2Z4DA

Nmr structures of yeast proteasome component rpn13
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
96
structure length
96
Chain Sequence
TVIKFRAGVCEYNEDSRLCTPIPVQGEIEIKPNEEEELGFWDFEWRPTEKPVGRELDPISLILIPGETMWVPIKSSKSGRIFALVFSSNERYFFWL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Proteasome subunit Rpn13 is a novel ubiquitin receptor.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Nuclear protein
molecule keywords 26S proteasome regulatory subunit RPN13
total genus 7
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2007-06-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.70 Mainly Beta Roll PH-domain like PH-domain like 2z4dA00
2KR0A 2Z59A 5IRSA 2Z4DA 2NBVA 2R2YA
chains in the Genus database with same CATH superfamily
5J3YA 2COFA 1Z87A 3SYXA 3A58A 2R09A 1V5UA 2CRFA 2CY5A 4QJ4B 2HE7A 2IYBA 1GG3A 1ISNA 4GNKB 1N3HA 1AQCA 2M14A 5D3XA 2Q13A 3TCAA 4EMOA 5FI0A 2IFSA 2AEHA 1FGZA 4WJ7A 4CSQA 3DCXA 1NTYA 2DHKA 1GC7A 2K2UA 4ZRKA 2YRYA 2Z4DA 1P5TA 1IRSA 1Q67A 1X1GA 4QJ3B 3SNHA 3TW1A 1KI1B 1W1DA 1OQNA 4HDOA 1TQZA 3NWFA 2YS3A 2MWNB 2RSGA 3DXDA 4MK0A 3KRWA 4F7UP 3GYPA 2J0KA 2RGNB 1PLSA 4K81A 1TJ6A 5C5BA 1UNRA 2UVMA 4Z2NA 4HB3B 1I7AA 5KCVA 2K49A 3HIEA 5HE2A 3NWAA 2D9VA 3TVVA 4TKNA 2W2XC 3TO1A 4YONA 2EMSA 4HAXB 4KHOA 1DDVA 4WVFB 2XQNM 2D9XA 5C6RA 2KIEA 1X86A 1M7RA 1XCGA 2JP2A 4HB4B 2D9ZA 1P6SA 1FAOA 2DN6A 4BBKA 2COAA 4L1RA 1OMWA 4CYEA 1UPQA 4HATB 5DIFB 2UZSA 5JHHA 4IAPA 1J0WA 1FB8A 2W2WA 2D4QA 3NSUA 1U2BA 2J59M 3FEHA 2Z13A 1NI2A 2RVBB 2EMTA 1W1HA 2CY4A 1AWEA 4GXBA 2I5CA 1H4RA 3PG7A 2KCJA 3N7CA 4HAYB 4HHVA 5IRSA 1P3RA 3P6AA 2KR0A 1ZVRA 3ODWA 4KAXB 1RRPB 5HE0A 1FOEA 1FHOA 3O96A 4A6FA 3SV1A 1FHXA 2E2XA 4EJNA 5JLJB 3SO6A 1EAZA 4D6WA 5HE3A 4KHAA 2V76A 3QBVB 4K17A 5D3VA 1M7EA 2DX5A 3A8PA 2LYDA 4OT1A 1SHCA 4GOUA 5FI1A 2NMBA 3UZTA 3TFMA 4WSFA 2VSZA 3F0WA 3ULBA 4GPTB 5J3TA 2CODA 1PMSA 2MKRA 2VKIA 1UNQA 1BTKA 4DX8A 2W2XD 2MFQA 3OHMB 3ML4A 3KRXA 5C79A 1BTNA 2YT1A 1T77A 2GCLA 1RJ2A 2KUPA 2ELBA 