTA 1LB1A 1BTKA 3ODOA 3KY9A 2D2QA 5L81A 2Z0PA 3SNHA 3UZTA 4DX8A 4HB4B 4NY0A 2Z4DA 4A6HA 1MIXA 1EVHA 3QBVB 3TFMA 5JHGA 2DN6A 2DKQA 2GCLA 3RCPA 2ROZB 1X05A 1U5EA 2Y8GA 4WVFB 5D3YA 5KCVA 2D9WA 2V76A 3FSSA 1UPRA 1H4RA 2M14A 1XODA 3AJ4A 3GYPA 4GOUA 5HE3A 3TO1A 3PVUA 2Z0QA 4QXAB 3SUZA 3N7CA 1M7RA 1WGQA 1X1GA 1Y19B 2N0YA 5DI9B 3OHMB 1NU2A 3PZDA 4GN1A 3D8EA 2K00A 1KI1B 2COFA 1Q67A 3GYOA 1U2BA 2YT1A 1EF1A 1NI2A 2LOZA 1DBHA 1PLSA 1K5GB 1BTNA 4HSIA 4BBKA 4C0AA 1Y5OA 2UZRA 1MK9B 4WSFA 3DXDA 4KAXB 4L1RA 1Z87A 4CSQA 3SO6A 3PG7A 4HAXB 1ZC4B 5HE0A 4OT1A 3BINA 2COAA 2JP2A 3M1IB 1UNRA 2FJLA 4HAVB 1PMSA 3A8PA 3HK0A 3A8QA 2Z13A 4KVGB 2P0HA 1AWEA 1OY2A 3FEHA 1FB8A 1XKEA 4TYZA 1WJMA 2P0FA 2P0DA 4GMVA 4QJ3B 1QQGA 5KQ1A 2CY5A 1V89A 2DLWA 1KZ7A 2D9XA 3G9WA 3PVWA 3U7DA 3TW1A 1DDVA 2DHJA 4K81A 1E5WA 2R2YA 4F7GA 4HB2B 3A58A 2DTCA 3HSAA 3ML4A 1DROA 1U5DA 1ZVRA 1K5DB 3DXEA 5JLJB 3LJUX 3HQCA 5DH9B 2Y7BA 2D4QA 2Z14A 2MWNB 4A5KA 3CXBB 3WYFB 2IFSA 4EMOA 3FVCA 2HE7A 2K49A 1MK7B 1J19A 1WJ1A 2H7DA 1W1DA 4K17A 2QKMA 2KIGA 4HAUB 4Z2MB 4CYEA 2ELBA 5HE2A 4GZUA 1W1GA 5EFXA 1ZYIA 4CHJA 3ODXA 3MPXA 3KRWA 3WA0A 2VRWB 1V61A
chains in the Genus database with same CATH topology
2MFQA 3V5WA 5D27A 1ZSQA 3HW2B 1FHOA 5LONB 1SHCA 1X11A 4HAYB 1MKEA 4HATB 2COCA 1U5GA 1DDMA 3ULBA 3TVVA 3FM8C 2K2JA 2G35A 3PSCA 1RJ2A 3U8ZA 3VOQA 4HAZB 2D9ZA 1FGYA 2HTHB 1SGHA 4PQ0A 2EMSA 2MKRA 1XD4A 1XR0B 4IFSA 1OMWA 1XCGA 2YRYA 5D3WA 5KQ4A 2LKOA 1FAOA 2LG1A 4F7UP 1MIZB 4DX90 2PZ1A 4K2OA 1P5TA 1WGUA 3BJIA 5HE1A 4MK0A 2K2UA 2I1KA 2ELAA 2DHKA 2J0MA 2EMTA 3ULCA 2NZ8B 4HDOA 4EKUA 2P8VA 2Q13A 2UZSA 2ZPYA 3KRXA 2CODA 2W2XD 3O96A 2W2WA 5C5BA 1B55A 1UNPA 4L6EA 1FHWA 5J3QA 2I5FA 3TCAA 4CHMA 2D11A 5DHAB 2J0KA 2EJ8A 2DYQA 2YT0A 3F5RA 4YL8A 1IRSA 1U5FA 2QKLA 2KUPA 3X23A 2ADZA 2Y8FA 2EC1A 2MDXA 1QC6A 4DXAB 2D10A 4GXBA 4KHAA 2RVBB 5C79A 4TKNA 4Z2NA 5FI0A 4IAPA 4ZRKA 1I2HA 2CAYA 1PFJA 1U27A 2DHIA 1AQCA 2D9VA 3D8DA 4A6KA 3SV1A 3NSUA 2LOXA 4GPTB 3OANA 2NMBA 2GJYA 5C16A 2DA0A 1V88A 1P6SA 1GC7A 1N3HA 1BWNA 4MT7A 5FI1A 5C5BB 2BCJA 2KGXB 2YSZA 1NTVA 2OQBA 3IVFA 4H8SA 2E2XA 1V5UA 3AU5A 1FGZA 1X86A 2YF0A 1EAZA 2DX5A 2UVMA 1V5MA 2DYNA 3PVLA 2XQNM 3PP2A 5C6RA 3ODWA 2DKPA 1FOEA 1ZM0A 