4WJ7A

Ccm2 ptb domain in complex with krit1 npxy/f3
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
167
structure length
137
Chain Sequence
b'PDRLLSDYIEKEVKYLGQLTSIPGYLNPSSRTEILHFIDNAKRAHQLPGHLTQEHDAVLSLSAYNVKLAWRDGEDIILRVPIHDIAAVSYVRDDAAHLVVLKTAQDEACCLVILAAESKVAAEELCCLLGQVFQVVY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Malcavernin
publication title Structural Basis for the Disruption of the Cerebral Cavernous Malformations 2 (CCM2) Interaction with Krev Interaction Trapped 1 (KRIT1) by Disease-associated Mutations.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 35
structure length 137
sequence length 167
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-09-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4wj7A00
1MKEA 3MPXA 1UPRA 1BTNA 5DI9B 3PG7A 5EFXA 5C79A 1FAOA 1PMSA 5DH9B 4TKNA 4HAXB 3SO6A 2LOZA 2D9XA 1V5UA 1M7EA 1ZSQA 2YS5A 1X1FA 2VRWB 1J19A 3KY9A 1UEFA 3ML4A 1TXDA 2ADZA 5C5BB 1XD4A 4ZRIA 5C5BA 2YS3A 1U5GA 2M38A 2MWNB 2RNRB 1X05A 4NY0A 2Z0PA 1FGZA 1X1GA 3SUZA 3ZVRA 2UZSA 4GPTB 2NZ8B 2MDXA 2KCJA 4GMXB 3GYOA 1DDVA 1FHOA 5HE0A 2BCJA 5JP4A 2DKQA 2Y7BA 1XKEA 2CAYA 2X18A 4MY6A 1V89A 1QC6A 2J59M 1SHCA 1ZC4B 3TO1A 1K5GB 2V76A 4PNKA 4EMOA 2W2WA 4HHVA 4GMVA 2FJLA 3PVLA 3KSYA 5JHGA 1MAIA 3QIJA 1MIZB 2Z0OA 3P7ZA 2P8VA 2K2JA 2I1JA 4YL8A 4KVGB 3VOQA 4A6FB 2OQBA 1TQZA 4HDQA 1RRPB 4HAZB 2ELAA 2N23A 5LOPB 4A6FA 3SYXA 2GCJA 4XWXA 5CLLB 3F0WA 2P0DA 1KZGA 3A8PA 4H8SA 5DIFB 3DXDA 3V5WA 1ZM0A 3ODOA 3WYFB 3N7CA 1QQGA 2QKLA 2LG1A 3AU5A 1UPQA 4KHBB 3WA0A 4Y94A 3FM8C 3X23A 1I7AA 2D11A 1DDWA 2CODA 2D10A 1GC7A 3G9WA 3FEHA 1BAKA 5KQ4A 1WI1A 2VKIA 4WJ7A 1WG7A 3HQCA 1XR0B 3CXBB 5D3WA 1W1DA 2D9VA 2DTCA 2UVMA 2D4QA 2EMSA 5FI0A 2COCA 1BWNA 1AQCA 4HB3B 5J3YA 1H10A 2DX5A 2ROZB 1TJ6A 1Q67A 1U5FA 2RLOA 2LOXA 4IOYX 3VIAA 3A98B 1PLSA 1N3HA 2GJYA 3FSSA 4KHAA 2EMTA 3U7DA 1Y19B 1DROA 3D8FA 4ZRJA 2L1CA 2HE7A 1FHXA 1NU2A 2DHKA 2RUKB 1UNPA 5HE2A 1ZC3B 2DYNA 1EF1A 3D8DA 2I1KA 2CY4A 4HB4B 1P3RA 1WGUA 1WJ1A 4MT7A 2IYBA 2J0KA 1Y5OA 1UNRA 1KI1B 3OANA 3PP2A 3A8QA 4HB2B 5KQ1A 2I5CA 3HW2B 2ROVA 4IFSA 1W1HA 2R0DA 3ODXA 2YRYA 4HDOA 5CLQB 2AL6A 5D27A 5C6RA 4DX8A 1SGHA 1MK7B 2RSGA 1M7RA 3HK0A 1GG3A 1DDMA 4A6KA 1WVHA 1U5DA 2GCLA 1XCGA 4P7IA 1DBHA 2PZ1A 1DYNA 1MK9B 1P6SA 2D2QA 4ZRKA 1OMWA 2RVBB 2YSZA 3F5RA 2CY5A 2DX1A 2R09A 4L6EA 3TFMA 1W1GA 1U29A 3ZDTA 2K00A 2DN6A 2E2XA 3SNHA 2DKPA 4HAYB 2CRFA 3SV1A 4F7GA 4KHOA 4GXBA 4CYEA 5C16A 1EVHA 4EKUA 2RGNB 1EAZA 1V88A 3KRWA 1NTVA 1XODA 2J0MA 4BBKA 1EGXA 2DHJA 3O96A 3PSCA 5D3YA 3T06A 4K2OA 1MIXA 5JLJB 5DHAB 1ISNA 1Z87A 2KGXB 2XQNM 1RJ2A 3M1IB 2DFKA 3AJ4A 1I2HA 2LYDA 2YF0A 2D9WA 2DLWA 1LB1A 1FHWA 3ULCA 4D0NB 5JHHA 1FOEA 1V5PA 3TVVA 2Y8GA 2COAA 2ELBA 2D9YA 3TCAA 5FI1A 2YT0A 3U8ZA 2P0HA 5HE1A 1U27A 3RCPA 3ULBA 5LONB 5D3VA 2KUPA 3PZDA 3PEGA 5J3TA 2DYQA 2P0FA 4A6HA 2JP2A 2MFQA 4CHMA 3DXCA 1U2BA 4DX90 1B55A 2YVCA 4YONA 1K5DB 2VSZA 2DA0A 1AWEA 1NTYA 