2Z4DA

Nmr structures of yeast proteasome component rpn13
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
96
structure length
96
Chain Sequence
TVIKFRAGVCEYNEDSRLCTPIPVQGEIEIKPNEEEELGFWDFEWRPTEKPVGRELDPISLILIPGETMWVPIKSSKSGRIFALVFSSNERYFFWL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 26S proteasome regulatory subunit RPN13
publication title Proteasome subunit Rpn13 is a novel ubiquitin receptor.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Nuclear protein
total genus 7
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2007-06-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.70 Mainly Beta Roll PH-domain like PH-domain like 2z4dA00
2R2YA 2Z4DA 2Z59A 2KR0A 2NBVA 5IRSA
chains in the Genus database with same CATH superfamily
2ELBA 4MY6A 4BBKA 2N23A 1RJ2A 4HATB 5C5BB 2GCJA 2ROZB 3ZDTA 5C6RA 1FOEA 4HB3B 1FHXA 1XX0A 3NSUA 4HAWB 2RUKB 3U8ZA 1TQZA 5GOWB 5J3YA 3TCAA 2LOZA 2Y8FA 1ZVRA 2I1KA 2DHIA 2P8VA 3AU4A 1NI2A 3N7CA 1BTNA 2XQNM 2DHJA 3LJUX 3G9WA 4WVFB 3ULBA 3TVVA 1U29A 1W1HA 1X86A 4GOUA 3U12A 1U5GA 1KZGA 1EAZA 1ZYIA 2HTHB 2W2WA 1Y5OA 2DA0A 1GC6A 4TYZA 4GXBA 2ELAA 1FAOA 2FJLA 2EMSA 1WGUA 4WJ7A 4XWXA 1BTKA 3P7ZA 4HB0B 2NZ8B 1BAKA 2G35A 2RLOA 1IRSA 1FB8A 1BWNA 2R09A 1MK9B 5IRSA 2CRFA 1E5WA 2YRYA 3O96A 4K81A 1RRPB 2Z0PA 2J0KA 4HB2B 1B55A 2K2UA 5JLJB 2D9VA 2CY4A 4HB4B 4A5KA 2Z0QA 4A6HA 4QJ5B 3FVCA 1KZ7A 2UZSA 1SHCA 1P5TA 5C5BA 2QKMA 2DHKA 5DH9B 3CIKA 3A98B 1V88A 4KHAA 5LONB 4P7IA 3NWAA 5JHGA 1AWEA 1DDVA 4NY0A 4CYEA 3A58A 1K5GB 4EMOA 2DYNA 2CODA 5D3VA 2LULA 3T06A 2DYQA 5D3WA 2LOXA 1TJ6A 3FM8C 1SGHA 3A8PA 2ADZA 1J0WA 2R2YA 2EJ8A 3RCPA 5LG4B 4PQ0A 3AJ4A 2D9ZA 2LKOA 5CLQB 5C16A 2M14A 2DKPA 1MI1A 2YF0A 5KQ4A 2AL6A 2RSGA 4K2PA 1FHWA 2FJUB 2GCLA 1H10A 1U27A 4K17A 1TXDA 4GZUA 2KR0A 1W1DA 4IOYX 1UNPA 2JP2A 1EGXA 2UVMA 2Z59A 3PVWA 5EFXA 4Y94A 2KIEA 2RVBB 4HAYB 5D3XA 5L81A 1KI1B 2BCJA 2VRWB 3QWMA 2EC1A 2D11A 2KIGA 3PVUA 1J19A 1PMSA 3M1IB 5DI9B 1DBHA 2RGNB 3F0WA 3QBVB 5FI1A 5KCVA 4PNKA 1U5DA 