2YS5A 3AU4A 1MI1A 1UPRA 2H7EA 5CLLB 5C16A 1ZC3B 1PFJA 4GZUA 3PEGA 2VRWB 2LOZA 4KHBB 1WJMA 2RUKB 4DIXA 3KZ1A 3HW2B 1QC6A 3HK0A 2FJUB 4ZRIA 3ODOA 1WI1A 2UZRA 1XD4A 2D10A 4K2OA 5J3QA 1V5MA 2DKQA 2MDXA 5I2MA 3V5WA 3WYFB 2ADZA 1EGXA 3P7ZA 2DHJA 1BAKA 1X05A 1DDMA 4P7IA 3MDBC 2Z0QA 3HQCA 1MIZB 1MIXA 1XODA 3NWDA 3ODXA 1ZYIA 4NSWA 1V88A 2RRFA 1LB1A 1BWNA 2D9WA 1E5WA 4A6HA 3ZVRA 3ULCA 3PVWA 4HSIA 2N23A 4GN1A 4F7HA 4Z2MB 2Y8FA 2YF0A 1MAIA 1WJ1A 1WVHA 4HAUB 2EC1A 2R0DA 2QKLA 4L6EA 5DI9B 2NZ8B 1U5FA 3A8QA 2YS1A 5DHFB 1UEFA 2R2YA 2YVCA 2H7DA 4EKUA 1EF1A 2K00A 1KZGA 4KHBA 4GMVA 1FGYA 2K8EA 1DROA 2Y7BA 3QWMA 2GS0A 2BCJA 2QKMA 2LKOA 3G9WA 3AJ4A 2HTHB 5I2SA 2J0JA 3PSCA 1U29A 2DFKA 4A5KA 1ZSQA 2I5FA 5DHAB 2M38A 2ROZB 1SGHA 3DXEA 2ZPYA 3KY9A 2YT0A 4IOYX 2DYQA 2X18A 2EJ8A 2Z14A 4TYZA 4OSNA 1EVHA 3VOQA 5LG4B 4H8SA 3SUZA 1LW3A 3FSSA 4CHJA 1GC6A 3PP2A 2CAYA 2DYNA 5GOWB 5KQ1A 4A6KA 5D3YA 2GCJA 2PZ1A 4NY0A 1V89A 2COCA 1XKEA 3CIKA 1UNPA 4MY6A 5DH9B 3BINA 2FJLA 1H10A 1Y5OA 2KGXB 3T06A 3U7DA 3QIJA 4QXAB 2D11A 4XWXA 4CHMA 3LJUX 3ZDTA 4IFSA 2J0MA 1I2HA 2I1KA 2YSZA 2OQBA 1U27A 3X23A 2DTCA 1U5GA 5D27A 4HAVB 2KUQA 3KSYA 1XX0A 1NTVA 4HB0B 5KQ4A 3D8DA 1NU2A 1X11A 3AU5A 5JP4A 4K2PA 4D0NB 3OANA 4HAZB 1V61A 1MK9B 2OTXA 5HE1A 2P8VA 2P0HA 3PZDA 4QJ5B 1ZC4B 2D9YA 4GMXB 1WGQA 2LOXA 4MT7A 1V5PA 1K5DB 3DXCA 1K5GB 5LOPB 5C5BB 4DBBA 5M4YB 4KVGB 1X1FA 2GUMA 2I1JA 5D3WA 4HB2B 4PQ0A 3PVUA 2DLWA 1U5DA 3NW8A 3IVFA 2KIGA 3U12A 2NBVA 2Z59A 1U5EA 4ZRJA 1DBHA 2Z0OA 2RNRB 1XR0B 2LG1A 4DXAB 2DHIA 1MPHA 1Y19B 2DA0A 5EFXA 2DKPA 1KZ7A 3FM8C 3BJIA 1ZM0A 2GJYA 2ROVA 3F5RA 1OY2A 5CLQB 2G35A 2YT2A 3GYOA 3M1IB 1MKEA 2K2JA 1QQGA 1W1GA 4A6FB 2ZKMX 2RLOA 2L2IA 3D8FA 1TXDA 5L81A 2AL6A 1DYNA 4DX90 1J19A 2D2QA 2DX1A 1WGUA 4F7GA 3WA0A 3RCPA 4HAWB 1DDWA 3A98B 4PNKA 3U8ZA 3MPXA 5JHGA 2N0YA 4B6HA 3FVCA 3B77A 1WG7A 3D8EA 2Y8GA 3PVLA 4Y94A 2L1CA 2P0FA 5LONB 4C0AA 1FHWA 2P0DA 3VIAA 2LULA 3HSAA 1MK7B 2ELAA 4YL8A 1B55A 3CXBB 4HDQA 2Z0PA
chains in the Genus database with same CATH topology