1X11A 4B6HA 4HAUB 5L81A 3QWMA 1GC6A 3PVWA 5KCVA 4DXAB 5HE3A 2YT1A 1WJMA 4HAVB 2K2UA 4Z2NA 2OTXA 3ODWA 1P5TA 3KRXA 1V61A 2Q13A 4KAXB 4K17A 5J3QA 3NSUA 2COFA 4GN1A 4HAWB 1WGQA 1FGYA 2M14A 1U5EA 3QBVB 4MK0A 2HTHB 3PVUA 1FB8A 2G35A 4CHJA 2J0JA 2YS1A 4HATB 1V5MA 3CIKA 2DHIA 2UZRA 4GZUA 1OQNA 4PQ0A 3GYPA 4EJNA 3UZTA 2W2XC 3DXEA 2Y8FA 4K81A 3D8EA 4IAPA 3TW1A 1J0WA 2N0YA 2H7EA 2D9ZA 4K2PA 1LW3A 3KZ1A 2H7DA 4WSFA 3LJUX 4TYZA 1XX0A 1MPHA 1H4RA 1NI2A 1X86A 4NSWA 5GOWB 4C0AA 2Z0QA 3BINA 1UNQA 2EJ8A 3P6AA 2ZPYA 5D3XA 2QKMA 1PFJA 1IRSA 1ZVRA 4F7HA 2LKOA 3BJIA 3IVFA 1E5WA 2GS0A 1BTKA 4A5KA 1OY2A 4WVFB 2IFSA 4DBBA 4F7UP 4HB0B 2I5FA 5DHFB 2EC1A 2L2IA 3AU4A 2LULA 2W2XD 2MKRA 4Z2MB 1KZ7A 3MDBC 2AEHA 2NMBA
chains in the Genus database with same CATH superfamily
4KHBA 1MKEA 3MPXA 2RRFA 1UPRA 1BTNA 5DI9B 3PG7A 5EFXA 5C79A 1FAOA 2ZKMX 1PMSA 5DH9B 4TKNA 4HAXB 3SO6A 2LOZA 2D9XA 4QJ5B 1V5UA 1M7EA 1ZSQA 2YS5A 1X1FA 2VRWB 1J19A 3KY9A 1UEFA 3ML4A 1TXDA 2ADZA 5C5BB 5IRSA 1XD4A 4ZRIA 4QJ3B 4QXAB 2YS3A 5C5BA 1U5GA 2M38A 2MWNB 2RNRB 1X05A 2Z4DA 4NY0A 3HSAA 2Z0PA 1FGZA 1X1GA 3SUZA 3ZVRA 2UZSA 4GPTB 2NZ8B 2MDXA 2KCJA 4GMXB 3GYOA 3HIEA 1DDVA 1FHOA 5HE0A 4L1RA 2BCJA 5JP4A 2DKQA 2Y7BA 1XKEA 2CAYA 2X18A 4MY6A 1V89A 1QC6A 2J59M 1SHCA 1ZC4B 3TO1A 1K5GB 2V76A 4PNKA 4EMOA 2Z59A 3B77A 2W2WA 4HHVA 4GMVA 2FJLA 2Z14A 3PVLA 3KSYA 5JHGA 1MAIA 3QIJA 1MIZB 2Z0OA 2YT2A 3P7ZA 2P8VA 2K2JA 3NW8A 2I1JA 4YL8A 4KVGB 3VOQA 2FJUB 4A6FB 2OQBA 1TQZA 4HDQA 1RRPB 4HAZB 2ELAA 2N23A 5LOPB 4A6FA 3SYXA 2GCJA 4XWXA 5CLLB 3F0WA 2P0DA 1KZGA 3A8PA 4H8SA 5DIFB 3DXDA 3V5WA 1ZM0A 3ODOA 3WYFB 3N7CA 1QQGA 4OT1A 2QKLA 2Z13A 4GNKB 2LG1A 3AU5A 1UPQA 4KHBB 3WA0A 4Y94A 3FM8C 3X23A 1I7AA 2D11A 1DDWA 2CODA 2D10A 1GC7A 3G9WA 3FEHA 1BAKA 5KQ4A 1WI1A 2VKIA 4WJ7A 1WG7A 3HQCA 1XR0B 3CXBB 5D3WA 1W1DA 2D9VA 2DTCA 2UVMA 2D4QA 2EMSA 5FI0A 2COCA 1BWNA 1AQCA 4HB3B 5J3YA 1H10A 2DX5A 4D6WA 2ROZB 1TJ6A 1Q67A 1U5FA 2RLOA 2KR0A 2LOXA 4IOYX 3VIAA 3A98B 1PLSA 1N3HA 2GJYA 3FSSA 4KHAA 2EMTA 3U7DA 1Y19B 2GUMA 1DROA 3D8FA 3OHMB 3DCXA 4ZRJA 2L1CA 2HE7A 1FHXA 1NU2A 2DHKA 2RUKB 1UNPA 5HE2A 5I2MA 1ZC3B 2DYNA 1EF1A 3D8DA 2I1KA 2CY4A 4HB4B 1P3RA 1WGUA 1WJ1A 4MT7A 2IYBA 2J0KA 1Y5OA 1UNRA 1KI1B 3OANA 3FVCA 3PP2A 3A8QA 4HB2B 5KQ1A 2KUQA 2I5CA 3HW2B 2ROVA 4IFSA 1W1HA 2KIEA 2R0DA 3NWDA 3ODXA 2YRYA 4HDOA 5CLQB 2AL6A 5D27A 5C6RA 4DX8A 1SGHA 1MK7B 2RSGA 1M7RA 3HK0A 1GG3A 1DDMA 4A6KA 1WVHA 1U5DA 3NWFA 2GCLA 1XCGA 4P7IA 1DBHA 2PZ1A 1DYNA 1MK9B 1P6SA 2D2QA 4ZRKA 1OMWA 2RVBB 2YSZA 3F5RA 2CY5A 2DX1A 2R09A 4L6EA 3TFMA 1W1GA 1U29A 3ZDTA 2K00A 2DN6A 2E2XA 3SNHA 2DKPA 4HAYB 2CRFA 3SV1A 4F7GA 4KHOA 4GXBA 4CYEA 5C16A 1EVHA 4EKUA 2RGNB 1EAZA 1V88A 3KRWA 1NTVA 1XODA 2J0MA 4BBKA 1EGXA 2DHJA 3O96A 3PSCA 5D3YA 3T06A 4K2OA 1MIXA 5JLJB 5DHAB 4CSQA 1ISNA 1Z87A 2KGXB 2XQNM 1RJ2A 3M1IB 2DFKA 3AJ4A 4DIXA 1I2HA 2LYDA 2YF0A 2D9WA 1T77A 2DLWA 1LB1A 5I2SA 1FHWA 3ULCA 2K49A 4D0NB 1FOEA 5JHHA 1V5PA 3TVVA 