3KZ1A 4GPTB 4L6EA 5D3YA 1FHOA 2RNRB 2Z0OA 2MKRA 3QIJA 5HE0A 1MAIA 4EKUA 2YT0A 1WI1A 3KSYA 2N0YA 1UNQA 4OT1A 1V5UA 3OHMB 4Z2NA 2W2XD 4MK0A 1P3RA 2D9XA 3P6AA 3HIEA 4KHOA 3V5WA 3CXBB 3SUZA 1WJMA 1GC7A 1XD4A 1XR0B 4NSWA 4WSFA 3VIAA 4KHBB 2OQBA 3D8DA 4DBBA 1H4RA 3SYXA 2DN6A 5HE2A 2IYBA 2P0FA 2DFKA 2D10A 5FI0A 2LG1A 4CSQA 4YONA 5D27A 3TO1A 2K8EA 1UEFA 2D9YA 4HAZB 1WVHA 2MFQA 2NBVA 3D8EA 3NWFA 1UNRA 3DCXA 1MPHA 2AEHA 1XODA 4IFSA 4DIXA 4HAUB 2K00A 2COCA 3DXDA 2K49A 1I2HA 2J0MA 3ML4A 4GNKB 1X1FA 1UPRA 2Z4DA 3VOQA 5DIFB 2DX5A 3OANA 1MK7B 1K5DB 2CY5A 3UZTA 2J0JA 3MDBC 2MWNB 4CHJA 2L1CA 4DXAB 1XCGA 5C79A 4IAPA 2DX1A 4HDOA 1X1GA 1NTYA 2VSZA 3SV1A 2D9WA 2IFSA 5J3TA 2X18A 1OQNA 4CHMA 2Q13A 4A6KA 3IVFA 4D6WA 3FSSA 3MPXA 5JP4A 1Q67A 2Z14A 1FGZA 1MKEA 2COAA 3AU5A 4KHBA 4KAXB 3DXCA 3F5RA 3HK0A 3U7DA 1ZC4B 1LB1A 3A8QA 4DX90 1UPQA 3PEGA 3NWDA 2QKLA 1U2BA 1EVHA 5I2MA 1Z87A 1U5EA 3HSAA 5HE3A 3HW2B 3KRWA 2Z13A 2M38A 2MDXA 1EF1A 1PLSA 1I7AA 3BINA 3PZDA 4HHVA 4B6HA 1WGQA 4F7UP 4Z2MB 2YT1A 2UZRA 3WYFB 2L2IA 1DYNA 5J3QA 1XKEA 5DHAB 4C0AA 4GMXB 1Y19B 3GYPA 2YT2A 2YVCA 1U5FA 2K2JA 3PP2A 2KGXB 1X05A 2CAYA 3B77A 4A6FB 1ZSQA 3ZVRA 4F7GA 1AQCA 1V5PA 5JHHA 2Y8GA 1N3HA 4EJNA 1M7RA 1ZM0A 4GMVA 1W1GA 4OSNA 3SO6A 3BJIA 2KCJA 1WJ1A 4D0NB 1X11A 2DKQA 2I1JA 2I5CA 1ZC3B 4L1RA 2KUQA 2DTCA 1WG7A 2H7EA 1V89A 2P0HA 3KY9A 2R0DA 2VKIA 2YS5A 1PFJA 2LYDA 5DHFB 4QJ3B 3GYOA 2DLWA 2ZKMX 3KRXA 5CLLB 3TW1A 5I2SA 3PG7A 2OTXA 4ZRKA 2ROVA 2KUPA 1DROA 2COFA 4K2OA 1MIXA 3ODWA 4DX8A 3WA0A 4YL8A 2GS0A 2GUMA 3D8FA 3PVLA 3HQCA 3DXEA 1T77A 1OMWA 4HAVB 4ZRIA 1ISNA 3ODOA 1FGYA 5LOPB 2GJYA 2YS1A 1V5MA 4TKNA 3TFMA 2HE7A 2YS3A 1QQGA 2V76A 1DDWA 1DDMA 2EMTA 3X23A 4A6FA 4GN1A 5M4YB 5HE1A 3FEHA 4MT7A 1GG3A 2J59M 4QXAB 2D4QA 1V61A 2E2XA 3ODXA 1NU2A 2D2QA 4H8SA 4HSIA 4KVGB 5KQ1A 3NW8A 3SNHA 1MIZB 2H7DA 3PSCA 4HDQA 4F7HA 1OY2A 4QJ4B 3ULCA 1LW3A 1NTVA 1QC6A 2W2XC 4ZRJA 1M7EA 2RRFA 2P0DA 4HAXB 2Y7BA 2ZPYA 2YSZA 2PZ1A 2NMBA 1P6SA 2I5FA
chains in the Genus database with same CATH topology