5CLQB 1FHXA 1XX0A 2ROVA 1H10A 1NTYA 2VKIA 4PNKA 2RLOA 4HDQA 2RSGA 2VSZA 4GMXB 3P7ZA 4KHBB 3D8FA 4D0NB 2I5CA 2RGNB 2GCJA 2YS5A 4HHVA 2LULA 1MAIA 4EJNA 4P7IA 2R09A 5D3XA 1KZGA 2RUKB 1ISNA 2DX1A 4A6FB 3PEGA 4NSWA 1TJ6A 2AL6A 5GOWB 4MY6A 4YONA 3VIAA 2D9YA 1OQNA 4WJ7A 3KZ1A 5J3YA 1BAKA 2R0DA 3KSYA 4Y94A 1V5PA 4HB0B 2M38A 4XWXA 4K2PA 4A6FA 4B6HA 1GC6A 2I1JA 3CIKA 1P3RA 1EGXA 1WG7A 2CRFA 4F7HA 4IOYX 1GG3A 1DYNA 5JP4A 3AU4A 1UEFA 3P6AA 2CY4A 1W1HA 2H7EA 2X18A 2YS3A 2Z0OA 1UPQA 3SYXA 5JHHA 1MPHA 1RRPB 1WVHA 1LW3A 1TQZA 1TXDA 2YVCA 2J0JA 4ZRJA 3MDBC 2RNRB 3T06A 2L2IA 4KHOA 2IYBA 4ZRIA 1X1FA 5CLLB 3A98B 1UNQA 2GS0A 1I7AA 2LYDA 4DBBA 1DDWA 3QWMA 5LOPB 5DIFB 1U29A 2KCJA 5DHFB 3ZVRA 2OTXA 1M7EA 2YS1A 3F0WA 2N23A 3DXCA 1J0WA 2L1CA 5D3VA 1WI1A 5J3TA 2J59M 2AEHA 4HB3B 4HAWB 1ZC3B 3QIJA 2W2XC 2DFKA 3ZDTA 1LB1A 1BTKA 3ODOA 3KY9A 2D2QA 5L81A 2Z0PA 3SNHA 3UZTA 4DX8A 4HB4B 4NY0A 4A6HA 1MIXA 1EVHA 3QBVB 3TFMA 5JHGA 2DN6A 2DKQA 2GCLA 3RCPA 2ROZB 1X05A 1U5EA 2Y8GA 4WVFB 5D3YA 5KCVA 2D9WA 2V76A 3FSSA 1UPRA 1H4RA 2M14A 1XODA 3AJ4A 3GYPA 5HE3A 3TO1A 3PVUA 2Z0QA 3SUZA 3N7CA 1M7RA 1WGQA 1X1GA 1Y19B 2N0YA 5DI9B 1NU2A 3PZDA 4GN1A 3D8EA 2K00A 1KI1B 2COFA 1Q67A 3GYOA 1U2BA 2YT1A 1EF1A 1NI2A 2LOZA 1DBHA 1PLSA 1K5GB 1BTNA 4BBKA 4C0AA 1Y5OA 2UZRA 1MK9B 4WSFA 3DXDA 4KAXB 1Z87A 3SO6A 3PG7A 4HAXB 1ZC4B 5HE0A 3BINA 2COAA 2JP2A 3M1IB 1UNRA 2FJLA 4HAVB 1PMSA 3A8PA 3HK0A 3A8QA 4KVGB 2P0HA 1AWEA 1OY2A 3FEHA 1FB8A 1XKEA 4TYZA 1WJMA 2P0FA 2P0DA 4GMVA 1QQGA 5KQ1A 2CY5A 1V89A 2DLWA 1KZ7A 2D9XA 3G9WA 3PVWA 3U7DA 3TW1A 1DDVA 2DHJA 4K81A 1E5WA 4F7GA 4HB2B 2DTCA 3ML4A 1DROA 1U5DA 1ZVRA 1K5DB 3DXEA 5JLJB 3LJUX 3HQCA 5DH9B 2Y7BA 2D4QA 2MWNB 4A5KA 3CXBB 3WYFB 2IFSA 4EMOA 2HE7A 1MK7B 1J19A 1WJ1A 2H7DA 1W1DA 4K17A 2QKMA 4HAUB 4Z2MB 4CYEA 2ELBA 5HE2A 4GZUA 1W1GA 5EFXA 4CHJA 3ODXA 3MPXA 3KRWA 3WA0A 2VRWB 1V61A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MFQ A;  3V5W A;  5D27 A;  1ZSQ A;  3HW2 B;  1FHO A;  5LON B;  1SHC A;  1X11 A;  4HAY B;  1MKE A;  4HAT B;  2COC A;  1U5G A;  1DDM A;  3ULB A;  3TVV A;  3FM8 C;  2K2J A;  2G35 A;  3PSC A;  1RJ2 A;  3U8Z A;  3VOQ A;  4HAZ B;  2D9Z A;  1FGY A;  2HTH B;  1SGH A;  4PQ0 A;  2EMS A;  2MKR A;  