2Z4DA

Nmr structures of yeast proteasome component rpn13
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
96
structure length
96
Chain Sequence
TVIKFRAGVCEYNEDSRLCTPIPVQGEIEIKPNEEEELGFWDFEWRPTEKPVGRELDPISLILIPGETMWVPIKSSKSGRIFALVFSSNERYFFWL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Nuclear protein
molecule keywords 26S proteasome regulatory subunit RPN13
publication title Proteasome subunit Rpn13 is a novel ubiquitin receptor.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 7
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2007-06-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.70 Mainly Beta Roll PH-domain like PH-domain like 2z4dA00
2NBVA 2Z59A 2R2YA 2Z4DA 5IRSA 2KR0A
chains in the Genus database with same CATH superfamily
3A58A 1I7AA 1FHXA 2N0YA 2PZ1A 4D6WA 2I1KA 2X18A 2VKIA 2J0MA 3VOQA 2D10A 1GG3A 3LJUX 4ZRJA 2J0KA 2Z0OA 4Z2NA 4CYEA 2Z13A 4HAWB 1H4RA 4MK0A 2E2XA 2P8VA 1ZC4B 3O96A 1NU2A 4HAXB 3F5RA 4Y94A 1UNPA 1U5DA 4WVFB 1Y19B 1P6SA 2AEHA 5FI1A 1K5DB 1NTYA 1WJMA 4IAPA 4QJ4B 2DHKA 3ODOA 2M14A 5JLJB 1MK7B 2YT2A 3SO6A 5IRSA 3OANA 4KHOA 4C0AA 4HB0B 4GN1A 1X05A 1UPRA 3U7DA 5D27A 2K2JA 2DKQA 4Z2MB 3ODWA 4GXBA 2J0JA 2MDXA 2HE7A 3A98B 1DDMA 4HDQA 2MKRA 2DLWA 1FGZA 1FHWA 1XR0B 3PEGA 4NSWA 5C6RA 2N23A 2CAYA 2VSZA 2DTCA 2GS0A 5KQ4A 2EJ8A 3SNHA 4DIXA 2Z14A 4NY0A 3NWAA 4GPTB 2W2XC 2P0FA 3KY9A 5DHFB 4HB2B 4IOYX 1Z87A 1FB8A 3GYPA 2R09A 2D11A 2YT0A 1MI1A 2R2YA 3SUZA 2DX5A 4TYZA 1XD4A 1ZC3B 2R0DA 2YS3A 4EKUA 4CHMA 1P3RA 5GOWB 3DXEA 3ULCA 1ZSQA 3GYOA 2VRWB 5C5BA 1E5WA 3D8FA 1TQZA 4KHBA 3KRWA 3HIEA 3PZDA 4HAZB 3D8DA 4A6HA 2K2UA 1U27A 3X23A 1SHCA 1RRPB 2NZ8B 4OSNA 1KZ7A 4HB3B 1MK9B 1SGHA 5D3XA 5HE1A 3HK0A 2GUMA 3CXBB 1XKEA 1W1GA 2FJLA 1UNRA 3DXDA 5D3YA 3ZDTA 2YS5A 5D3VA 2YRYA 4HHVA 2IYBA 3OHMB 2Q13A 5DI9B 1XODA 2I5FA 2D9YA 3BJIA 2V76A 2EC1A 5HE3A 4ZRKA 3CIKA 1FHOA 4K2PA 3ZVRA 4EJNA 1XCGA 4DBBA 5HE0A 2DYQA 1WGQA 1H10A 2Y7BA 2DKPA 1V89A 2GJYA 3TVVA 5M4YB 3BINA 5J3QA 3KSYA 4HB4B 2COFA 