5M4YB 4IOYX 2KIEA 4OT1A 5IRSA 4GOUA 4Z2MB 2Z14A 2Z4DA 4QXAB 2GUMA 3A58A 4PQ0A 5I2SA 3GYPA 4KHBB 4L1RA 4OSNA 2KR0A 3NW8A 4DIXA 4IFSA 4QJ3B 4QJ4B 5LG4B 4KHAA 3NWDA 2KIGA 3TW1A 3U12A 4QJ5B 2NBVA 3FSSA 3FVCA 4Z2NA 2YT2A 3GYOA 2K49A 2FJUB 4GNKB 3HIEA 2Z59A 1ZYIA 2RRFA 2GCJA 2R2YA 3NWAA 2KUQA 3TVVA 2Z13A 3OHMB 5I2MA 3TO1A 2GCLA 2ZKMX 4KHOA 4D6WA 3NWFA 4KHBA 4CSQA 2K8EA 4HSIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KR0 A;  2Z59 A;  5IRS A;  2Z4D A;  2NBV A;  2R2Y A; 
#chains in the Genus database with same CATH topology
 5J3Y A;  2COF A;  1Z87 A;  3SYX A;  3A58 A;  2R09 A;  1V5U A;  2CRF A;  2CY5 A;  4QJ4 B;  2HE7 A;  2IYB A;  1GG3 A;  1ISN A;  4GNK B;  1N3H A;  1AQC A;  2M14 A;  5D3X A;  2Q13 A;  3TCA A;  4EMO A;  5FI0 A;  2IFS A;  2AEH A;  1FGZ A;  4WJ7 A;  4CSQ A;  3DCX A;  1NTY A;  2DHK A;  1GC7 A;  2K2U A;  4ZRK A;  2YRY A;  2Z4D A;  1P5T A;  1IRS A;  1Q67 A;  1X1G A;  4QJ3 B;  3SNH A;  3TW1 A;  1KI1 B;  1W1D A;  1OQN A;  4HDO A;  1TQZ A;  3NWF A;  2YS3 A;  2MWN B;  2RSG A;  3DXD A;  4MK0 A;  3KRW A;  4F7U P;  3GYP A;  2J0K A;  2RGN B;  1PLS A;  4K81 A;  1TJ6 A;  5C5B A;  1UNR A;  2UVM A;  4Z2N A;  4HB3 B;  1I7A A;  5KCV A;  2K49 A;  3HIE A;  5HE2 A;  3NWA A;  2D9V A;  3TVV A;  4TKN A;  2W2X C;  3TO1 A;  4YON A;  2EMS A;  4HAX B;  4KHO A;  1DDV A;  4WVF B;  2XQN M;  2D9X A;  5C6R A;  2KIE A;  1X86 A;  1M7R A;  1XCG A;  2JP2 A;  4HB4 B;  2D9Z A;  1P6S A;  1FAO A;  2DN6 A;  4BBK A;  2COA A;  4L1R A;  1OMW A;  4CYE A;  1UPQ A;  4HAT B;  5DIF B;  2UZS A;  5JHH A;  4IAP A;  1J0W A;  1FB8 A;  2W2W A;  2D4Q A;  3NSU A;  1U2B A;  2J59 M;  3FEH A;  2Z13 A;  1NI2 A;  2RVB B;  2EMT A;  1W1H A;  2CY4 A;  1AWE A;  4GXB A;  2I5C A;  1H4R A;  3PG7 A;  2KCJ A;  3N7C A;  4HAY B;  4HHV A;  5IRS A;  1P3R A;  3P6A A;  2KR0 A;  1ZVR A;  3ODW A;  4KAX B;  1RRP B;  5HE0 A;  1FOE A;  1FHO A;  3O96 A;  4A6F A;  3SV1 A;  1FHX A;  2E2X A;  4EJN A;  5JLJ B;  3SO6 A;  1EAZ A;  4D6W A;  5HE3 A;  4KHA A;  2V76 