1XD4 A;  1XR0 B;  4IFS A;  1OMW A;  1XCG A;  2YRY A;  5D3W A;  5KQ4 A;  2LKO A;  1FAO A;  2LG1 A;  4F7U P;  1MIZ B;  4DX9 0;  2PZ1 A;  4K2O A;  1P5T A;  1WGU A;  3BJI A;  5HE1 A;  4MK0 A;  2K2U A;  2I1K A;  2ELA A;  2DHK A;  2J0M A;  2EMT A;  3ULC A;  2NZ8 B;  4HDO A;  4EKU A;  2P8V A;  2Q13 A;  2UZS A;  2ZPY A;  3KRX A;  2COD A;  2W2X D;  3O96 A;  2W2W A;  5C5B A;  1B55 A;  1UNP A;  4L6E A;  1FHW A;  5J3Q A;  2I5F A;  3TCA A;  4CHM A;  2D11 A;  5DHA B;  2J0K A;  2EJ8 A;  2DYQ A;  2YT0 A;  3F5R A;  4YL8 A;  1IRS A;  1U5F A;  2QKL A;  2KUP A;  3X23 A;  2ADZ A;  2Y8F A;  2EC1 A;  2MDX A;  1QC6 A;  4DXA B;  2D10 A;  4GXB A;  4KHA A;  2RVB B;  5C79 A;  4TKN A;  4Z2N A;  5FI0 A;  4IAP A;  4ZRK A;  1I2H A;  2CAY A;  1PFJ A;  1U27 A;  2DHI A;  1AQC A;  2D9V A;  3D8D A;  4A6K A;  3SV1 A;  3NSU A;  2LOX A;  4GPT B;  3OAN A;  2NMB A;  2GJY A;  5C16 A;  2DA0 A;  1V88 A;  1P6S A;  1GC7 A;  1N3H A;  1BWN A;  4MT7 A;  5FI1 A;  5C5B B;  2BCJ A;  2KGX B;  2YSZ A;  1NTV A;  2OQB A;  3IVF A;  4H8S A;  2E2X A;  1V5U A;  3AU5 A;  1FGZ A;  1X86 A;  2YF0 A;  1EAZ A;  2DX5 A;  2UVM A;  1V5M A;  2DYN A;  3PVL A;  2XQN M;  3PP2 A;  5C6R A;  3ODW A;  2DKP A;  1FOE A;  1ZM0 A;  5CLQ B;  1FHX A;  1XX0 A;  2ROV A;  1H10 A;  1NTY A;  2VKI A;  4PNK A;  2RLO A;  4HDQ A;  2RSG A;  2VSZ A;  4GMX B;  3P7Z A;  4KHB B;  3D8F A;  4D0N B;  2I5C A;  2RGN B;  2GCJ A;  2YS5 A;  4HHV A;  2LUL A;  1MAI A;  4EJN A;  4P7I A;  2R09 A;  5D3X A;  1KZG A;  2RUK B;  1ISN A;  2DX1 A;  4A6F B;  3PEG A;  4NSW A;  1TJ6 A;  2AL6 A;  5GOW B;  4MY6 A;  4YON A;  3VIA A;  2D9Y A;  1OQN A;  4WJ7 A;  3KZ1 A;  5J3Y A;  1BAK A;  2R0D A;  3KSY A;  4Y94 A;  1V5P A;  4HB0 B;  2M38 A;  4XWX A;  4K2P A;  4A6F A;  4B6H A;  1GC6 A;  2I1J A;  3CIK A;  1P3R A;  1EGX A;  1WG7 A;  2CRF A;  4F7H A;  4IOY X;  1GG3 A;  1DYN A;  5JP4 A;  3AU4 A;  1UEF A;  3P6A A;  2CY4 A;  1W1H A;  2H7E A;  2X18 A;  2YS3 A;  2Z0O A;  1UPQ A;  3SYX A;  5JHH A;  1MPH A;  1RRP B;  1WVH A;  1LW3 A;  1TQZ A;  1TXD A;  2YVC A;  2J0J A;  4ZRJ A;  3MDB C;  2RNR B;  3T06 A;  2L2I A;  4KHO A;  2IYB A;  4ZRI A;  1X1F A;  5CLL B;  3A98 B;  1UNQ A;  2GS0 A;  1I7A A;  2LYD A;  4DBB A;  1DDW