2Y8GA 2COAA 2NBVA 2ELBA 2D9YA 3TCAA 5FI1A 2YT0A 2KIGA 3U8ZA 2P0HA 5HE1A 1U27A 3RCPA 3ULBA 5LONB 1ZYIA 5M4YB 5D3VA 2KUPA 3PZDA 3PEGA 5J3TA 2DYQA 2P0FA 4A6HA 2JP2A 2MFQA 4CHMA 3DXCA 1U2BA 4DX90 1B55A 2YVCA 4YONA 1K5DB 2VSZA 2DA0A 3U12A 3A58A 1AWEA 1NTYA 2K8EA 1X11A 4B6HA 4HAUB 5L81A 3QWMA 1GC6A 3PVWA 5KCVA 4DXAB 5HE3A 2YT1A 1WJMA 4HAVB 2K2UA 4Z2NA 2OTXA 3ODWA 1P5TA 3KRXA 1V61A 2Q13A 4KAXB 4K17A 5J3QA 3NSUA 2COFA 4GN1A 4HAWB 1WGQA 1FGYA 2M14A 1U5EA 3QBVB 4MK0A 2HTHB 3PVUA 4QJ4B 1FB8A 4HSIA 2G35A 4CHJA 2J0JA 2YS1A 4HATB 1V5MA 3CIKA 3NWAA 2DHIA 2UZRA 4GZUA 1OQNA 4PQ0A 3GYPA 4EJNA 3UZTA 2W2XC 3DXEA 2Y8FA 4K81A 3D8EA 4IAPA 3TW1A 1J0WA 2N0YA 2H7EA 2D9ZA 4K2PA 1LW3A 3KZ1A 2H7DA 4OSNA 4WSFA 2R2YA 3LJUX 4TYZA 1XX0A 1MPHA 1H4RA 1NI2A 1X86A 4NSWA 5GOWB 4C0AA 1MI1A 2Z0QA 3BINA 1UNQA 2EJ8A 3P6AA 2ZPYA 5D3XA 2QKMA 1PFJA 1IRSA 1ZVRA 4F7HA 2LKOA 3BJIA 4GOUA 3IVFA 5LG4B 1E5WA 2GS0A 1BTKA 4A5KA 1OY2A 4WVFB 2IFSA 4DBBA 4F7UP 4HB0B 2I5FA 5DHFB 2EC1A 2L2IA 3AU4A 2LULA 2W2XD 2MKRA 4Z2MB 1KZ7A 3MDBC 2AEHA 2NMBA
chains in the Genus database with same CATH topology
1MKEA 3MPXA 1UPRA 1BTNA 5DI9B 3PG7A 5EFXA 5C79A 1FAOA 1PMSA 5DH9B 4TKNA 4HAXB 3SO6A 2LOZA 2D9XA 1V5UA 1M7EA 1ZSQA 2YS5A 1X1FA 2VRWB 1J19A 3KY9A 1UEFA 3ML4A 1TXDA 2ADZA 5C5BB 1XD4A 4ZRIA 5C5BA 2YS3A 1U5GA 2M38A 2MWNB 2RNRB 1X05A 4NY0A 2Z0PA 1FGZA 1X1GA 3SUZA 3ZVRA 2UZSA 4GPTB 2NZ8B 2MDXA 2KCJA 4GMXB 3GYOA 1DDVA 1FHOA 5HE0A 2BCJA 5JP4A 2DKQA 2Y7BA 1XKEA 2CAYA 2X18A 4MY6A 1V89A 1QC6A 2J59M 1SHCA 1ZC4B 3TO1A 1K5GB 2V76A 4PNKA 4EMOA 2W2WA 4HHVA 4GMVA 2FJLA 3PVLA 3KSYA 5JHGA 1MAIA 3QIJA 1MIZB 2Z0OA 3P7ZA 2P8VA 2K2JA 2I1JA 4YL8A 4KVGB 3VOQA 4A6FB 2OQBA 1TQZA 4HDQA 1RRPB 4HAZB 2ELAA 2N23A 5LOPB 4A6FA 3SYXA 2GCJA 4XWXA 5CLLB 3F0WA 2P0DA 1KZGA 3A8PA 4H8SA 5DIFB 3DXDA 3V5WA 1ZM0A 3ODOA 3WYFB 3N7CA 1QQGA 2QKLA 2LG1A 3AU5A 1UPQA 4KHBB 3WA0A 4Y94A 3FM8C 3X23A 1I7AA 2D11A 1DDWA 2CODA 2D10A 1GC7A 3G9WA 3FEHA 1BAKA 5KQ4A 1WI1A 2VKIA 4WJ7A 1WG7A 3HQCA 1XR0B 3CXBB 5D3WA 1W1DA 2D9VA 2DTCA 2UVMA 2D4QA 2EMSA 5FI0A 2COCA 1BWNA 1AQCA 4HB3B 5J3YA 1H10A 2DX5A 2ROZB 1TJ6A 1Q67A 1U5FA 2RLOA 2LOXA 4IOYX 3VIAA 3A98B 1PLSA 1N3HA 2GJYA 3FSSA 4KHAA 2EMTA 3U7DA 1Y19B 1DROA 3D8FA 4ZRJA 2L1CA 2HE7A 1FHXA 1NU2A 2DHKA 2RUKB 1UNPA 5HE2A 1ZC3B 2DYNA 1EF1A 3D8DA 2I1KA 2CY4A 4HB4B 1P3RA 1WGUA 1WJ1A 4MT7A 2IYBA 2J0KA 1Y5OA 1UNRA 1KI1B 3OANA 3PP2A 3A8QA 4HB2B 5KQ1A 2I5CA 3HW2B 2ROVA 4IFSA 1W1HA 2R0DA 3ODXA 2YRYA 4HDOA 5CLQB 2AL6A 5D27A 5C6RA 4DX8A 1SGHA 1MK7B 2RSGA 1M7RA 3HK0A 1GG3A 1DDMA 4A6KA 1WVHA 1U5DA 2GCLA 1XCGA 4P7IA 1DBHA 2PZ1A 1DYNA 1MK9B 1P6SA 2D2QA 4ZRKA 1OMWA 2RVBB 2YSZA 3F5RA 2CY5A 2DX1A 2R09A 4L6EA 3TFMA 1W1GA 1U29A 3ZDTA 2K00A 2DN6A 2E2XA 3SNHA 2DKPA 4HAYB 2CRFA 3SV1A 4F7GA 4KHOA 4GXBA 4CYEA 5C16A 1EVHA 4EKUA 2RGNB 1EAZA 1V88A 3KRWA 1NTVA 1XODA 2J0MA 4BBKA 1EGXA 2DHJA 3O96A 3PSCA 5D3YA 3T06A 4K2OA 1MIXA 5JLJB 5DHAB 1ISNA 1Z87A 2KGXB 2XQNM 1RJ2A 3M1IB 2DFKA 