4IOYX 2GUMA 4QJ3B 2R2YA 3GYOA 2ZKMX 4Z2MB 5LG4B 4PQ0A 4KHBA 4GOUA 4OSNA 4HSIA 4IFSA 4KHBB 2GCJA 4DIXA 3TW1A 3NW8A 3U12A 4KHAA 2K49A 2Z59A 5I2SA 3NWAA 4QJ4B 3GYPA 1ZYIA 4CSQA 2YT2A 3TO1A 4GNKB 4L1RA 5IRSA 2KUQA 3A58A 2KIEA 3NWDA 2Z4DA 2K8EA 2RRFA 4OT1A 5I2MA 4D6WA 5M4YB 3OHMB 4Z2NA 2FJUB 4QXAB 2GCLA 3FSSA 2KIGA 2Z13A 3HIEA 4KHOA 2Z14A 4QJ5B 3FVCA 2KR0A 2NBVA 3TVVA 3NWFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R2Y A;  2Z4D A;  2Z59 A;  2KR0 A;  2NBV A;  5IRS A; 
#chains in the Genus database with same CATH topology
 2ELB A;  4MY6 A;  4BBK A;  2N23 A;  1RJ2 A;  4HAT B;  5C5B B;  2GCJ A;  2ROZ B;  3ZDT A;  5C6R A;  1FOE A;  4HB3 B;  1FHX A;  1XX0 A;  3NSU A;  4HAW B;  2RUK B;  3U8Z A;  1TQZ A;  5GOW B;  5J3Y A;  3TCA A;  2LOZ A;  2Y8F A;  1ZVR A;  2I1K A;  2DHI A;  2P8V A;  3AU4 A;  1NI2 A;  3N7C A;  1BTN A;  2XQN M;  2DHJ A;  3LJU X;  3G9W A;  4WVF B;  3ULB A;  3TVV A;  1U29 A;  1W1H A;  1X86 A;  4GOU A;  3U12 A;  1U5G A;  1KZG A;  1EAZ A;  1ZYI A;  2HTH B;  2W2W A;  1Y5O A;  2DA0 A;  1GC6 A;  4TYZ A;  4GXB A;  2ELA A;  1FAO A;  2FJL A;  2EMS A;  1WGU A;  4WJ7 A;  4XWX A;  1BTK A;  3P7Z A;  4HB0 B;  2NZ8 B;  1BAK A;  2G35 A;  2RLO A;  1IRS A;  1FB8 A;  1BWN A;  2R09 A;  1MK9 B;  5IRS A;  2CRF A;  1E5W A;  2YRY A;  3O96 A;  4K81 A;  1RRP B;  2Z0P A;  2J0K A;  4HB2 B;  1B55 A;  2K2U A;  5JLJ B;  2D9V A;  2CY4 A;  4HB4 B;  4A5K A;  2Z0Q A;  4A6H A;  4QJ5 B;  3FVC A;  1KZ7 A;  2UZS A;  1SHC A;  1P5T A;  5C5B A;  2QKM A;  2DHK A;  5DH9 B;  3CIK A;  3A98 B;  1V88 A;  4KHA A;  5LON B;  4P7I A;  3NWA A;  5JHG A;  1AWE A;  1DDV A;  4NY0 A;  4CYE A;  3A58 A;  1K5G B;  4EMO A;  2DYN A;  2COD A;  5D3V A;  2LUL A;  3T06 A;  2DYQ A;  5D3W A;  2LOX A;  1TJ6 A;  3FM8 C;  1SGH A;  3A8P A;  2ADZ A;  1J0W A;  2R2Y A;  2EJ8 A;  3RCP A;  5LG4 B;  4PQ0 A;  3AJ4 A;  2D9Z A;  2LKO A;  5CLQ B;  5C16 A;  2M14 A;  2DKP A;  1MI1 A;  2YF0 A;  5KQ4 A;  2AL6 A;  2RSG A;  4K2P A;  1FHW A;  2FJU B;  2GCL A;  1H10 