A;  3QWM A;  5LOP B;  5DIF B;  1U29 A;  2KCJ A;  5DHF B;  3ZVR A;  2OTX A;  1M7E A;  2YS1 A;  3F0W A;  2N23 A;  3DXC A;  1J0W A;  2L1C A;  5D3V A;  1WI1 A;  5J3T A;  2J59 M;  2AEH A;  4HB3 B;  4HAW B;  1ZC3 B;  3QIJ A;  2W2X C;  2DFK A;  3ZDT A;  1LB1 A;  1BTK A;  3ODO A;  3KY9 A;  2D2Q A;  5L81 A;  2Z0P A;  3SNH A;  3UZT A;  4DX8 A;  4HB4 B;  4NY0 A;  4A6H A;  1MIX A;  1EVH A;  3QBV B;  3TFM A;  5JHG A;  2DN6 A;  2DKQ A;  2GCL A;  3RCP A;  2ROZ B;  1X05 A;  1U5E A;  2Y8G A;  4WVF B;  5D3Y A;  5KCV A;  2D9W A;  2V76 A;  3FSS A;  1UPR A;  1H4R A;  2M14 A;  1XOD A;  3AJ4 A;  3GYP A;  5HE3 A;  3TO1 A;  3PVU A;  2Z0Q A;  3SUZ A;  3N7C A;  1M7R A;  1WGQ A;  1X1G A;  1Y19 B;  2N0Y A;  5DI9 B;  1NU2 A;  3PZD A;  4GN1 A;  3D8E A;  2K00 A;  1KI1 B;  2COF A;  1Q67 A;  3GYO A;  1U2B A;  2YT1 A;  1EF1 A;  1NI2 A;  2LOZ A;  1DBH A;  1PLS A;  1K5G B;  1BTN A;  4BBK A;  4C0A A;  1Y5O A;  2UZR A;  1MK9 B;  4WSF A;  3DXD A;  4KAX B;  1Z87 A;  3SO6 A;  3PG7 A;  4HAX B;  1ZC4 B;  5HE0 A;  3BIN A;  2COA A;  2JP2 A;  3M1I B;  1UNR A;  2FJL A;  4HAV B;  1PMS A;  3A8P A;  3HK0 A;  3A8Q A;  4KVG B;  2P0H A;  1AWE A;  1OY2 A;  3FEH A;  1FB8 A;  1XKE A;  4TYZ A;  1WJM A;  2P0F A;  2P0D A;  4GMV A;  1QQG A;  5KQ1 A;  2CY5 A;  1V89 A;  2DLW A;  1KZ7 A;  2D9X A;  3G9W A;  3PVW A;  3U7D A;  3TW1 A;  1DDV A;  2DHJ A;  4K81 A;  1E5W A;  4F7G A;  4HB2 B;  2DTC A;  3ML4 A;  1DRO A;  1U5D A;  1ZVR A;  1K5D B;  3DXE A;  5JLJ B;  3LJU X;  3HQC A;  5DH9 B;  2Y7B A;  2D4Q A;  2MWN B;  4A5K A;  3CXB B;  3WYF B;  2IFS A;  4EMO A;  2HE7 A;  1MK7 B;  1J19 A;  1WJ1 A;  2H7D A;  1W1D A;  4K17 A;  2QKM A;  4HAU B;  4Z2M B;  4CYE A;  2ELB A;  5HE2 A;  4GZU A;  1W1G A;  5EFX A;  4CHJ A;  3ODX A;  3MPX A;  3KRW A;  3WA0 A;  2VRW B;  1V61 A; 
#chains in the Genus database with same CATH topology
 2MFQ A;  3V5W A;  5D27 A;  1ZSQ A;  3HW2 B;  1FHO A;  5LON B;  1SHC A;  1X11 A;  4HAY B;  4QJ5 B;  1MKE A;  4HAT B;  2COC A;  1U5G A;  1DDM A;  3ULB A;  3TVV A;  3FM8 C;  2GUM A;  2K2J A;  3HIE A;  2G35 A;  3PSC A;  1RJ2 A;  3U8Z A;  3VOQ A;  4HAZ B;  2D9Z A;  1FGY A;  4QJ4 B;  2HTH B;  1SGH A;  4PQ0 A;  2EMS A;  2MKR A;  1XD4 A;  2ZKM X;  