3AJ4A 1I2HA 2LYDA 2YF0A 2D9WA 2DLWA 1LB1A 1FHWA 3ULCA 4D0NB 5JHHA 1FOEA 1V5PA 3TVVA 2Y8GA 2COAA 2ELBA 2D9YA 3TCAA 5FI1A 2YT0A 3U8ZA 2P0HA 5HE1A 1U27A 3RCPA 3ULBA 5LONB 5D3VA 2KUPA 3PZDA 3PEGA 5J3TA 2DYQA 2P0FA 4A6HA 2JP2A 2MFQA 4CHMA 3DXCA 1U2BA 4DX90 1B55A 2YVCA 4YONA 1K5DB 2VSZA 2DA0A 1AWEA 1NTYA 1X11A 4B6HA 4HAUB 5L81A 3QWMA 1GC6A 3PVWA 5KCVA 4DXAB 5HE3A 2YT1A 1WJMA 4HAVB 2K2UA 4Z2NA 2OTXA 3ODWA 1P5TA 3KRXA 1V61A 2Q13A 4KAXB 4K17A 5J3QA 3NSUA 2COFA 4GN1A 4HAWB 1WGQA 1FGYA 2M14A 1U5EA 3QBVB 4MK0A 2HTHB 3PVUA 1FB8A 2G35A 4CHJA 2J0JA 2YS1A 4HATB 1V5MA 3CIKA 2DHIA 2UZRA 4GZUA 1OQNA 4PQ0A 3GYPA 4EJNA 3UZTA 2W2XC 3DXEA 2Y8FA 4K81A 3D8EA 4IAPA 3TW1A 1J0WA 2N0YA 2H7EA 2D9ZA 4K2PA 1LW3A 3KZ1A 2H7DA 4WSFA 3LJUX 4TYZA 1XX0A 1MPHA 1H4RA 1NI2A 1X86A 4NSWA 5GOWB 4C0AA 2Z0QA 3BINA 1UNQA 2EJ8A 3P6AA 2ZPYA 5D3XA 2QKMA 1PFJA 1IRSA 1ZVRA 4F7HA 2LKOA 3BJIA 3IVFA 1E5WA 2GS0A 1BTKA 4A5KA 1OY2A 4WVFB 2IFSA 4DBBA 4F7UP 4HB0B 2I5FA 5DHFB 2EC1A 2L2IA 3AU4A 2LULA 2W2XD 2MKRA 4Z2MB 1KZ7A 3MDBC 2AEHA 2NMBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MKE A;  3MPX A;  1UPR A;  1BTN A;  5DI9 B;  3PG7 A;  5EFX A;  5C79 A;  1FAO A;  1PMS A;  5DH9 B;  4TKN A;  4HAX B;  3SO6 A;  2LOZ A;  2D9X A;  1V5U A;  1M7E A;  1ZSQ A;  2YS5 A;  1X1F A;  2VRW B;  1J19 A;  3KY9 A;  1UEF A;  3ML4 A;  1TXD A;  2ADZ A;  5C5B B;  1XD4 A;  4ZRI A;  5C5B A;  2YS3 A;  1U5G A;  2M38 A;  2MWN B;  2RNR B;  1X05 A;  4NY0 A;  2Z0P A;  1FGZ A;  1X1G A;  3SUZ A;  3ZVR A;  2UZS A;  4GPT B;  2NZ8 B;  2MDX A;  2KCJ A;  4GMX B;  3GYO A;  1DDV A;  1FHO A;  5HE0 A;  2BCJ A;  5JP4 A;  2DKQ A;  2Y7B A;  1XKE A;  2CAY A;  2X18 A;  4MY6 A;  1V89 A;  1QC6 A;  2J59 M;  1SHC A;  1ZC4 B;  3TO1 A;  1K5G B;  2V76 A;  4PNK A;  4EMO A;  2W2W A;  4HHV A;  4GMV A;  2FJL A;  3PVL A;  3KSY A;  5JHG A;  1MAI A;  3QIJ A;  1MIZ B;  2Z0O A;  3P7Z A;  2P8V A;  2K2J A;  2I1J A;  4YL8 A;  4KVG B;  3VOQ A;  4A6F B;  2OQB A;  1TQZ A;  4HDQ A;  1RRP B;  4HAZ B;  2ELA A;  2N23 A;  5LOP B;  4A6F A;  3SYX A;  2GCJ A;  4XWX A;  5CLL B;  3F0W A;  2P0D A;  1KZG A;  3A8P A;  4H8S A;  5DIF B;  3DXD A;  3V5W A;  1ZM0 A;  3ODO A;  3WYF B;  3N7C A;  1QQG A;  2QKL A;  2LG1 A;  3AU5 A;  1UPQ A;  4KHB B;  3WA0 A;  4Y94 A;  3FM8 C;  3X23 A;  1I7A A;  2D11 A;  1DDW A;  2COD A;  2D10 A;  1GC7 A;  3G9W A;  3FEH A;  1BAK A;  5KQ4 A;  1WI1 A;  2VKI A;  4WJ7 A;  1WG7 A;  3HQC A;  1XR0 B;  3CXB B;  5D3W A;  1W1D A;  2D9V A;  2DTC A;  2UVM A;  2D4Q A;  2EMS A;  5FI0 A;  2COC A;  1BWN A;  1AQC A;  4HB3 B;  5J3Y A;  1H10 A;  2DX5 A;  2ROZ B;  1TJ6 A;  1Q67 A;  1U5F A;  2RLO A;  2LOX A;  4IOY X;  3VIA A;  3A98 B;  1PLS A;  1N3H A;  2GJY A;  3FSS A;  4KHA A;  2EMT A;  3U7D A;  1Y19 B;  1DRO A;  3D8F A;  4ZRJ A;  2L1C A;  2HE7 A;  1FHX A;  1NU2 A;  2DHK A;  2RUK B;  1UNP A;  5HE2 A;  1ZC3 B;  2DYN A;  1EF1 A;  3D8D A;  2I1K A;  2CY4 A;  4HB4 B;  1P3R A;  1WGU A;  1WJ1 A;  