2Z4DA

Nmr structures of yeast proteasome component rpn13
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
96
structure length
96
Chain Sequence
TVIKFRAGVCEYNEDSRLCTPIPVQGEIEIKPNEEEELGFWDFEWRPTEKPVGRELDPISLILIPGETMWVPIKSSKSGRIFALVFSSNERYFFWL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Proteasome subunit Rpn13 is a novel ubiquitin receptor.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Nuclear protein
molecule keywords 26S proteasome regulatory subunit RPN13
total genus 7
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2007-06-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.70 Mainly Beta Roll PH-domain like PH-domain like 2z4dA00
5IRSA 2KR0A 2NBVA 2Z4DA 2Z59A 2R2YA
chains in the Genus database with same CATH superfamily
2P0FA 3SO6A 2MKRA 1X11A 3FM8C 3V5WA 3PP2A 3ZDTA 2I5FA 1GG3A 2N23A 4CSQA 2COCA 4GPTB 2VKIA 5CLQB 3A58A 1U27A 3MPXA 5FI1A 2KIGA 5M4YB 3B77A 1XX0A 5JLJB 1OMWA 3FVCA 1EF1A 2DYNA 5EFXA 3P7ZA 2ADZA 4P7IA 1ZM0A 5J3QA 2DN6A 2RUKB 3NW8A 1J0WA 2G35A 2MDXA 1XCGA 2DYQA 2Y8FA 4L6EA 4IOYX 5LG4B 2UVMA 2DKPA 3D8DA 3ULCA 1ZYIA 4KVGB 2GJYA 2RRFA 1TXDA 1RRPB 3G9WA 4CYEA 3FSSA 3P6AA 2R09A 4KHAA 3TW1A 4HAYB 1Z87A 4ZRKA 4Z2NA 2W2WA 2D9VA 1MIXA 1FB8A 2DX1A 4EMOA 3DXCA 1W1GA 1XKEA 3PG7A 3HIEA 1PLSA 2K8EA 1IRSA 4Y94A 1U5DA 2YS1A 1V5UA 2W2XC 5HE0A 2YS5A 2DFKA 1NU2A 2GS0A 2EMTA 5DH9B 2I1JA 3D8FA 1U5FA 2DTCA 2Z14A 3AU5A 2YT0A 2Q13A 4CHMA 3KSYA 3TFMA 3U12A 2LOZA 4HDQA 1DDVA 1DBHA 4GXBA 5D3YA 2QKLA 2D9ZA 4K17A 4KHOA 3NWFA 3RCPA 5DHAB 2ELAA 3KZ1A 3FEHA 4ZRIA 2RGNB 4F7HA 2Z0QA 1NTYA 3IVFA 1XR0B 3GYPA 4DXAB 4HB0B 2NMBA 5DI9B 2KUPA 1FHWA 1MPHA 2EJ8A 1ZC4B 1WGQA 2N0YA 1UNQA 3PEGA 2ZPYA 1N3HA 4B6HA 1MKEA 1GC7A 2EMSA 2X18A 1X1FA 4MY6A 3BJIA 5C79A 4MK0A 4K2OA 1H10A 3T06A 2CODA 2YSZA 2UZRA 1DYNA 5LONB 3BINA 3ODOA 4HHVA 2LOXA 2DKQA 3N7CA 2Z4DA 4ZRJA 1K5GB 3X23A 3NSUA 2D10A 1U29A 4D0NB 1MK7B 1FHXA 1W1DA 2M14A 4WSFA 2J0KA 1V5PA 1SHCA 1FOEA 3QWMA 2HE7A 4OT1A 2K49A 3PVUA 4GZUA 1E5WA 1EAZA 5D27A 