1XR0 B;  4IFS A;  1OMW A;  1XCG A;  3NWA A;  2YRY A;  5D3W A;  5KQ4 A;  2LKO A;  1FAO A;  2LG1 A;  4F7U P;  1MIZ B;  4DX9 0;  2PZ1 A;  4K2O A;  1P5T A;  1WGU A;  3BJI A;  5HE1 A;  4MK0 A;  2K2U A;  2I1K A;  2ELA A;  2DHK A;  2J0M A;  2EMT A;  3ULC A;  2NZ8 B;  5I2S A;  4HDO A;  4EKU A;  2KR0 A;  2P8V A;  2Q13 A;  2UZS A;  2ZPY A;  3KRX A;  2COD A;  2W2X D;  3O96 A;  2W2W A;  5C5B A;  1B55 A;  1UNP A;  4L6E A;  1FHW A;  5J3Q A;  2I5F A;  3TCA A;  4CHM A;  2D11 A;  5DHA B;  2J0K A;  2EJ8 A;  2DYQ A;  2YT0 A;  3F5R A;  4YL8 A;  1IRS A;  1U5F A;  2QKL A;  2KUP A;  3X23 A;  2ADZ A;  2Y8F A;  2EC1 A;  2MDX A;  1QC6 A;  4DXA B;  2D10 A;  4GXB A;  3B77 A;  2RRF A;  4KHA A;  2RVB B;  2FJU B;  5C79 A;  4TKN A;  4Z2N A;  5FI0 A;  4IAP A;  4ZRK A;  1I2H A;  2CAY A;  1PFJ A;  1U27 A;  2DHI A;  1AQC A;  2D9V A;  3D8D A;  4A6K A;  3SV1 A;  5I2M A;  3NSU A;  2LOX A;  4GPT B;  3OAN A;  2NMB A;  2GJY A;  2NBV A;  5IRS A;  5C16 A;  2DA0 A;  1V88 A;  1P6S A;  1GC7 A;  1N3H A;  1BWN A;  3U12 A;  4MT7 A;  5FI1 A;  5C5B B;  2BCJ A;  2KGX B;  2YSZ A;  1NTV A;  2OQB A;  3IVF A;  4H8S A;  2E2X A;  1V5U A;  3AU5 A;  1FGZ A;  1X86 A;  4KHB A;  2YF0 A;  1EAZ A;  2DX5 A;  2UVM A;  1V5M A;  2DYN A;  4D6W A;  3PVL A;  2XQN M;  3PP2 A;  5C6R A;  3ODW A;  2DKP A;  1FOE A;  1ZM0 A;  5CLQ B;  1FHX A;  1XX0 A;  2ROV A;  1H10 A;  1NTY A;  2VKI A;  4PNK A;  2RLO A;  4HDQ A;  2RSG A;  2VSZ A;  4GMX B;  3P7Z A;  4KHB B;  3D8F A;  4D0N B;  2I5C A;  2RGN B;  2GCJ A;  2YS5 A;  4HHV A;  2LUL A;  1MAI A;  4EJN A;  4P7I A;  2R09 A;  5D3X A;  1KZG A;  2RUK B;  1ISN A;  2DX1 A;  4A6F B;  2K8E A;  3PEG A;  4NSW A;  2KUQ A;  1TJ6 A;  2AL6 A;  5GOW B;  4MY6 A;  4YON A;  3VIA A;  2Z59 A;  2D9Y A;  1OQN A;  4WJ7 A;  3KZ1 A;  5J3Y A;  3NW8 A;  1BAK A;  2R0D A;  3KSY A;  4Y94 A;  1V5P A;  4HB0 B;  2M38 A;  4XWX A;  4K2P A;  4A6F A;  4B6H A;  1GC6 A;  2I1J A;  3CIK A;  1P3R A;  1EGX A;  1WG7 A;  2CRF A;  4F7H A;  4IOY X;  1GG3 A;  1DYN A;  5JP4 A;  3AU4 A;  1UEF A;  3P6A A;  2CY4 A;  1W1H A;  2H7E A;  2X18 A;  2YS3 A;  2Z0O A;  1UPQ A;  3SYX A;  5JHH A;  1MPH A;  1RRP B;  1WVH A;  1LW3 A;  1TQZ A;  1TXD A;  2YVC A;  5LG4 B;  4OSN A;  2J0J A;  