4MT7 A;  2IYB A;  2J0K A;  1Y5O A;  1UNR A;  1KI1 B;  3OAN A;  3PP2 A;  3A8Q A;  4HB2 B;  5KQ1 A;  2I5C A;  3HW2 B;  2ROV A;  4IFS A;  1W1H A;  2R0D A;  3ODX A;  2YRY A;  4HDO A;  5CLQ B;  2AL6 A;  5D27 A;  5C6R A;  4DX8 A;  1SGH A;  1MK7 B;  2RSG A;  1M7R A;  3HK0 A;  1GG3 A;  1DDM A;  4A6K A;  1WVH A;  1U5D A;  2GCL A;  1XCG A;  4P7I A;  1DBH A;  2PZ1 A;  1DYN A;  1MK9 B;  1P6S A;  2D2Q A;  4ZRK A;  1OMW A;  2RVB B;  2YSZ A;  3F5R A;  2CY5 A;  2DX1 A;  2R09 A;  4L6E A;  3TFM A;  1W1G A;  1U29 A;  3ZDT A;  2K00 A;  2DN6 A;  2E2X A;  3SNH A;  2DKP A;  4HAY B;  2CRF A;  3SV1 A;  4F7G A;  4KHO A;  4GXB A;  4CYE A;  5C16 A;  1EVH A;  4EKU A;  2RGN B;  1EAZ A;  1V88 A;  3KRW A;  1NTV A;  1XOD A;  2J0M A;  4BBK A;  1EGX A;  2DHJ A;  3O96 A;  3PSC A;  5D3Y A;  3T06 A;  4K2O A;  1MIX A;  5JLJ B;  5DHA B;  1ISN A;  1Z87 A;  2KGX B;  2XQN M;  1RJ2 A;  3M1I B;  2DFK A;  3AJ4 A;  1I2H A;  2LYD A;  2YF0 A;  2D9W A;  2DLW A;  1LB1 A;  1FHW A;  3ULC A;  4D0N B;  5JHH A;  1FOE A;  1V5P A;  3TVV A;  2Y8G A;  2COA A;  2ELB A;  2D9Y A;  3TCA A;  5FI1 A;  2YT0 A;  3U8Z A;  2P0H A;  5HE1 A;  1U27 A;  3RCP A;  3ULB A;  5LON B;  5D3V A;  2KUP A;  3PZD A;  3PEG A;  5J3T A;  2DYQ A;  2P0F A;  4A6H A;  2JP2 A;  2MFQ A;  4CHM A;  3DXC A;  1U2B A;  4DX9 0;  1B55 A;  2YVC A;  4YON A;  1K5D B;  2VSZ A;  2DA0 A;  1AWE A;  1NTY A;  1X11 A;  4B6H A;  4HAU B;  5L81 A;  3QWM A;  1GC6 A;  3PVW A;  5KCV A;  4DXA B;  5HE3 A;  2YT1 A;  1WJM A;  4HAV B;  2K2U A;  4Z2N A;  2OTX A;  3ODW A;  1P5T A;  3KRX A;  1V61 A;  2Q13 A;  4KAX B;  4K17 A;  5J3Q A;  3NSU A;  2COF A;  4GN1 A;  4HAW B;  1WGQ A;  1FGY A;  2M14 A;  1U5E A;  3QBV B;  4MK0 A;  2HTH B;  3PVU A;  1FB8 A;  2G35 A;  4CHJ A;  2J0J A;  2YS1 A;  4HAT B;  1V5M A;  3CIK A;  2DHI A;  2UZR A;  4GZU A;  1OQN A;  4PQ0 A;  3GYP A;  4EJN A;  3UZT A;  2W2X C;  3DXE A;  2Y8F A;  4K81 A;  3D8E A;  4IAP A;  3TW1 A;  1J0W A;  2N0Y A;  2H7E A;  2D9Z A;  4K2P A;  1LW3 A;  3KZ1 A;  2H7D A;  4WSF A;  3LJU X;  4TYZ A;  1XX0 A;  1MPH A;  1H4R A;  1NI2 A;  1X86 A;  4NSW A;  5GOW B;  4C0A A;  2Z0Q A;  3BIN A;  1UNQ A;  2EJ8 A;  3P6A A;  2ZPY A;  5D3X A;  2QKM A;  1PFJ A;  1IRS A;  1ZVR A;  4F7H A;  2LKO A;  3BJI A;  3IVF A;  1E5W A;  2GS0 A;  1BTK A;  4A5K A;  1OY2 A;  4WVF B;  2IFS A;  4DBB A;  4F7U P;  4HB0 B;  2I5F A;  5DHF B;  2EC1 A;  2L2I A;  3AU4 A;  2LUL A;  2W2X D;  2MKR A;  4Z2M B;  1KZ7 A;  3MDB C;  2AEH A;  2NMB A; 
#chains in the Genus database with same CATH topology