A;  1U27 A;  4K17 A;  1TXD A;  4GZU A;  2KR0 A;  1W1D A;  4IOY X;  1UNP A;  2JP2 A;  1EGX A;  2UVM A;  2Z59 A;  3PVW A;  5EFX A;  4Y94 A;  2KIE A;  2RVB B;  4HAY B;  5D3X A;  5L81 A;  1KI1 B;  2BCJ A;  2VRW B;  3QWM A;  2EC1 A;  2D11 A;  2KIG A;  3PVU A;  1J19 A;  1PMS A;  3M1I B;  5DI9 B;  1DBH A;  2RGN B;  3F0W A;  3QBV B;  5FI1 A;  5KCV A;  4PNK A;  1U5D A;  3KZ1 A;  4GPT B;  4L6E A;  5D3Y A;  1FHO A;  2RNR B;  2Z0O A;  2MKR A;  3QIJ A;  5HE0 A;  1MAI A;  4EKU A;  2YT0 A;  1WI1 A;  3KSY A;  2N0Y A;  1UNQ A;  4OT1 A;  1V5U A;  3OHM B;  4Z2N A;  2W2X D;  4MK0 A;  1P3R A;  2D9X A;  3P6A A;  3HIE A;  4KHO A;  3V5W A;  3CXB B;  3SUZ A;  1WJM A;  1GC7 A;  1XD4 A;  1XR0 B;  4NSW A;  4WSF A;  3VIA A;  4KHB B;  2OQB A;  3D8D A;  4DBB A;  1H4R A;  3SYX A;  2DN6 A;  5HE2 A;  2IYB A;  2P0F A;  2DFK A;  2D10 A;  5FI0 A;  2LG1 A;  4CSQ A;  4YON A;  5D27 A;  3TO1 A;  2K8E A;  1UEF A;  2D9Y A;  4HAZ B;  1WVH A;  2MFQ A;  2NBV A;  3D8E A;  3NWF A;  1UNR A;  3DCX A;  1MPH A;  2AEH A;  1XOD A;  4IFS A;  4DIX A;  4HAU B;  2K00 A;  2COC A;  3DXD A;  2K49 A;  1I2H A;  2J0M A;  3ML4 A;  4GNK B;  1X1F A;  1UPR A;  2Z4D A;  3VOQ A;  5DIF B;  2DX5 A;  3OAN A;  1MK7 B;  1K5D B;  2CY5 A;  3UZT A;  2J0J A;  3MDB C;  2MWN B;  4CHJ A;  2L1C A;  4DXA B;  1XCG A;  5C79 A;  4IAP A;  2DX1 A;  4HDO A;  1X1G A;  1NTY A;  2VSZ A;  3SV1 A;  2D9W A;  2IFS A;  5J3T A;  2X18 A;  1OQN A;  4CHM A;  2Q13 A;  4A6K A;  3IVF A;  4D6W A;  3FSS A;  3MPX A;  5JP4 A;  1Q67 A;  2Z14 A;  1FGZ A;  1MKE A;  2COA A;  3AU5 A;  4KHB A;  4KAX B;  3DXC A;  3F5R A;  3HK0 A;  3U7D A;  1ZC4 B;  1LB1 A;  3A8Q A;  4DX9 0;  1UPQ A;  3PEG A;  3NWD A;  2QKL A;  1U2B A;  1EVH A;  5I2M A;  1Z87 A;  1U5E A;  3HSA A;  5HE3 A;  3HW2 B;  3KRW A;  2Z13 A;  2M38 A;  2MDX A;  1EF1 A;  1PLS A;  1I7A A;  3BIN A;  3PZD A;  4HHV A;  4B6H A;  1WGQ A;  4F7U P;  4Z2M B;  2YT1 A;  2UZR A;  3WYF B;  2L2I A;  1DYN A;  5J3Q A;  1XKE A;  5DHA B;  4C0A A;  4GMX B;  1Y19 B;  3GYP A;  