1GC7A 5D3WA 3QWMA 3U8ZA 1EF1A 1Y5OA 2Y8GA 2I1JA 1FAOA 5I2SA 2FJUB 1B55A 1U29A 2YT1A 2D9XA 2Z0QA 2RNRB 2L1CA 4K17A 5LONB 2W2WA 2LG1A 1DDVA 5JP4A 2KR0A 1TXDA 2M38A 1P5TA 4A5KA 4HAVB 2QKMA 4TKNA 1UPQA 2CODA 1W1HA 2H7EA 2UZSA 3PVUA 3V5WA 4MY6A 4GOUA 1U5FA 1OMWA 1V5UA 2D9ZA 2GCLA 4K81A 4GNKB 4OT1A 5EFXA 4CHJA 1ZVRA 1U2BA 1U5GA 2CY4A 3PP2A 5JHHA 4HSIA 4HAYB 1PFJA 4B6HA 1EGXA 3A8QA 3PVLA 2D4QA 1X11A 2DFKA 2MFQA 1AWEA 3ODXA 2P0HA 4L6EA 3FSSA 1BWNA 2AL6A 2CRFA 1XX0A 2NBVA 1NTVA 3NWDA 3TCAA 2D9WA 4WJ7A 5C16A 1M7EA 2LOXA 5I2MA 1BAKA 3QBVB 4XWXA 1NI2A 3P6AA 4WSFA 4YONA 2GCJA 4A6FB 4PNKA 3DXCA 3TFMA 2DN6A 2UVMA 3A8PA 3AU5A 1X86A 1LB1A 4EMOA 2D9VA 3MPXA 3PVWA 1T77A 2ZKMX 5HE2A 1K5GB 2KGXB 5J3TA 2K49A 5L81A 4DXAB 1MKEA 2ROVA 1WI1A 4QXAB 2ELBA 2LULA 2LOZA 5DIFB 3VIAA 2OTXA 2YVCA 1ZYIA 2NMBA 2ROZB 2LKOA 3F0WA 3B77A 2KUQA 2D2QA 1FGYA 3G9WA 3N7CA 1ZM0A 1WGUA 3AU4A 2Z4DA 4L1RA 3NSUA 4ZRIA 4DX8A 3WA0A 4D0NB 3QIJA 1FOEA 5KQ1A 1WG7A 2CY5A 1OQNA 4CSQA 1MIZB 4BBKA 3U12A 2K8EA 1MIXA 2RSGA 3P7ZA 4HDOA 4GMXB 1IRSA 2DX1A 3DCXA 1Q67A 3FVCA 4A6KA 4YL8A 5C79A 2G35A 2OQBA 2DA0A 3D8EA 3HW2B 3TO1A 3NW8A 1M7RA 1DROA 1BTKA 3HSAA 2QKLA 2ZPYA 1QQGA 5JHGA 5LOPB 2EMSA 2JP2A 4IFSA 2Z59A 1EAZA 2ELAA 4GZUA 1KZGA 2COAA 5J3YA 1ISNA 4K2OA 5DHAB 2YSZA 4QJ3B 2K00A 2I5CA 1N3HA 2MWNB 2EMTA 3SYXA 1PLSA 4A6FA 2Z0PA 2RRFA 3RCPA 4F7UP 4MT7A 2HTHB 1J19A 1X1FA 1EVHA 3NWFA 2L2IA 1DDWA 1UEFA 4KVGB 3FM8C 1X1GA 3PSCA 4DX90 3M1IB 2UZRA 1BTNA 3IVFA 3KZ1A 4P7IA 1W1DA 2YS1A 5CLQB 2KUPA 3ULBA 1KI1B 1V88A 3FEHA 3AJ4A 4KHAA 3WYFB 4PQ0A 1V5MA 2BCJA 3ML4A 4QJ5B 3HQCA 3TW1A 2DHJA 2LYDA 5DH9B 2DYNA 4HATB 2YF0A 1J0WA 1AQCA 1U5EA 2KIEA 3SV1A 3KRXA 1V61A 4F7HA 2J59M 2RGNB 4HAUB 1PMSA 1WJ1A 5CLLB 3PG7A 1DYNA 2KIGA 2W2XD 2KCJA 1MPHA 1LW3A 1WVHA 1UNQA 2COCA 4F7GA 3UZTA 1RJ2A 1V5PA 2RLOA 1MAIA 3T06A 2Y8FA 2ADZA 2DHIA 2IFSA 5C5BB 4GMVA 2XQNM 1QC6A 3MDBC 1GC6A 4KAXB 1I2HA 2RVBB 4KHBB 2P0DA 2H7DA 5KCVA 2RUKB 4H8SA 5LG4B 5FI0A 1DBHA 1TJ6A 1OY2A
chains in the Genus database with same CATH topology