 4KHB A;  1MKE A;  3MPX A;  2RRF A;  1UPR A;  1BTN A;  5DI9 B;  3PG7 A;  5EFX A;  5C79 A;  1FAO A;  2ZKM X;  1PMS A;  5DH9 B;  4TKN A;  4HAX B;  3SO6 A;  2LOZ A;  2D9X A;  4QJ5 B;  1V5U A;  1M7E A;  1ZSQ A;  2YS5 A;  1X1F A;  2VRW B;  1J19 A;  3KY9 A;  1UEF A;  3ML4 A;  1TXD A;  2ADZ A;  5C5B B;  5IRS A;  1XD4 A;  4ZRI A;  4QJ3 B;  4QXA B;  2YS3 A;  5C5B A;  1U5G A;  2M38 A;  2MWN B;  2RNR B;  1X05 A;  2Z4D A;  4NY0 A;  3HSA A;  2Z0P A;  1FGZ A;  1X1G A;  3SUZ A;  3ZVR A;  2UZS A;  4GPT B;  2NZ8 B;  2MDX A;  2KCJ A;  4GMX B;  3GYO A;  3HIE A;  1DDV A;  1FHO A;  5HE0 A;  4L1R A;  2BCJ A;  5JP4 A;  2DKQ A;  2Y7B A;  1XKE A;  2CAY A;  2X18 A;  4MY6 A;  1V89 A;  1QC6 A;  2J59 M;  1SHC A;  1ZC4 B;  3TO1 A;  1K5G B;  2V76 A;  4PNK A;  4EMO A;  2Z59 A;  3B77 A;  2W2W A;  4HHV A;  4GMV A;  2FJL A;  2Z14 A;  3PVL A;  3KSY A;  5JHG A;  1MAI A;  3QIJ A;  1MIZ B;  2Z0O A;  2YT2 A;  3P7Z A;  2P8V A;  2K2J A;  3NW8 A;  2I1J A;  4YL8 A;  4KVG B;  3VOQ A;  2FJU B;  4A6F B;  2OQB A;  1TQZ A;  4HDQ A;  1RRP B;  4HAZ B;  2ELA A;  2N23 A;  5LOP B;  4A6F A;  3SYX A;  2GCJ A;  4XWX A;  5CLL B;  3F0W A;  2P0D A;  1KZG A;  3A8P A;  4H8S A;  5DIF B;  3DXD A;  3V5W A;  1ZM0 A;  3ODO A;  3WYF B;  3N7C A;  1QQG A;  4OT1 A;  2QKL A;  2Z13 A;  4GNK B;  2LG1 A;  3AU5 A;  1UPQ A;  4KHB B;  3WA0 A;  4Y94 A;  3FM8 C;  3X23 A;  1I7A A;  2D11 A;  1DDW A;  2COD A;  2D10 A;  1GC7 A;  3G9W A;  3FEH A;  1BAK A;  5KQ4 A;  1WI1 A;  2VKI A;  4WJ7 A;  1WG7 A;  3HQC A;  1XR0 B;  3CXB B;  5D3W A;  1W1D A;  2D9V A;  2DTC A;  2UVM A;  2D4Q A;  2EMS A;  5FI0 A;  2COC A;  1BWN A;  1AQC A;  4HB3 B;  5J3Y A;  1H10 A;  2DX5 A;  4D6W A;  2ROZ B;  1TJ6 A;  1Q67 A;  1U5F A;  2RLO A;  2KR0 A;  2LOX A;  4IOY X;  3VIA A;  3A98 B;  1PLS A;  1N3H A;  2GJY A;  3FSS A;  4KHA A;  2EMT A;  3U7D A;  1Y19 B;  2GUM A;  1DRO A;  3D8F A;  3OHM B;  3DCX A;  4ZRJ A;  2L1C A;  2HE7 A;  1FHX A;  1NU2 A;  2DHK A;  2RUK B;  1UNP A;  5HE2 A;  5I2M A;  1ZC3 B;  2DYN A;  1EF1 A;  3D8D A;  2I1K A;  2CY4 A;  4HB4 B;  1P3R A;  1WGU A;  1WJ1 A;  4MT7 A;  2IYB A;  2J0K A;  1Y5O A;  1UNR A;  1KI1 B;  3OAN A;  3FVC A;  3PP2 A;  3A8Q A;  4HB2 B;  5KQ1 A;  2KUQ A;  2I5C A;  3HW2 B;  2ROV A;  4IFS A;  1W1H A;  2KIE A;  2R0D A;  3NWD A;  3ODX A;  2YRY A;  4HDO A;  5CLQ B;  2AL6 A;  5D27 A;  5C6R A;  4DX8 A;  1SGH A;  1MK7 B;  2RSG A;  1M7R A;  3HK0 A;  1GG3 A;  1DDM A;  4A6K A;  1WVH A;  1U5D A;  3NWF A;  2GCL A;  1XCG A;  4P7I A;  1DBH A;  2PZ1 A;  1DYN A;  1MK9 B;  1P6S A;  2D2Q A;  4ZRK A;  1OMW A;  2RVB B;  2YSZ A;  3F5R A;  2CY5 A;  2DX1 A;  2R09 A;  4L6E A;  3TFM A;  1W1G A;  1U29 A;  3ZDT A;  2K00 A;  2DN6 A;  2E2X A;  3SNH A;  2DKP A;  4HAY B;  2CRF A;  3SV1 A;  4F7G A;  4KHO A;  4GXB A;  4CYE A;  5C16 A;  1EVH A;  4EKU A;  2RGN B;  1EAZ A;  1V88 A;  3KRW A;  1NTV A;  1XOD A;  2J0M A;  4BBK A;  1EGX A;  2DHJ A;  3O96 A;  3PSC A;  5D3Y A;  3T06 A;  4K2O A;  1MIX A;  5JLJ B;  5DHA B;  4CSQ A;  1ISN A;  1Z87 A;  2KGX B;  2XQN M;  1RJ2 A;  3M1I B;  2DFK A;  3AJ4 A;  4DIX A;  1I2H A;  2LYD A;  2YF0 A;  2D9W A;  1T77 A;  2DLW A;  1LB1 A;  5I2S A;  1FHW A;  3ULC A;  2K49 A;  4D0N B;  1FOE A;  5JHH A;  1V5P A;  3TVV A;  2Y8G A;  2COA A;  2NBV A;  2ELB A;  2D9Y A;  3TCA A;  5FI1 A;  2YT0 A;  2KIG A;  3U8Z A;  2P0H A;  5HE1 A;  1U27 A;  