A;  3QBV B;  4K17 A;  5D3V A;  1M7E A;  2DX5 A;  3A8P A;  2LYD A;  4OT1 A;  1SHC A;  4GOU A;  5FI1 A;  2NMB A;  3UZT A;  3TFM A;  4WSF A;  2VSZ A;  3F0W A;  3ULB A;  4GPT B;  5J3T A;  2COD A;  1PMS A;  2MKR A;  2VKI A;  1UNQ A;  1BTK A;  4DX8 A;  2W2X D;  2MFQ A;  3OHM B;  3ML4 A;  3KRX A;  5C79 A;  1BTN A;  2YT1 A;  1T77 A;  2GCL A;  1RJ2 A;  2KUP A;  2ELB A;  2YS5 A;  3AU4 A;  1MI1 A;  1UPR A;  2H7E A;  5CLL B;  5C16 A;  1ZC3 B;  1PFJ A;  4GZU A;  3PEG A;  2VRW B;  2LOZ A;  4KHB B;  1WJM A;  2RUK B;  4DIX A;  3KZ1 A;  3HW2 B;  1QC6 A;  3HK0 A;  2FJU B;  4ZRI A;  3ODO A;  1WI1 A;  2UZR A;  1XD4 A;  2D10 A;  4K2O A;  5J3Q A;  1V5M A;  2DKQ A;  2MDX A;  5I2M A;  3V5W A;  3WYF B;  2ADZ A;  1EGX A;  3P7Z A;  2DHJ A;  1BAK A;  1X05 A;  1DDM A;  4P7I A;  3MDB C;  2Z0Q A;  3HQC A;  1MIZ B;  1MIX A;  1XOD A;  3NWD A;  3ODX A;  1ZYI A;  4NSW A;  1V88 A;  2RRF A;  1LB1 A;  1BWN A;  2D9W A;  1E5W A;  4A6H A;  3ZVR A;  3ULC A;  3PVW A;  4HSI A;  2N23 A;  4GN1 A;  4F7H A;  4Z2M B;  2Y8F A;  2YF0 A;  1MAI A;  1WJ1 A;  1WVH A;  4HAU B;  2EC1 A;  2R0D A;  2QKL A;  4L6E A;  5DI9 B;  2NZ8 B;  1U5F A;  3A8Q A;  2YS1 A;  5DHF B;  1UEF A;  2R2Y A;  2YVC A;  2H7D A;  4EKU A;  1EF1 A;  2K00 A;  1KZG A;  4KHB A;  4GMV A;  1FGY A;  2K8E A;  1DRO A;  2Y7B A;  3QWM A;  2GS0 A;  2BCJ A;  2QKM A;  2LKO A;  3G9W A;  3AJ4 A;  2HTH B;  5I2S A;  2J0J A;  3PSC A;  1U29 A;  2DFK A;  4A5K A;  1ZSQ A;  2I5F A;  5DHA B;  2M38 A;  2ROZ B;  1SGH A;  3DXE A;  2ZPY A;  3KY9 A;  2YT0 A;  4IOY X;  2DYQ A;  2X18 A;  2EJ8 A;  2Z14 A;  4TYZ A;  4OSN A;  1EVH A;  3VOQ A;  5LG4 B;  4H8S A;  3SUZ A;  1LW3 A;  3FSS A;  4CHJ A;  1GC6 A;  3PP2 A;  2CAY A;  2DYN A;  5GOW B;  5KQ1 A;  4A6K A;  5D3Y A;  2GCJ A;  2PZ1 A;  4NY0 A;  1V89 A;  2COC A;  1XKE A;  3CIK A;  1UNP A;  4MY6 A;  5DH9 B;  3BIN A;  2FJL A;  1H10 A;  1Y5O A;  2KGX B;  3T06 A;  3U7D A;  3QIJ A;  4QXA B;  2D11 A;  4XWX A;  4CHM A;  3LJU X;  3ZDT A;  4IFS A;  2J0M A;  1I2H A;  2I1K A;  