3A58A 4HSIA 5M4YB 4D6WA 3OHMB 1ZYIA 2R2YA 4CSQA 4QJ4B 3U12A 4QJ3B 2KIGA 4IFSA 2KUQA 2Z59A 4OSNA 2RRFA 2K8EA 4KHAA 4GOUA 3FSSA 2YT2A 4PQ0A 5IRSA 5I2SA 2FJUB 2NBVA 3FVCA 3GYOA 3NWFA 4KHOA 2ZKMX 2GCLA 2GUMA 2Z14A 3NWDA 3NWAA 4DIXA 4Z2NA 4KHBB 2K49A 2Z13A 2Z4DA 4L1RA 2GCJA 4GNKB 4OT1A 4QJ5B 3TW1A 5I2MA 3TO1A 3NW8A 4KHBA 4Z2MB 3HIEA 4IOYX 5LG4B 4QXAB 2KIEA 3GYPA 2KR0A 3TVVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NBV A;  2Z59 A;  2R2Y A;  2Z4D A;  5IRS A;  2KR0 A; 
#chains in the Genus database with same CATH topology
 3A58 A;  1I7A A;  1FHX A;  2N0Y A;  2PZ1 A;  4D6W A;  2I1K A;  2X18 A;  2VKI A;  2J0M A;  3VOQ A;  2D10 A;  1GG3 A;  3LJU X;  4ZRJ A;  2J0K A;  2Z0O A;  4Z2N A;  4CYE A;  2Z13 A;  4HAW B;  1H4R A;  4MK0 A;  2E2X A;  2P8V A;  1ZC4 B;  3O96 A;  1NU2 A;  4HAX B;  3F5R A;  4Y94 A;  1UNP A;  1U5D A;  4WVF B;  1Y19 B;  1P6S A;  2AEH A;  5FI1 A;  1K5D B;  1NTY A;  1WJM A;  4IAP A;  4QJ4 B;  2DHK A;  3ODO A;  2M14 A;  5JLJ B;  1MK7 B;  2YT2 A;  3SO6 A;  5IRS A;  3OAN A;  4KHO A;  4C0A A;  4HB0 B;  4GN1 A;  1X05 A;  1UPR A;  3U7D A;  5D27 A;  2K2J A;  2DKQ A;  4Z2M B;  3ODW A;  4GXB A;  2J0J A;  2MDX A;  2HE7 A;  3A98 B;  1DDM A;  4HDQ A;  2MKR A;  2DLW A;  1FGZ A;  1FHW A;  1XR0 B;  3PEG A;  4NSW A;  5C6R A;  2N23 A;  2CAY A;  2VSZ A;  2DTC A;  2GS0 A;  5KQ4 A;  2EJ8 A;  3SNH A;  4DIX A;  2Z14 A;  4NY0 A;  3NWA A;  4GPT B;  2W2X C;  2P0F A;  3KY9 A;  5DHF B;  4HB2 B;  4IOY X;  1Z87 A;  1FB8 A;  3GYP A;  2R09 A;  2D11 A;  2YT0 A;  1MI1 A;  2R2Y A;  3SUZ A;  2DX5 A;  4TYZ A;  1XD4 A;  1ZC3 B;  2R0D A;  2YS3 A;  4EKU A;  4CHM A;  1P3R A;  5GOW B;  3DXE A;  3ULC A;  1ZSQ A;  3GYO A;  2VRW B;  5C5B A;  1E5W A;  3D8F A;  1TQZ A;  4KHB A;  3KRW A;  3HIE A;  3PZD A;  4HAZ B;  3D8D A;  4A6H A;  2K2U A;  1U27 A;  3X23 A;  1SHC A;  1RRP B;  2NZ8 B;  4OSN A;  1KZ7 A;  4HB3 B;  1MK9 B;  1SGH A;  5D3X A;  5HE1 A;  3HK0 A;  2GUM A;  3CXB B;  1XKE A;  1W1G A;  2FJL A;  1UNR A;  3DXD A;  