2YT2 A;  2YVC A;  1U5F A;  2K2J A;  3PP2 A;  2KGX B;  1X05 A;  2CAY A;  3B77 A;  4A6F B;  1ZSQ A;  3ZVR A;  4F7G A;  1AQC A;  1V5P A;  5JHH A;  2Y8G A;  1N3H A;  4EJN A;  1M7R A;  1ZM0 A;  4GMV A;  1W1G A;  4OSN A;  3SO6 A;  3BJI A;  2KCJ A;  1WJ1 A;  4D0N B;  1X11 A;  2DKQ A;  2I1J A;  2I5C A;  1ZC3 B;  4L1R A;  2KUQ A;  2DTC A;  1WG7 A;  2H7E A;  1V89 A;  2P0H A;  3KY9 A;  2R0D A;  2VKI A;  2YS5 A;  1PFJ A;  2LYD A;  5DHF B;  4QJ3 B;  3GYO A;  2DLW A;  2ZKM X;  3KRX A;  5CLL B;  3TW1 A;  5I2S A;  3PG7 A;  2OTX A;  4ZRK A;  2ROV A;  2KUP A;  1DRO A;  2COF A;  4K2O A;  1MIX A;  3ODW A;  4DX8 A;  3WA0 A;  4YL8 A;  2GS0 A;  2GUM A;  3D8F A;  3PVL A;  3HQC A;  3DXE A;  1T77 A;  1OMW A;  4HAV B;  4ZRI A;  1ISN A;  3ODO A;  1FGY A;  5LOP B;  2GJY A;  2YS1 A;  1V5M A;  4TKN A;  3TFM A;  2HE7 A;  2YS3 A;  1QQG A;  2V76 A;  1DDW A;  1DDM A;  2EMT A;  3X23 A;  4A6F A;  4GN1 A;  5M4Y B;  5HE1 A;  3FEH A;  4MT7 A;  1GG3 A;  2J59 M;  4QXA B;  2D4Q A;  1V61 A;  2E2X A;  3ODX A;  1NU2 A;  2D2Q A;  4H8S A;  4HSI A;  4KVG B;  5KQ1 A;  3NW8 A;  3SNH A;  1MIZ B;  2H7D A;  3PSC A;  4HDQ A;  4F7H A;  1OY2 A;  4QJ4 B;  3ULC A;  1LW3 A;  1NTV A;  1QC6 A;  2W2X C;  4ZRJ A;  1M7E A;  2RRF A;  2P0D A;  4HAX B;  2Y7B A;  2ZPY A;  2YSZ A;  2PZ1 A;  2NMB A;  1P6S A;  2I5F A; 
#chains in the Genus database with same CATH homology
 4IOY X;  2GUM A;  4QJ3 B;  2R2Y A;  3GYO A;  2ZKM X;  4Z2M B;  5LG4 B;  4PQ0 A;  4KHB A;  4GOU A;  4OSN A;  4HSI A;  4IFS A;  4KHB B;  2GCJ A;  4DIX A;  3TW1 A;  3NW8 A;  3U12 A;  4KHA A;  2K49 A;  2Z59 A;  5I2S A;  3NWA A;  4QJ4 B;  3GYP A;  1ZYI A;  4CSQ A;  2YT2 A;  3TO1 A;  4GNK B;  4L1R A;  5IRS A;  2KUQ A;  3A58 A;  2KIE A;  3NWD A;  2Z4D A;  2K8E A;  2RRF A;  4OT1 A;  5I2M A;  4D6W A;  5M4Y B;  3OHM B;  4Z2N A;  2FJU B;  4QXA B;  2GCL A;  3FSS A;  2KIG A;  2Z13 A;  3HIE A;  4KHO A;  2Z14 A;  4QJ5 B;  3FVC A;  2KR0 A;  2NBV A;  3TVV A;  3NWF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...