2YSZ A;  2OQB A;  1U27 A;  3X23 A;  2DTC A;  1U5G A;  5D27 A;  4HAV B;  2KUQ A;  3KSY A;  1XX0 A;  1NTV A;  4HB0 B;  5KQ4 A;  3D8D A;  1NU2 A;  1X11 A;  3AU5 A;  5JP4 A;  4K2P A;  4D0N B;  3OAN A;  4HAZ B;  1V61 A;  1MK9 B;  2OTX A;  5HE1 A;  2P8V A;  2P0H A;  3PZD A;  4QJ5 B;  1ZC4 B;  2D9Y A;  4GMX B;  1WGQ A;  2LOX A;  4MT7 A;  1V5P A;  1K5D B;  3DXC A;  1K5G B;  5LOP B;  5C5B B;  4DBB A;  5M4Y B;  4KVG B;  1X1F A;  2GUM A;  2I1J A;  5D3W A;  4HB2 B;  4PQ0 A;  3PVU A;  2DLW A;  1U5D A;  3NW8 A;  3IVF A;  2KIG A;  3U12 A;  2NBV A;  2Z59 A;  1U5E A;  4ZRJ A;  1DBH A;  2Z0O A;  2RNR B;  1XR0 B;  2LG1 A;  4DXA B;  2DHI A;  1MPH A;  1Y19 B;  2DA0 A;  5EFX A;  2DKP A;  1KZ7 A;  3FM8 C;  3BJI A;  1ZM0 A;  2GJY A;  2ROV A;  3F5R A;  1OY2 A;  5CLQ B;  2G35 A;  2YT2 A;  3GYO A;  3M1I B;  1MKE A;  2K2J A;  1QQG A;  1W1G A;  4A6F B;  2ZKM X;  2RLO A;  2L2I A;  3D8F A;  1TXD A;  5L81 A;  2AL6 A;  1DYN A;  4DX9 0;  1J19 A;  2D2Q A;  2DX1 A;  1WGU A;  4F7G A;  3WA0 A;  3RCP A;  4HAW B;  1DDW A;  3A98 B;  4PNK A;  3U8Z A;  3MPX A;  5JHG A;  2N0Y A;  4B6H A;  3FVC A;  3B77 A;  1WG7 A;  3D8E A;  2Y8G A;  3PVL A;  4Y94 A;  2L1C A;  2P0F A;  5LON B;  4C0A A;  1FHW A;  2P0D A;  3VIA A;  2LUL A;  3HSA A;  1MK7 B;  2ELA A;  4YL8 A;  1B55 A;  3CXB B;  4HDQ A;  2Z0P A; 
#chains in the Genus database with same CATH homology
 5M4Y B;  4IOY X;  2KIE A;  4OT1 A;  5IRS A;  4GOU A;  4Z2M B;  2Z14 A;  2Z4D A;  4QXA B;  2GUM A;  3A58 A;  4PQ0 A;  5I2S A;  3GYP A;  4KHB B;  4L1R A;  4OSN A;  2KR0 A;  3NW8 A;  4DIX A;  4IFS A;  4QJ3 B;  4QJ4 B;  5LG4 B;  4KHA A;  3NWD A;  2KIG A;  3TW1 A;  3U12 A;  4QJ5 B;  2NBV A;  3FSS A;  3FVC A;  4Z2N A;  2YT2 A;  3GYO A;  2K49 A;  2FJU B;  4GNK B;  3HIE A;  2Z59 A;  1ZYI A;  2RRF A;  2GCJ A;  2R2Y A;  3NWA A;  2KUQ A;  3TVV A;  2Z13 A;  3OHM B;  5I2M A;  3TO1 A;  2GCL A;  2ZKM X;  4KHO A;  4D6W A;  3NWF A;  4KHB A;  4CSQ A;  2K8E A;  4HSI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...