5D3Y A;  3ZDT A;  2YS5 A;  5D3V A;  2YRY A;  4HHV A;  2IYB A;  3OHM B;  2Q13 A;  5DI9 B;  1XOD A;  2I5F A;  2D9Y A;  3BJI A;  2V76 A;  2EC1 A;  5HE3 A;  4ZRK A;  3CIK A;  1FHO A;  4K2P A;  3ZVR A;  4EJN A;  1XCG A;  4DBB A;  5HE0 A;  2DYQ A;  1WGQ A;  1H10 A;  2Y7B A;  2DKP A;  1V89 A;  2GJY A;  3TVV A;  5M4Y B;  3BIN A;  5J3Q A;  3KSY A;  4HB4 B;  2COF A;  1GC7 A;  5D3W A;  3QWM A;  3U8Z A;  1EF1 A;  1Y5O A;  2Y8G A;  2I1J A;  1FAO A;  5I2S A;  2FJU B;  1B55 A;  1U29 A;  2YT1 A;  2D9X A;  2Z0Q A;  2RNR B;  2L1C A;  4K17 A;  5LON B;  2W2W A;  2LG1 A;  1DDV A;  5JP4 A;  2KR0 A;  1TXD A;  2M38 A;  1P5T A;  4A5K A;  4HAV B;  2QKM A;  4TKN A;  1UPQ A;  2COD A;  1W1H A;  2H7E A;  2UZS A;  3PVU A;  3V5W A;  4MY6 A;  4GOU A;  1U5F A;  1OMW A;  1V5U A;  2D9Z A;  2GCL A;  4K81 A;  4GNK B;  4OT1 A;  5EFX A;  4CHJ A;  1ZVR A;  1U2B A;  1U5G A;  2CY4 A;  3PP2 A;  5JHH A;  4HSI A;  4HAY B;  1PFJ A;  4B6H A;  1EGX A;  3A8Q A;  3PVL A;  2D4Q A;  1X11 A;  2DFK A;  2MFQ A;  1AWE A;  3ODX A;  2P0H A;  4L6E A;  3FSS A;  1BWN A;  2AL6 A;  2CRF A;  1XX0 A;  2NBV A;  1NTV A;  3NWD A;  3TCA A;  2D9W A;  4WJ7 A;  5C16 A;  1M7E A;  2LOX A;  5I2M A;  1BAK A;  3QBV B;  4XWX A;  1NI2 A;  3P6A A;  4WSF A;  4YON A;  2GCJ A;  4A6F B;  4PNK A;  3DXC A;  3TFM A;  2DN6 A;  2UVM A;  3A8P A;  3AU5 A;  1X86 A;  1LB1 A;  4EMO A;  2D9V A;  3MPX A;  3PVW A;  1T77 A;  2ZKM X;  5HE2 A;  1K5G B;  2KGX B;  5J3T A;  2K49 A;  5L81 A;  4DXA B;  1MKE A;  2ROV A;  1WI1 A;  4QXA B;  2ELB A;  2LUL A;  2LOZ A;  5DIF B;  3VIA A;  2OTX A;  2YVC A;  1ZYI A;  2NMB A;  2ROZ B;  2LKO A;  3F0W A;  3B77 A;  2KUQ A;  2D2Q A;  1FGY A;  3G9W A;  3N7C A;  1ZM0 A;  1WGU A;  3AU4 A;  2Z4D A;  4L1R A;  3NSU A;  4ZRI A;  4DX8 A;  3WA0 A;  4D0N B;  3QIJ A;  1FOE A;  5KQ1 A;  1WG7 A;  2CY5 A;  1OQN A;  4CSQ A;  1MIZ B;  4BBK A;  3U12 A;  2K8E A;  1MIX A;  2RSG A;  3P7Z A;  4HDO A;  4GMX B;  1IRS A;  2DX1 A;  3DCX A;  1Q67 A;  3FVC A;  4A6K A;  4YL8 A;  5C79 A;  2G35 A;  