4ZRJ A;  3MDB C;  2KIE A;  2RNR B;  3T06 A;  2L2I A;  3NWF A;  4KHO A;  2IYB A;  1T77 A;  4ZRI A;  1X1F A;  5CLL B;  3A98 B;  1UNQ A;  2GS0 A;  1I7A A;  2LYD A;  4DBB A;  1MI1 A;  1DDW A;  3QWM A;  3DCX A;  5LOP B;  5DIF B;  4GNK B;  1U29 A;  2KCJ A;  5DHF B;  3ZVR A;  2OTX A;  1M7E A;  2YS1 A;  5M4Y B;  3F0W A;  2N23 A;  3DXC A;  1J0W A;  2L1C A;  2YT2 A;  4DIX A;  5D3V A;  1WI1 A;  5J3T A;  2J59 M;  2AEH A;  4HB3 B;  3NWD A;  4HAW B;  1ZC3 B;  3QIJ A;  2W2X C;  2DFK A;  3ZDT A;  1LB1 A;  1BTK A;  3ODO A;  3KY9 A;  2D2Q A;  5L81 A;  2Z0P A;  3SNH A;  3UZT A;  4DX8 A;  4HB4 B;  4NY0 A;  2Z4D A;  4A6H A;  1MIX A;  1EVH A;  3QBV B;  3TFM A;  5JHG A;  2DN6 A;  2DKQ A;  2GCL A;  3RCP A;  2ROZ B;  1X05 A;  1U5E A;  2Y8G A;  4WVF B;  5D3Y A;  5KCV A;  2D9W A;  2V76 A;  3FSS A;  1UPR A;  1H4R A;  2M14 A;  1XOD A;  3AJ4 A;  3GYP A;  4GOU A;  5HE3 A;  3TO1 A;  3PVU A;  2Z0Q A;  4QXA B;  3SUZ A;  3N7C A;  1M7R A;  1WGQ A;  1X1G A;  1Y19 B;  2N0Y A;  5DI9 B;  3OHM B;  1NU2 A;  3PZD A;  4GN1 A;  3D8E A;  2K00 A;  1KI1 B;  2COF A;  1Q67 A;  3GYO A;  1U2B A;  2YT1 A;  1EF1 A;  1NI2 A;  2LOZ A;  1DBH A;  1PLS A;  1K5G B;  1BTN A;  4HSI A;  4BBK A;  4C0A A;  1Y5O A;  2UZR A;  1MK9 B;  4WSF A;  3DXD A;  4KAX B;  4L1R A;  1Z87 A;  4CSQ A;  3SO6 A;  3PG7 A;  4HAX B;  1ZC4 B;  5HE0 A;  4OT1 A;  3BIN A;  2COA A;  2JP2 A;  3M1I B;  1UNR A;  2FJL A;  4HAV B;  1PMS A;  3A8P A;  3HK0 A;  3A8Q A;  2Z13 A;  4KVG B;  2P0H A;  1AWE A;  1OY2 A;  3FEH A;  1FB8 A;  1XKE A;  4TYZ A;  1WJM A;  2P0F A;  2P0D A;  4GMV A;  4QJ3 B;  1QQG A;  5KQ1 A;  2CY5 A;  1V89 A;  2DLW A;  1KZ7 A;  2D9X A;  3G9W A;  3PVW A;  3U7D A;  3TW1 A;  1DDV A;  2DHJ A;  4K81 A;  1E5W A;  2R2Y A;  4F7G A;  4HB2 B;  3A58 A;  2DTC A;  3HSA A;  3ML4 A;  1DRO A;  1U5D A;  1ZVR A;  1K5D B;  3DXE A;  5JLJ B;  3LJU X;  3HQC A;  5DH9 B;  2Y7B A;  2D4Q A;  2Z14 A;  2MWN B;  4A5K A;  3CXB B;  3WYF B;  2IFS A;  4EMO A;  3FVC A;  2HE7 A;  2K49 A;  1MK7 B;  1J19 A;  1WJ1 A;  2H7D A;  1W1D A;  4K17 A;  2QKM A;  2KIG A;  4HAU B;  4Z2M B;  4CYE A;  2ELB A;  5HE2 A;  4GZU A;  1W1G A;  5EFX A;  1ZYI A;  4CHJ A;  3ODX A;  3MPX A;  3KRW A;  3WA0 A;  2VRW B;  1V61 A; 