3RCP A;  3ULB A;  5LON B;  1ZYI A;  5M4Y B;  5D3V A;  2KUP A;  3PZD A;  3PEG A;  5J3T A;  2DYQ A;  2P0F A;  4A6H A;  2JP2 A;  2MFQ A;  4CHM A;  3DXC A;  1U2B A;  4DX9 0;  1B55 A;  2YVC A;  4YON A;  1K5D B;  2VSZ A;  2DA0 A;  3U12 A;  3A58 A;  1AWE A;  1NTY A;  2K8E A;  1X11 A;  4B6H A;  4HAU B;  5L81 A;  3QWM A;  1GC6 A;  3PVW A;  5KCV A;  4DXA B;  5HE3 A;  2YT1 A;  1WJM A;  4HAV B;  2K2U A;  4Z2N A;  2OTX A;  3ODW A;  1P5T A;  3KRX A;  1V61 A;  2Q13 A;  4KAX B;  4K17 A;  5J3Q A;  3NSU A;  2COF A;  4GN1 A;  4HAW B;  1WGQ A;  1FGY A;  2M14 A;  1U5E A;  3QBV B;  4MK0 A;  2HTH B;  3PVU A;  4QJ4 B;  1FB8 A;  4HSI A;  2G35 A;  4CHJ A;  2J0J A;  2YS1 A;  4HAT B;  1V5M A;  3CIK A;  3NWA A;  2DHI A;  2UZR A;  4GZU A;  1OQN A;  4PQ0 A;  3GYP A;  4EJN A;  3UZT A;  2W2X C;  3DXE A;  2Y8F A;  4K81 A;  3D8E A;  4IAP A;  3TW1 A;  1J0W A;  2N0Y A;  2H7E A;  2D9Z A;  4K2P A;  1LW3 A;  3KZ1 A;  2H7D A;  4OSN A;  4WSF A;  2R2Y A;  3LJU X;  4TYZ A;  1XX0 A;  1MPH A;  1H4R A;  1NI2 A;  1X86 A;  4NSW A;  5GOW B;  4C0A A;  1MI1 A;  2Z0Q A;  3BIN A;  1UNQ A;  2EJ8 A;  3P6A A;  2ZPY A;  5D3X A;  2QKM A;  1PFJ A;  1IRS A;  1ZVR A;  4F7H A;  2LKO A;  3BJI A;  4GOU A;  3IVF A;  5LG4 B;  1E5W A;  2GS0 A;  1BTK A;  4A5K A;  1OY2 A;  4WVF B;  2IFS A;  4DBB A;  4F7U P;  4HB0 B;  2I5F A;  5DHF B;  2EC1 A;  2L2I A;  3AU4 A;  2LUL A;  2W2X D;  2MKR A;  4Z2M B;  1KZ7 A;  3MDB C;  2AEH A;  2NMB A; 
#chains in the Genus database with same CATH homology
 1MKE A;  3MPX A;  1UPR A;  1BTN A;  5DI9 B;  3PG7 A;  5EFX A;  5C79 A;  1FAO A;  1PMS A;  5DH9 B;  4TKN A;  4HAX B;  3SO6 A;  2LOZ A;  2D9X A;  1V5U A;  1M7E A;  1ZSQ A;  2YS5 A;  1X1F A;  2VRW B;  1J19 A;  3KY9 A;  1UEF A;  3ML4 A;  1TXD A;  2ADZ A;  5C5B B;  1XD4 A;  4ZRI A;  5C5B A;  2YS3 A;  1U5G A;  2M38 A;  2MWN B;  2RNR B;  1X05 A;  4NY0 A;  2Z0P A;  1FGZ A;  1X1G A;  3SUZ A;  3ZVR A;  2UZS A;  4GPT B;  2NZ8 B;  2MDX A;  2KCJ A;  4GMX B;  3GYO A;  1DDV A;  1FHO A;  5HE0 A;  2BCJ A;  5JP4 A;  2DKQ A;  2Y7B A;  1XKE A;  2CAY A;  2X18 A;  4MY6 A;  1V89 A;  1QC6 A;  2J59 M;  1SHC A;  1ZC4 B;  3TO1 A;  1K5G B;  2V76 A;  4PNK A;  4EMO A;  2W2W A;  4HHV A;  4GMV A;  2FJL A;  3PVL A;  3KSY A;  5JHG A;  1MAI A;  3QIJ A;  1MIZ B;  2Z0O A;  3P7Z A;  2P8V A;  2K2J A;  2I1J A;  4YL8 A;  4KVG B;  3VOQ A;  4A6F B;  2OQB A;  1TQZ A;  4HDQ A;  1RRP B;  4HAZ B;  2ELA A;  2N23 A;  5LOP B;  4A6F A;  3SYX A;  2GCJ A;  4XWX A;  5CLL B;  3F0W A;  2P0D A;  1KZG A;  3A8P A;  4H8S A;  5DIF B;  3DXD A;  3V5W A;  1ZM0 A;  3ODO A;  3WYF B;  3N7C A;  1QQG A;  2QKL A;  2LG1 A;  3AU5 A;  1UPQ A;  4KHB B;  3WA0 A;  4Y94 A;  3FM8 C;  3X23 A;  1I7A A;  2D11 A;  1DDW A;  2COD A;  2D10 A;  1GC7 A;  3G9W A;  3FEH A;  1BAK A;  5KQ4 A;  1WI1 A;  2VKI A;  4WJ7 A;  1WG7 A;  3HQC A;  1XR0 B;  3CXB B;  5D3W A;  1W1D A;  2D9V A;  2DTC A;  2UVM A;  2D4Q A;  2EMS A;  5FI0 A;  2COC A;  