4HB3B 4A6KA 4TYZA 1Y5OA 5FI0A 1V88A 2GCJA 3HW2B 2KGXB 5C5BB 4BBKA 1LB1A 3PSCA 4NSWA 2IFSA 3U7DA 2I5CA 1WJ1A 3PVLA 4GN1A 3OANA 1MK9B 2RSGA 1NTVA 2DX5A 1EGXA 4L1RA 3NWDA 4CHJA 1ISNA 2K2JA 3U8ZA 1QQGA 2R0DA 2Z0PA 2YF0A 1RJ2A 3KRXA 5J3YA 3SUZA 4WVFB 1WGUA 4HAUB 1PMSA 1KI1B 3SV1A 2P0DA 1T77A 1ZC3B 1X1GA 3TCAA 3ML4A 3ULBA 5GOWB 2Y7BA 4GNKB 4HATB 4WJ7A 1K5DB 4GMVA 5JHHA 2VSZA 4Z2MB 4QXAB 3D8EA 3DCXA 4PQ0A 4OSNA 2CAYA 4C0AA 3AU4A 2AEHA 2HTHB 2M38A 1BWNA 2LG1A 2J59M 4KHBA 3PZDA 1U5GA 2KUQA 2LYDA 2PZ1A 1M7RA 2AL6A 3SNHA 4HB4B 5DIFB 4YL8A 1J19A 5HE3A 1I2HA 5DHFB 3DXDA 2NZ8B 2DA0A 1KZ7A 4H8SA 2KCJA 1P5TA 1LW3A 1DDWA 2COFA 4QJ3B 3OHMB 4KAXB 4DX90 1M7EA 2RLOA 2YRYA 5KQ4A 3UZTA 2D11A 1P6SA 4IFSA 4K81A 1EVHA 2ROZB 3CIKA 1GC6A 3TO1A 3NWAA 5LOPB 1WG7A 1P3RA 1I7AA 1MIZB 2LULA 2D4QA 3SYXA 1V89A 1BTNA 2GUMA 2LKOA 2NBVA 4HB2B 4MT7A 2VRWB 1V61A 2OQBA 2OTXA 1FGZA 2P8VA 5C6RA 2IYBA 1TQZA 1Q67A 2I1KA 5HE2A 3F5RA 3M1IB 4TKNA 1FHOA 4A6FA 1XODA 2FJUB 2XQNM 5KQ1A 2ZKMX 4D6WA 2MWNB 3ODWA 2Z0OA 2CRFA 1KZGA 3KY9A 4YONA 5J3TA 2L2IA 1NI2A 1U5EA 4EKUA 3ODXA 2D9YA 3A8QA 1WI1A 3DXEA 5IRSA 4GOUA 1B55A 5JP4A 2J0MA 3ZVRA 3AJ4A 3HQCA 3KRWA 2MFQA 2JP2A 3HSAA 4IAPA 2RVBB 4QJ4B 2L1CA 5L81A 2E2XA 3WYFB 1OY2A 2Z59A 1ZSQA 4QJ5B 5D3VA 1AWEA 4K2PA 2K2UA 5C16A 3MDBC 1UPQA 2J0JA 1BTKA 2D9WA 2GCLA 5CLLB 4HSIA 1WJMA 2K00A 4EJNA 3CXBB 4F7UP 3QBVB 1H4RA 3F0WA 1WVHA 2Z13A 4DIXA 4NY0A 3PVWA 2KR0A 1BAKA 2H7DA 2YT2A 1MAIA 1UEFA 2R2YA 3QIJA 1FAOA 1UPRA 4A6HA 4A6FB 5I2SA 1V5MA 3HK0A 2CY5A 2ELBA 1AQCA 3LJUX 2FJLA 2D9XA 2YS3A 3VOQA 2DHJA 2COAA 4KHBB 5I2MA 1PFJA 1FGYA 2UZSA 4DBBA 4HAZB 3WA0A 5D3XA 5D3WA 3O96A 1ZVRA 5JHGA 1SGHA 4PNKA 1QC6A 3A98B 1TJ6A 4HAXB 3GYOA 4DX8A 2H7EA 4HAWB 1XD4A 1DDMA 2KIEA 2Y8GA 5HE1A 4XWXA 1X86A 2W2XD 1MI1A 2EC1A 5C5BA 3VIAA 3TVVA 2P0HA 4GMXB 1OQNA 1Y19B 2DHIA 1X05A 4HAVB 4A5KA 4F7GA 2DHKA 2ROVA 1W1HA 2QKMA 2RNRB 2D2QA 2YVCA 1UNPA 2CY4A 3A8PA 5KCVA 2DLWA 2V76A 1UNRA 2YT1A 1U2BA 1DROA 4HDOA 2BCJA
chains in the Genus database with same CATH topology
