2Z4DA

Nmr structures of yeast proteasome component rpn13
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
96
structure length
96
Chain Sequence
TVIKFRAGVCEYNEDSRLCTPIPVQGEIEIKPNEEEELGFWDFEWRPTEKPVGRELDPISLILIPGETMWVPIKSSKSGRIFALVFSSNERYFFWL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 26S proteasome regulatory subunit RPN13
publication title Proteasome subunit Rpn13 is a novel ubiquitin receptor.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Nuclear protein
total genus 7
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2007-06-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.70 Mainly Beta Roll PH-domain like PH-domain like 2z4dA00
2R2YA 2Z59A 2NBVA 2KR0A 2Z4DA 5IRSA
chains in the Genus database with same CATH superfamily
4GMXB 5C79A 1WVHA 1X11A 2KGXB 2K49A 1AWEA 4K2PA 1NU2A 2Q13A 4DXAB 1GG3A 3QBVB 1Q67A 3FSSA 3FVCA 1AQCA 4EMOA 2COAA 3DCXA 1BAKA 1P6SA 2NZ8B 2VKIA 2RLOA 3DXCA 4D6WA 1QQGA 1TQZA 2NBVA 4HDQA 2H7EA 1ZC3B 2OQBA 2Y7BA 1Z87A 2YT2A 5I2SA 1IRSA 1NTVA 4ZRIA 5EFXA 5JLJB 3ULBA 5I2MA 2AEHA 2D9ZA 1J19A 1KZ7A 3P7ZA 3PVWA 2D11A 3PVUA 1MIXA 1PMSA 2KCJA 2ZKMX 4WSFA 1TXDA 2J0MA 3KRWA 2M14A 1EVHA 3KZ1A 1SHCA 3AU4A 4GPTB 4XWXA 5DHAB 2GCJA 3CIKA 4DX90 2J0KA 2W2WA 2BCJA 1V61A 2JP2A 2D2QA 5LONB 4KHOA 1XKEA 3SNHA 2H7DA 1ISNA 2MFQA 2ELAA 1WG7A 3ODWA 5D27A 5M4YB 4GN1A 3PZDA 4GZUA 5J3TA 2GUMA 1FGYA 5LG4B 1XODA 2FJLA 4CYEA 2YS5A 3GYOA 2UZSA 2YF0A 5KQ1A 2DN6A 2P0HA 4Y94A 3ODXA 2MWNB 1FHOA 3A58A 3MDBC 3DXEA 1DYNA 2YVCA 3UZTA 1W1DA 3SUZA 3PSCA 2LOXA 3SYXA 1QC6A 1K5GB 1I7AA 1MPHA 3WYFB 5DH9B 2RRFA 1EAZA 2Z4DA 4Z2NA 1MIZB 2P8VA 1UNRA 4IAPA 4WJ7A 3V5WA 4HAWB 1ZYIA 1NTYA 2LKOA 1OY2A 3O96A 3MPXA 5D3XA 5FI1A 2P0DA 2ROVA 2NMBA 2K8EA 3P6AA 2LOZA 1PLSA 1H10A 2L2IA 2QKLA 4QJ5B 5C5BA 5J3YA 1J0WA 2K00A 3BJIA 2LULA 2X18A 4OT1A 1KZGA 4K81A 2IFSA 5GOWB 3SV1A 4MY6A 1FOEA 2D9WA 1SGHA 5DHFB 5JHGA 3D8FA 4DX8A 1W1GA 4K17A 4F7HA 2EJ8A 2RUKB 1FAOA 4B6HA 5IRSA 1ZC4B 4A6FA 2W2XD 4HSIA 1H4RA 3KY9A 2AL6A 2CY5A 