1BWN A;  1AQC A;  4HB3 B;  5J3Y A;  1H10 A;  2DX5 A;  2ROZ B;  1TJ6 A;  1Q67 A;  1U5F A;  2RLO A;  2LOX A;  4IOY X;  3VIA A;  3A98 B;  1PLS A;  1N3H A;  2GJY A;  3FSS A;  4KHA A;  2EMT A;  3U7D A;  1Y19 B;  1DRO A;  3D8F A;  4ZRJ A;  2L1C A;  2HE7 A;  1FHX A;  1NU2 A;  2DHK A;  2RUK B;  1UNP A;  5HE2 A;  1ZC3 B;  2DYN A;  1EF1 A;  3D8D A;  2I1K A;  2CY4 A;  4HB4 B;  1P3R A;  1WGU A;  1WJ1 A;  4MT7 A;  2IYB A;  2J0K A;  1Y5O A;  1UNR A;  1KI1 B;  3OAN A;  3PP2 A;  3A8Q A;  4HB2 B;  5KQ1 A;  2I5C A;  3HW2 B;  2ROV A;  4IFS A;  1W1H A;  2R0D A;  3ODX A;  2YRY A;  4HDO A;  5CLQ B;  2AL6 A;  5D27 A;  5C6R A;  4DX8 A;  1SGH A;  1MK7 B;  2RSG A;  1M7R A;  3HK0 A;  1GG3 A;  1DDM A;  4A6K A;  1WVH A;  1U5D A;  2GCL A;  1XCG A;  4P7I A;  1DBH A;  2PZ1 A;  1DYN A;  1MK9 B;  1P6S A;  2D2Q A;  4ZRK A;  1OMW A;  2RVB B;  2YSZ A;  3F5R A;  2CY5 A;  2DX1 A;  2R09 A;  4L6E A;  3TFM A;  1W1G A;  1U29 A;  3ZDT A;  2K00 A;  2DN6 A;  2E2X A;  3SNH A;  2DKP A;  4HAY B;  2CRF A;  3SV1 A;  4F7G A;  4KHO A;  4GXB A;  4CYE A;  5C16 A;  1EVH A;  4EKU A;  2RGN B;  1EAZ A;  1V88 A;  3KRW A;  1NTV A;  1XOD A;  2J0M A;  4BBK A;  1EGX A;  2DHJ A;  3O96 A;  3PSC A;  5D3Y A;  3T06 A;  4K2O A;  1MIX A;  5JLJ B;  5DHA B;  1ISN A;  1Z87 A;  2KGX B;  2XQN M;  1RJ2 A;  3M1I B;  2DFK A;  3AJ4 A;  1I2H A;  2LYD A;  2YF0 A;  2D9W A;  2DLW A;  1LB1 A;  1FHW A;  3ULC A;  4D0N B;  5JHH A;  1FOE A;  1V5P A;  3TVV A;  2Y8G A;  2COA A;  2ELB A;  2D9Y A;  3TCA A;  5FI1 A;  2YT0 A;  3U8Z A;  2P0H A;  5HE1 A;  1U27 A;  3RCP A;  3ULB A;  5LON B;  5D3V A;  2KUP A;  3PZD A;  3PEG A;  5J3T A;  2DYQ A;  2P0F A;  4A6H A;  2JP2 A;  2MFQ A;  4CHM A;  3DXC A;  1U2B A;  4DX9 0;  1B55 A;  2YVC A;  4YON A;  1K5D B;  2VSZ A;  2DA0 A;  1AWE A;  1NTY A;  1X11 A;  4B6H A;  4HAU B;  5L81 A;  3QWM A;  1GC6 A;  3PVW A;  5KCV A;  4DXA B;  5HE3 A;  2YT1 A;  1WJM A;  4HAV B;  2K2U A;  4Z2N A;  2OTX A;  3ODW A;  1P5T A;  3KRX A;  1V61 A;  2Q13 A;  4KAX B;  4K17 A;  5J3Q A;  3NSU A;  2COF A;  4GN1 A;  4HAW B;  1WGQ A;  1FGY A;  2M14 A;  1U5E A;  3QBV B;  4MK0 A;  2HTH B;  3PVU A;  1FB8 A;  2G35 A;  4CHJ A;  2J0J A;  2YS1 A;  4HAT B;  1V5M A;  3CIK A;  2DHI A;  2UZR A;  4GZU A;  1OQN A;  4PQ0 A;  3GYP A;  4EJN A;  3UZT A;  2W2X C;  3DXE A;  2Y8F A;  4K81 A;  3D8E A;  4IAP A;  3TW1 A;  1J0W A;  2N0Y A;  2H7E A;  2D9Z A;  4K2P A;  1LW3 A;  3KZ1 A;  2H7D A;  4WSF A;  3LJU X;  4TYZ A;  1XX0 A;  1MPH A;  1H4R A;  1NI2 A;  1X86 A;  4NSW A;  5GOW B;  4C0A A;  2Z0Q A;  3BIN A;  1UNQ A;  2EJ8 A;  3P6A A;  2ZPY A;  5D3X A;  2QKM A;  1PFJ A;  1IRS A;  1ZVR A;  4F7H A;  2LKO A;  3BJI A;  3IVF A;  1E5W A;  2GS0 A;  1BTK A;  4A5K A;  1OY2 A;  4WVF B;  2IFS A;  4DBB A;  4F7U P;  4HB0 B;  2I5F A;  5DHF B;  2EC1 A;  2L2I A;  3AU4 A;  2LUL A;  2W2X D;  2MKR A;  4Z2M B;  1KZ7 A;  3MDB C;  2AEH A;  2NMB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...