3TVVA 3NW8A 4QJ3B 4Z2NA 3OHMB 2ZKMX 4KHBB 5I2MA 4D6WA 3U12A 4QJ4B 2Z13A 4DIXA 2GUMA 3TW1A 2KR0A 4KHBA 2NBVA 4CSQA 2KUQA 4IOYX 2YT2A 3HIEA 5LG4B 2Z59A 2R2YA 3A58A 4IFSA 2K49A 2K8EA 4GNKB 3NWFA 4KHOA 4OT1A 4QJ5B 4GOUA 5IRSA 1ZYIA 3GYOA 2RRFA 2KIGA 5I2SA 4Z2MB 5M4YB 4QXAB 4L1RA 3FSSA 2KIEA 3TO1A 3NWDA 3GYPA 3NWAA 2Z4DA 3FVCA 2GCJA 4KHAA 2GCLA 4PQ0A 4OSNA 2Z14A 4HSIA 2FJUB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IRS A;  2KR0 A;  2NBV A;  2Z4D A;  2Z59 A;  2R2Y A; 
#chains in the Genus database with same CATH topology
 2P0F A;  3SO6 A;  2MKR A;  1X11 A;  3FM8 C;  3V5W A;  3PP2 A;  3ZDT A;  2I5F A;  1GG3 A;  2N23 A;  4CSQ A;  2COC A;  4GPT B;  2VKI A;  5CLQ B;  3A58 A;  1U27 A;  3MPX A;  5FI1 A;  2KIG A;  5M4Y B;  3B77 A;  1XX0 A;  5JLJ B;  1OMW A;  3FVC A;  1EF1 A;  2DYN A;  5EFX A;  3P7Z A;  2ADZ A;  4P7I A;  1ZM0 A;  5J3Q A;  2DN6 A;  2RUK B;  3NW8 A;  1J0W A;  2G35 A;  2MDX A;  1XCG A;  2DYQ A;  2Y8F A;  4L6E A;  4IOY X;  5LG4 B;  2UVM A;  2DKP A;  3D8D A;  3ULC A;  1ZYI A;  4KVG B;  2GJY A;  2RRF A;  1TXD A;  1RRP B;  3G9W A;  4CYE A;  3FSS A;  3P6A A;  2R09 A;  4KHA A;  3TW1 A;  4HAY B;  1Z87 A;  4ZRK A;  4Z2N A;  2W2W A;  2D9V A;  1MIX A;  1FB8 A;  2DX1 A;  4EMO A;  3DXC A;  1W1G A;  1XKE A;  3PG7 A;  3HIE A;  1PLS A;  2K8E A;  1IRS A;  4Y94 A;  1U5D A;  2YS1 A;  1V5U A;  2W2X C;  5HE0 A;  2YS5 A;  2DFK A;  1NU2 A;  2GS0 A;  2EMT A;  5DH9 B;  2I1J A;  3D8F A;  1U5F A;  2DTC A;  2Z14 A;  3AU5 A;  2YT0 A;  2Q13 A;  4CHM A;  3KSY A;  3TFM A;  3U12 A;  2LOZ A;  4HDQ A;  1DDV A;  1DBH A;  4GXB A;  5D3Y A;  2QKL A;  2D9Z A;  4K17 A;  4KHO A;  3NWF A;  3RCP A;  5DHA B;  2ELA A;  3KZ1 A;  3FEH A;  4ZRI A;  2RGN B;  4F7H A;  2Z0Q A;  1NTY A;  3IVF A;  1XR0 B;  3GYP A;  4DXA B;  4HB0 B;  2NMB A;  5DI9 B;  2KUP A;  1FHW A;  1MPH A;  2EJ8 A;  1ZC4 B;  1WGQ A;  2N0Y A;  1UNQ A;  3PEG A;  2ZPY A;  1N3H A;  4B6H A;  1MKE A;  1GC7 A;  2EMS A;  2X18 A;  1X1F A;  4MY6 A;  3BJI A;  5C79 A;  4MK0 