4HB3B 4HB4B 5JP4A 4QJ3B 5D3YA 2EMSA 2ADZA 5HE0A 1OQNA 2HTHB 1T77A 2DA0A 1M7EA 2R2YA 3QWMA 1X05A 2YRYA 2I1KA 3VIAA 3ULCA 2K2JA 5FI0A 4PQ0A 4D0NB 3WA0A 1XD4A 1FHWA 4MK0A 4HHVA 2I5FA 1FHXA 4GMVA 3OANA 4PNKA 1P3RA 4ZRKA 5C16A 1FB8A 2Z14A 2ROZB 1GC6A 3PP2A 4YL8A 2XQNM 4KHBA 1K5DB 3OHMB 3U8ZA 4NSWA 3KRXA 1XR0B 1X1GA 1BTNA 4DIXA 2COFA 4K2OA 2DTCA 4HAVB 4KAXB 1V88A 1RJ2A 2DYNA 3U7DA 3FM8C 2MKRA 4QJ4B 1Y5OA 3U12A 2RSGA 1ZVRA 1KI1B 1X86A 2COCA 2DFKA 1MAIA 4A6KA 1W1HA 2DX5A 2EMTA 5D3WA 3A8QA 2ELBA 1DBHA 1WGUA 2N0YA 1WGQA 2DKQA 3F5RA 1UEFA 3SO6A 3HIEA 1U5EA 2PZ1A 1UPQA 2I5CA 2P0FA 2DHKA 1U5GA 2ZPYA 2HE7A 4HAXB 2YSZA 3AJ4A 5DIFB 3GYPA 2D9XA 5HE1A 2E2XA 2J0JA 1MKEA 3ODOA 1TJ6A 2CRFA 2Z59A 2L1CA 1V5MA 1DDVA 5KQ4A 2D9VA 4KHAA 4H8SA 1MK7B 3DXDA 2RNRB 2K2UA 5CLLB 3HK0A 4A5KA 2W2XC 5HE3A 3A98B 3D8EA 3NWAA 1UNQA 2YS3A 1ZSQA 4TKNA 2GJYA 4P7IA 2Z0QA 1LB1A 1DROA 1WJMA 2KIGA 3A8PA 1WJ1A 3M1IB 4DBBA 2CODA 5JHHA 2D9YA 1DDWA 4HAYB 3KSYA 4HB0B 2I1JA 5DI9B 1V5UA 5KCVA 1WI1A 1MI1A 3N7CA 4A6HA 3TFMA 3FEHA 1U2BA 1OMWA 4C0AA 4MT7A 5D3VA 2G35A 1U27A 1U5FA 2FJUB 2J59M 4IFSA 4L6EA 2QKMA 1Y19B 3VOQA 2CY4A 1UPRA 1MK9B 2IYBA 1FGZA 1I2HA 1ZM0A 1M7RA 2R09A 5CLQB 4IOYX 4EJNA 3AU5A 2CAYA 3HQCA 1P5TA 5LOPB 1LW3A 5C6RA 3ML4A 2MDXA 5L81A 2Y8FA 5J3QA 1U5DA 2DHJA 2YT1A 1V89A 4HATB 2DKPA 4BBKA 4CSQA 3PG7A 4QXAB 4CHJA 2KUQA 5C5BB 3NWDA 3TO1A 3TVVA 4HDOA 1X1FA 1B55A 2UVMA 4HAUB 2OTXA 4Z2MB 1U29A 2LG1A 2R0DA 3NSUA 4GOUA 4GNKB 1BWNA 1PFJA 3HW2B 4WVFB 3F0WA 2Y8GA 2Z0PA 1DDMA 2VRWB 3QIJA 2M38A 3PVLA 1E5WA 3NWFA 4EKUA 4GXBA 2GS0A 2Z0OA 3IVFA 4ZRJA 3B77A 2DYQA 2DX1A 3PEGA 2DHIA 3ZDTA 4F7GA 4L1RA 4YONA 2N23A 2GCLA 4A6FB 3D8DA 3TW1A 2RGNB 2KIEA 4HAZB 2DLWA 3ZVRA 2EC1A 3T06A 1NI2A 1EF1A 1GC7A 1EGXA 4CHMA 3G9WA 1RRPB 4NY0A 2KR0A 2KUPA 4HB2B 2D4QA 3CXBB 3LJUX 1N3HA 4OSNA 3HSAA 2YT0A 3RCPA 2Z13A 2RVBB 1UNPA 1XX0A 2LYDA 3X23A 4KVGB 3BINA 3NW8A 3TCAA 1XCGA 2D10A 5HE2A 1V5PA 2YS1A 4F7UP 4TYZA 4KHBB 1BTKA 2UZRA 2VSZA 2V76A
chains in the Genus database with same CATH topology