#chains in the Genus database with same CATH homology
 2MFQ A;  3V5W A;  5D27 A;  1ZSQ A;  3HW2 B;  1FHO A;  5LON B;  1SHC A;  1X11 A;  4HAY B;  1MKE A;  4HAT B;  2COC A;  1U5G A;  1DDM A;  3ULB A;  3TVV A;  3FM8 C;  2K2J A;  2G35 A;  3PSC A;  1RJ2 A;  3U8Z A;  3VOQ A;  4HAZ B;  2D9Z A;  1FGY A;  2HTH B;  1SGH A;  4PQ0 A;  2EMS A;  2MKR A;  1XD4 A;  1XR0 B;  4IFS A;  1OMW A;  1XCG A;  2YRY A;  5D3W A;  5KQ4 A;  2LKO A;  1FAO A;  2LG1 A;  4F7U P;  1MIZ B;  4DX9 0;  2PZ1 A;  4K2O A;  1P5T A;  1WGU A;  3BJI A;  5HE1 A;  4MK0 A;  2K2U A;  2I1K A;  2ELA A;  2DHK A;  2J0M A;  2EMT A;  3ULC A;  2NZ8 B;  4HDO A;  4EKU A;  2P8V A;  2Q13 A;  2UZS A;  2ZPY A;  3KRX A;  2COD A;  2W2X D;  3O96 A;  2W2W A;  5C5B A;  1B55 A;  1UNP A;  4L6E A;  1FHW A;  5J3Q A;  2I5F A;  3TCA A;  4CHM A;  2D11 A;  5DHA B;  2J0K A;  2EJ8 A;  2DYQ A;  2YT0 A;  3F5R A;  4YL8 A;  1IRS A;  1U5F A;  2QKL A;  2KUP A;  3X23 A;  2ADZ A;  2Y8F A;  2EC1 A;  2MDX A;  1QC6 A;  4DXA B;  2D10 A;  4GXB A;  4KHA A;  2RVB B;  5C79 A;  4TKN A;  4Z2N A;  5FI0 A;  4IAP A;  4ZRK A;  1I2H A;  2CAY A;  1PFJ A;  1U27 A;  2DHI A;  1AQC A;  2D9V A;  3D8D A;  4A6K A;  3SV1 A;  3NSU A;  2LOX A;  4GPT B;  3OAN A;  2NMB A;  2GJY A;  5C16 A;  2DA0 A;  1V88 A;  1P6S A;  1GC7 A;  1N3H A;  1BWN A;  4MT7 A;  5FI1 A;  5C5B B;  2BCJ A;  2KGX B;  2YSZ A;  1NTV A;  2OQB A;  3IVF A;  4H8S A;  2E2X A;  1V5U A;  3AU5 A;  1FGZ A;  1X86 A;  2YF0 A;  1EAZ A;  2DX5 A;  2UVM A;  1V5M A;  2DYN A;  3PVL A;  2XQN M;  3PP2 A;  5C6R A;  3ODW A;  2DKP A;  1FOE A;  1ZM0 A;  5CLQ B;  1FHX A;  1XX0 A;  2ROV A;  1H10 A;  1NTY A;  2VKI A;  4PNK A;  2RLO A;  4HDQ A;  2RSG A;  2VSZ A;  4GMX B;  3P7Z A;  4KHB B;  3D8F A;  4D0N B;  2I5C A;  2RGN B;  2GCJ A;  2YS5 A;  4HHV A;  2LUL A;  1MAI A;  4EJN A;  4P7I A;  2R09 A;  5D3X A;  1KZG A;  2RUK B;  1ISN A;  2DX1 A;  4A6F B;  3PEG A;  4NSW A;  1TJ6 A;  2AL6 A;  5GOW B;  4MY6 A;  4YON A;  3VIA A;  2D9Y A;  1OQN A;  4WJ7 A;  3KZ1 A;  5J3Y A;  1BAK A;  2R0D A;  3KSY A;  4Y94 A;  1V5P A;  4HB0 B;  2M38 A;  4XWX A;  4K2P A;  4A6F A;  4B6H A;  1GC6 A;  2I1J A;  3CIK A;  1P3R A;  1EGX A;  1WG7 A;  2CRF A;  4F7H A;  4IOY X;  1GG3 A;  