2OQB A;  2DA0 A;  3D8E A;  3HW2 B;  3TO1 A;  3NW8 A;  1M7R A;  1DRO A;  1BTK A;  3HSA A;  2QKL A;  2ZPY A;  1QQG A;  5JHG A;  5LOP B;  2EMS A;  2JP2 A;  4IFS A;  2Z59 A;  1EAZ A;  2ELA A;  4GZU A;  1KZG A;  2COA A;  5J3Y A;  1ISN A;  4K2O A;  5DHA B;  2YSZ A;  4QJ3 B;  2K00 A;  2I5C A;  1N3H A;  2MWN B;  2EMT A;  3SYX A;  1PLS A;  4A6F A;  2Z0P A;  2RRF A;  3RCP A;  4F7U P;  4MT7 A;  2HTH B;  1J19 A;  1X1F A;  1EVH A;  3NWF A;  2L2I A;  1DDW A;  1UEF A;  4KVG B;  3FM8 C;  1X1G A;  3PSC A;  4DX9 0;  3M1I B;  2UZR A;  1BTN A;  3IVF A;  3KZ1 A;  4P7I A;  1W1D A;  2YS1 A;  5CLQ B;  2KUP A;  3ULB A;  1KI1 B;  1V88 A;  3FEH A;  3AJ4 A;  4KHA A;  3WYF B;  4PQ0 A;  1V5M A;  2BCJ A;  3ML4 A;  4QJ5 B;  3HQC A;  3TW1 A;  2DHJ A;  2LYD A;  5DH9 B;  2DYN A;  4HAT B;  2YF0 A;  1J0W A;  1AQC A;  1U5E A;  2KIE A;  3SV1 A;  3KRX A;  1V61 A;  4F7H A;  2J59 M;  2RGN B;  4HAU B;  1PMS A;  1WJ1 A;  5CLL B;  3PG7 A;  1DYN A;  2KIG A;  2W2X D;  2KCJ A;  1MPH A;  1LW3 A;  1WVH A;  1UNQ A;  2COC A;  4F7G A;  3UZT A;  1RJ2 A;  1V5P A;  2RLO A;  1MAI A;  3T06 A;  2Y8F A;  2ADZ A;  2DHI A;  2IFS A;  5C5B B;  4GMV A;  2XQN M;  1QC6 A;  3MDB C;  1GC6 A;  4KAX B;  1I2H A;  2RVB B;  4KHB B;  2P0D A;  2H7D A;  5KCV A;  2RUK B;  4H8S A;  5LG4 B;  5FI0 A;  1DBH A;  1TJ6 A;  1OY2 A; 
#chains in the Genus database with same CATH homology
 3A58 A;  4HSI A;  5M4Y B;  4D6W A;  3OHM B;  1ZYI A;  2R2Y A;  4CSQ A;  4QJ4 B;  3U12 A;  4QJ3 B;  2KIG A;  4IFS A;  2KUQ A;  2Z59 A;  4OSN A;  2RRF A;  2K8E A;  4KHA A;  4GOU A;  3FSS A;  2YT2 A;  4PQ0 A;  5IRS A;  5I2S A;  2FJU B;  2NBV A;  3FVC A;  3GYO A;  3NWF A;  4KHO A;  2ZKM X;  2GCL A;  2GUM A;  2Z14 A;  3NWD A;  3NWA A;  4DIX A;  4Z2N A;  4KHB B;  2K49 A;  2Z13 A;  2Z4D A;  4L1R A;  2GCJ A;  4GNK B;  4OT1 A;  4QJ5 B;  3TW1 A;  5I2M A;  3TO1 A;  3NW8 A;  4KHB A;  4Z2M B;  3HIE A;  4IOY X;  5LG4 B;  4QXA B;  2KIE A;  3GYP A;  2KR0 A;  3TVV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...