3U12A 2KUQA 4OSNA 3NWDA 3TO1A 4IOYX 2K49A 4L1RA 5I2MA 3TVVA 4KHBA 2K8EA 3GYPA 4KHOA 2GCLA 2R2YA 3NWAA 2Z13A 3OHMB 3TW1A 3A58A 4Z2MB 4QJ5B 2KIEA 3FSSA 3FVCA 4GOUA 2FJUB 4DIXA 4GNKB 4PQ0A 5IRSA 3NW8A 4IFSA 2Z59A 5M4YB 2KIGA 2ZKMX 4OT1A 4HSIA 4KHAA 2GUMA 4QJ3B 4D6WA 3NWFA 5LG4B 2NBVA 4CSQA 5I2SA 4QXAB 2YT2A 2GCJA 2KR0A 3GYOA 2RRFA 2Z4DA 3HIEA 4KHBB 4QJ4B 4Z2NA 2Z14A 1ZYIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R2Y A;  2Z59 A;  2NBV A;  2KR0 A;  2Z4D A;  5IRS A; 
#chains in the Genus database with same CATH topology
 4GMX B;  5C79 A;  1WVH A;  1X11 A;  2KGX B;  2K49 A;  1AWE A;  4K2P A;  1NU2 A;  2Q13 A;  4DXA B;  1GG3 A;  3QBV B;  1Q67 A;  3FSS A;  3FVC A;  1AQC A;  4EMO A;  2COA A;  3DCX A;  1BAK A;  1P6S A;  2NZ8 B;  2VKI A;  2RLO A;  3DXC A;  4D6W A;  1QQG A;  1TQZ A;  2NBV A;  4HDQ A;  2H7E A;  1ZC3 B;  2OQB A;  2Y7B A;  1Z87 A;  2YT2 A;  5I2S A;  1IRS A;  1NTV A;  4ZRI A;  5EFX A;  5JLJ B;  3ULB A;  5I2M A;  2AEH A;  2D9Z A;  1J19 A;  1KZ7 A;  3P7Z A;  3PVW A;  2D11 A;  3PVU A;  1MIX A;  1PMS A;  2KCJ A;  2ZKM X;  4WSF A;  1TXD A;  2J0M A;  3KRW A;  2M14 A;  1EVH A;  3KZ1 A;  1SHC A;  3AU4 A;  4GPT B;  4XWX A;  5DHA B;  2GCJ A;  3CIK A;  4DX9 0;  2J0K A;  2W2W A;  2BCJ A;  1V61 A;  2JP2 A;  2D2Q A;  5LON B;  4KHO A;  1XKE A;  3SNH A;  2H7D A;  1ISN A;  2MFQ A;  2ELA A;  1WG7 A;  3ODW A;  5D27 A;  5M4Y B;  4GN1 A;  3PZD A;  4GZU A;  5J3T A;  2GUM A;  1FGY A;  5LG4 B;  1XOD A;  2FJL A;  4CYE A;  2YS5 A;  3GYO A;  2UZS A;  2YF0 A;  5KQ1 A;  2DN6 A;  2P0H A;  4Y94 A;  3ODX A;  2MWN B;  1FHO A;  3A58 A;  3MDB C;  3DXE A;  1DYN A;  2YVC A;  3UZT A;  1W1D A;  3SUZ A;  3PSC A;  2LOX A;  3SYX A;  1QC6 A;  1K5G B;  1I7A A;  1MPH A;  3WYF B;  5DH9 B;  2RRF A;  1EAZ A;  2Z4D A;  4Z2N A;  1MIZ B;  2P8V A;  1UNR A;  4IAP A;  4WJ7 A;  3V5W A;  4HAW B;  1ZYI A;  1NTY A;  2LKO A;  1OY2 A;  3O96 A;  3MPX A;  5D3X A;  5FI1 A;  2P0D A;  2ROV A;  2NMB A;  2K8E A;  3P6A A;  2LOZ A;  1PLS A;  1H10 