1DYN A;  5JP4 A;  3AU4 A;  1UEF A;  3P6A A;  2CY4 A;  1W1H A;  2H7E A;  2X18 A;  2YS3 A;  2Z0O A;  1UPQ A;  3SYX A;  5JHH A;  1MPH A;  1RRP B;  1WVH A;  1LW3 A;  1TQZ A;  1TXD A;  2YVC A;  2J0J A;  4ZRJ A;  3MDB C;  2RNR B;  3T06 A;  2L2I A;  4KHO A;  2IYB A;  4ZRI A;  1X1F A;  5CLL B;  3A98 B;  1UNQ A;  2GS0 A;  1I7A A;  2LYD A;  4DBB A;  1DDW A;  3QWM A;  5LOP B;  5DIF B;  1U29 A;  2KCJ A;  5DHF B;  3ZVR A;  2OTX A;  1M7E A;  2YS1 A;  3F0W A;  2N23 A;  3DXC A;  1J0W A;  2L1C A;  5D3V A;  1WI1 A;  5J3T A;  2J59 M;  2AEH A;  4HB3 B;  4HAW B;  1ZC3 B;  3QIJ A;  2W2X C;  2DFK A;  3ZDT A;  1LB1 A;  1BTK A;  3ODO A;  3KY9 A;  2D2Q A;  5L81 A;  2Z0P A;  3SNH A;  3UZT A;  4DX8 A;  4HB4 B;  4NY0 A;  4A6H A;  1MIX A;  1EVH A;  3QBV B;  3TFM A;  5JHG A;  2DN6 A;  2DKQ A;  2GCL A;  3RCP A;  2ROZ B;  1X05 A;  1U5E A;  2Y8G A;  4WVF B;  5D3Y A;  5KCV A;  2D9W A;  2V76 A;  3FSS A;  1UPR A;  1H4R A;  2M14 A;  1XOD A;  3AJ4 A;  3GYP A;  5HE3 A;  3TO1 A;  3PVU A;  2Z0Q A;  3SUZ A;  3N7C A;  1M7R A;  1WGQ A;  1X1G A;  1Y19 B;  2N0Y A;  5DI9 B;  1NU2 A;  3PZD A;  4GN1 A;  3D8E A;  2K00 A;  1KI1 B;  2COF A;  1Q67 A;  3GYO A;  1U2B A;  2YT1 A;  1EF1 A;  1NI2 A;  2LOZ A;  1DBH A;  1PLS A;  1K5G B;  1BTN A;  4BBK A;  4C0A A;  1Y5O A;  2UZR A;  1MK9 B;  4WSF A;  3DXD A;  4KAX B;  1Z87 A;  3SO6 A;  3PG7 A;  4HAX B;  1ZC4 B;  5HE0 A;  3BIN A;  2COA A;  2JP2 A;  3M1I B;  1UNR A;  2FJL A;  4HAV B;  1PMS A;  3A8P A;  3HK0 A;  3A8Q A;  4KVG B;  2P0H A;  1AWE A;  1OY2 A;  3FEH A;  1FB8 A;  1XKE A;  4TYZ A;  1WJM A;  2P0F A;  2P0D A;  4GMV A;  1QQG A;  5KQ1 A;  2CY5 A;  1V89 A;  2DLW A;  1KZ7 A;  2D9X A;  3G9W A;  3PVW A;  3U7D A;  3TW1 A;  1DDV A;  2DHJ A;  4K81 A;  1E5W A;  4F7G A;  4HB2 B;  2DTC A;  3ML4 A;  1DRO A;  1U5D A;  1ZVR A;  1K5D B;  3DXE A;  5JLJ B;  3LJU X;  3HQC A;  5DH9 B;  2Y7B A;  2D4Q A;  2MWN B;  4A5K A;  3CXB B;  3WYF B;  2IFS A;  4EMO A;  2HE7 A;  1MK7 B;  1J19 A;  1WJ1 A;  2H7D A;  1W1D A;  4K17 A;  2QKM A;  4HAU B;  4Z2M B;  4CYE A;  2ELB A;  5HE2 A;  4GZU A;  1W1G A;  5EFX A;  4CHJ A;  3ODX A;  3MPX A;  3KRW A;  3WA0 A;  2VRW B;  1V61 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...