A;  4K2O A;  1H10 A;  3T06 A;  2COD A;  2YSZ A;  2UZR A;  1DYN A;  5LON B;  3BIN A;  3ODO A;  4HHV A;  2LOX A;  2DKQ A;  3N7C A;  2Z4D A;  4ZRJ A;  1K5G B;  3X23 A;  3NSU A;  2D10 A;  1U29 A;  4D0N B;  1MK7 B;  1FHX A;  1W1D A;  2M14 A;  4WSF A;  2J0K A;  1V5P A;  1SHC A;  1FOE A;  3QWM A;  2HE7 A;  4OT1 A;  2K49 A;  3PVU A;  4GZU A;  1E5W A;  1EAZ A;  5D27 A;  4HB3 B;  4A6K A;  4TYZ A;  1Y5O A;  5FI0 A;  1V88 A;  2GCJ A;  3HW2 B;  2KGX B;  5C5B B;  4BBK A;  1LB1 A;  3PSC A;  4NSW A;  2IFS A;  3U7D A;  2I5C A;  1WJ1 A;  3PVL A;  4GN1 A;  3OAN A;  1MK9 B;  2RSG A;  1NTV A;  2DX5 A;  1EGX A;  4L1R A;  3NWD A;  4CHJ A;  1ISN A;  2K2J A;  3U8Z A;  1QQG A;  2R0D A;  2Z0P A;  2YF0 A;  1RJ2 A;  3KRX A;  5J3Y A;  3SUZ A;  4WVF B;  1WGU A;  4HAU B;  1PMS A;  1KI1 B;  3SV1 A;  2P0D A;  1T77 A;  1ZC3 B;  1X1G A;  3TCA A;  3ML4 A;  3ULB A;  5GOW B;  2Y7B A;  4GNK B;  4HAT B;  4WJ7 A;  1K5D B;  4GMV A;  5JHH A;  2VSZ A;  4Z2M B;  4QXA B;  3D8E A;  3DCX A;  4PQ0 A;  4OSN A;  2CAY A;  4C0A A;  3AU4 A;  2AEH A;  2HTH B;  2M38 A;  1BWN A;  2LG1 A;  2J59 M;  4KHB A;  3PZD A;  1U5G A;  2KUQ A;  2LYD A;  2PZ1 A;  1M7R A;  2AL6 A;  3SNH A;  4HB4 B;  5DIF B;  4YL8 A;  1J19 A;  5HE3 A;  1I2H A;  5DHF B;  3DXD A;  2NZ8 B;  2DA0 A;  1KZ7 A;  4H8S A;  2KCJ A;  1P5T A;  1LW3 A;  1DDW A;  2COF A;  4QJ3 B;  3OHM B;  4KAX B;  4DX9 0;  1M7E A;  2RLO A;  2YRY A;  5KQ4 A;  3UZT A;  2D11 A;  1P6S A;  4IFS A;  4K81 A;  1EVH A;  2ROZ B;  3CIK A;  1GC6 A;  3TO1 A;  3NWA A;  5LOP B;  1WG7 A;  1P3R A;  1I7A A;  1MIZ B;  2LUL A;  2D4Q A;  3SYX A;  1V89 A;  1BTN A;  2GUM A;  2LKO A;  2NBV A;  4HB2 B;  4MT7 A;  2VRW B;  1V61 A;  2OQB A;  2OTX A;  1FGZ A;  2P8V A;  5C6R A;  2IYB A;  1TQZ A;  1Q67 A;  2I1K A;  5HE2 A;  3F5R A;  3M1I B;  4TKN A;  1FHO A;  4A6F A;  1XOD A;  2FJU B;  2XQN M;  5KQ1 A;  2ZKM X;  4D6W A;  2MWN B;  3ODW A;  2Z0O A;  2CRF A;  1KZG A;  3KY9 A;  4YON A;  5J3T A;  2L2I A;  1NI2 A;  1U5E A;  4EKU A;  3ODX A;  2D9Y A;  3A8Q