A;  2L2I A;  2QKL A;  4QJ5 B;  5C5B A;  5J3Y A;  1J0W A;  2K00 A;  3BJI A;  2LUL A;  2X18 A;  4OT1 A;  1KZG A;  4K81 A;  2IFS A;  5GOW B;  3SV1 A;  4MY6 A;  1FOE A;  2D9W A;  1SGH A;  5DHF B;  5JHG A;  3D8F A;  4DX8 A;  1W1G A;  4K17 A;  4F7H A;  2EJ8 A;  2RUK B;  1FAO A;  4B6H A;  5IRS A;  1ZC4 B;  4A6F A;  2W2X D;  4HSI A;  1H4R A;  3KY9 A;  2AL6 A;  2CY5 A;  4HB3 B;  4HB4 B;  5JP4 A;  4QJ3 B;  5D3Y A;  2EMS A;  2ADZ A;  5HE0 A;  1OQN A;  2HTH B;  1T77 A;  2DA0 A;  1M7E A;  2R2Y A;  3QWM A;  1X05 A;  2YRY A;  2I1K A;  3VIA A;  3ULC A;  2K2J A;  5FI0 A;  4PQ0 A;  4D0N B;  3WA0 A;  1XD4 A;  1FHW A;  4MK0 A;  4HHV A;  2I5F A;  1FHX A;  4GMV A;  3OAN A;  4PNK A;  1P3R A;  4ZRK A;  5C16 A;  1FB8 A;  2Z14 A;  2ROZ B;  1GC6 A;  3PP2 A;  4YL8 A;  2XQN M;  4KHB A;  1K5D B;  3OHM B;  3U8Z A;  4NSW A;  3KRX A;  1XR0 B;  1X1G A;  1BTN A;  4DIX A;  2COF A;  4K2O A;  2DTC A;  4HAV B;  4KAX B;  1V88 A;  1RJ2 A;  2DYN A;  3U7D A;  3FM8 C;  2MKR A;  4QJ4 B;  1Y5O A;  3U12 A;  2RSG A;  1ZVR A;  1KI1 B;  1X86 A;  2COC A;  2DFK A;  1MAI A;  4A6K A;  1W1H A;  2DX5 A;  2EMT A;  5D3W A;  3A8Q A;  2ELB A;  1DBH A;  1WGU A;  2N0Y A;  1WGQ A;  2DKQ A;  3F5R A;  1UEF A;  3SO6 A;  3HIE A;  1U5E A;  2PZ1 A;  1UPQ A;  2I5C A;  2P0F A;  2DHK A;  1U5G A;  2ZPY A;  2HE7 A;  4HAX B;  2YSZ A;  3AJ4 A;  5DIF B;  3GYP A;  2D9X A;  5HE1 A;  2E2X A;  2J0J A;  1MKE A;  3ODO A;  1TJ6 A;  2CRF A;  2Z59 A;  2L1C A;  1V5M A;  1DDV A;  5KQ4 A;  2D9V A;  4KHA A;  4H8S A;  1MK7 B;  3DXD A;  2RNR B;  2K2U A;  5CLL B;  3HK0 A;  4A5K A;  2W2X C;  5HE3 A;  3A98 B;  3D8E A;  3NWA A;  1UNQ A;  2YS3 A;  1ZSQ A;  4TKN A;  2GJY A;  4P7I A;  2Z0Q A;  1LB1 A;  1DRO A;  1WJM A;  2KIG A;  3A8P A;  1WJ1 A;  3M1I B;  4DBB A;  2COD A;  5JHH A;  2D9Y A;  1DDW A;  4HAY B;  3KSY A;  4HB0 B;  2I1J A;  5DI9 B;  1V5U A;  5KCV A;  1WI1 A;  1MI1 A;  3N7C A;  4A6H A;  3TFM A;  3FEH A;  1U2B A;  1OMW A;  4C0A A;  4MT7 A;  5D3V A;  2G35 A;  1U27 A;  1U5F A;  2FJU B;  