A;  1WI1 A;  3DXE A;  5IRS A;  4GOU A;  1B55 A;  5JP4 A;  2J0M A;  3ZVR A;  3AJ4 A;  3HQC A;  3KRW A;  2MFQ A;  2JP2 A;  3HSA A;  4IAP A;  2RVB B;  4QJ4 B;  2L1C A;  5L81 A;  2E2X A;  3WYF B;  1OY2 A;  2Z59 A;  1ZSQ A;  4QJ5 B;  5D3V A;  1AWE A;  4K2P A;  2K2U A;  5C16 A;  3MDB C;  1UPQ A;  2J0J A;  1BTK A;  2D9W A;  2GCL A;  5CLL B;  4HSI A;  1WJM A;  2K00 A;  4EJN A;  3CXB B;  4F7U P;  3QBV B;  1H4R A;  3F0W A;  1WVH A;  2Z13 A;  4DIX A;  4NY0 A;  3PVW A;  2KR0 A;  1BAK A;  2H7D A;  2YT2 A;  1MAI A;  1UEF A;  2R2Y A;  3QIJ A;  1FAO A;  1UPR A;  4A6H A;  4A6F B;  5I2S A;  1V5M A;  3HK0 A;  2CY5 A;  2ELB A;  1AQC A;  3LJU X;  2FJL A;  2D9X A;  2YS3 A;  3VOQ A;  2DHJ A;  2COA A;  4KHB B;  5I2M A;  1PFJ A;  1FGY A;  2UZS A;  4DBB A;  4HAZ B;  3WA0 A;  5D3X A;  5D3W A;  3O96 A;  1ZVR A;  5JHG A;  1SGH A;  4PNK A;  1QC6 A;  3A98 B;  1TJ6 A;  4HAX B;  3GYO A;  4DX8 A;  2H7E A;  4HAW B;  1XD4 A;  1DDM A;  2KIE A;  2Y8G A;  5HE1 A;  4XWX A;  1X86 A;  2W2X D;  1MI1 A;  2EC1 A;  5C5B A;  3VIA A;  3TVV A;  2P0H A;  4GMX B;  1OQN A;  1Y19 B;  2DHI A;  1X05 A;  4HAV B;  4A5K A;  4F7G A;  2DHK A;  2ROV A;  1W1H A;  2QKM A;  2RNR B;  2D2Q A;  2YVC A;  1UNP A;  2CY4 A;  3A8P A;  5KCV A;  2DLW A;  2V76 A;  1UNR A;  2YT1 A;  1U2B A;  1DRO A;  4HDO A;  2BCJ A; 
#chains in the Genus database with same CATH homology
 3TVV A;  3NW8 A;  4QJ3 B;  4Z2N A;  3OHM B;  2ZKM X;  4KHB B;  5I2M A;  4D6W A;  3U12 A;  4QJ4 B;  2Z13 A;  4DIX A;  2GUM A;  3TW1 A;  2KR0 A;  4KHB A;  2NBV A;  4CSQ A;  2KUQ A;  4IOY X;  2YT2 A;  3HIE A;  5LG4 B;  2Z59 A;  2R2Y A;  3A58 A;  4IFS A;  2K49 A;  2K8E A;  4GNK B;  3NWF A;  4KHO A;  4OT1 A;  4QJ5 B;  4GOU A;  5IRS A;  1ZYI A;  3GYO A;  2RRF A;  2KIG A;  5I2S A;  4Z2M B;  5M4Y B;  4QXA B;  4L1R A;  3FSS A;  2KIE A;  3TO1 A;  3NWD A;  3GYP A;  3NWA A;  2Z4D A;  3FVC A;  2GCJ A;  4KHA A;  2GCL A;  4PQ0 A;  4OSN A;  2Z14 A;  4HSI A;  2FJU B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...