2J59 M;  4IFS A;  4L6E A;  2QKM A;  1Y19 B;  3VOQ A;  2CY4 A;  1UPR A;  1MK9 B;  2IYB A;  1FGZ A;  1I2H A;  1ZM0 A;  1M7R A;  2R09 A;  5CLQ B;  4IOY X;  4EJN A;  3AU5 A;  2CAY A;  3HQC A;  1P5T A;  5LOP B;  1LW3 A;  5C6R A;  3ML4 A;  2MDX A;  5L81 A;  2Y8F A;  5J3Q A;  1U5D A;  2DHJ A;  2YT1 A;  1V89 A;  4HAT B;  2DKP A;  4BBK A;  4CSQ A;  3PG7 A;  4QXA B;  4CHJ A;  2KUQ A;  5C5B B;  3NWD A;  3TO1 A;  3TVV A;  4HDO A;  1X1F A;  1B55 A;  2UVM A;  4HAU B;  2OTX A;  4Z2M B;  1U29 A;  2LG1 A;  2R0D A;  3NSU A;  4GOU A;  4GNK B;  1BWN A;  1PFJ A;  3HW2 B;  4WVF B;  3F0W A;  2Y8G A;  2Z0P A;  1DDM A;  2VRW B;  3QIJ A;  2M38 A;  3PVL A;  1E5W A;  3NWF A;  4EKU A;  4GXB A;  2GS0 A;  2Z0O A;  3IVF A;  4ZRJ A;  3B77 A;  2DYQ A;  2DX1 A;  3PEG A;  2DHI A;  3ZDT A;  4F7G A;  4L1R A;  4YON A;  2N23 A;  2GCL A;  4A6F B;  3D8D A;  3TW1 A;  2RGN B;  2KIE A;  4HAZ B;  2DLW A;  3ZVR A;  2EC1 A;  3T06 A;  1NI2 A;  1EF1 A;  1GC7 A;  1EGX A;  4CHM A;  3G9W A;  1RRP B;  4NY0 A;  2KR0 A;  2KUP A;  4HB2 B;  2D4Q A;  3CXB B;  3LJU X;  1N3H A;  4OSN A;  3HSA A;  2YT0 A;  3RCP A;  2Z13 A;  2RVB B;  1UNP A;  1XX0 A;  2LYD A;  3X23 A;  4KVG B;  3BIN A;  3NW8 A;  3TCA A;  1XCG A;  2D10 A;  5HE2 A;  1V5P A;  2YS1 A;  4F7U P;  4TYZ A;  4KHB B;  1BTK A;  2UZR A;  2VSZ A;  2V76 A; 
#chains in the Genus database with same CATH homology
 3U12 A;  2KUQ A;  4OSN A;  3NWD A;  3TO1 A;  4IOY X;  2K49 A;  4L1R A;  5I2M A;  3TVV A;  4KHB A;  2K8E A;  3GYP A;  4KHO A;  2GCL A;  2R2Y A;  3NWA A;  2Z13 A;  3OHM B;  3TW1 A;  3A58 A;  4Z2M B;  4QJ5 B;  2KIE A;  3FSS A;  3FVC A;  4GOU A;  2FJU B;  4DIX A;  4GNK B;  4PQ0 A;  5IRS A;  3NW8 A;  4IFS A;  2Z59 A;  5M4Y B;  2KIG A;  2ZKM X;  4OT1 A;  4HSI A;  4KHA A;  2GUM A;  4QJ3 B;  4D6W A;  3NWF A;  5LG4 B;  2NBV A;  4CSQ A;  5I2S A;  4QXA B;  2YT2 A;  2GCJ A;  2KR0 A;  3GYO A;  2RRF A;  2Z4D A;  3HIE A;  4KHB B;  4QJ4 B;  4Z2N A;  2Z14 A;  1ZYI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...