3F0WA

Human numb-like protein, phosphotyrosine interaction domain
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
155
structure length
153
Chain Sequence
DLGTENLYFQSMASRPHQWQADEDAVRKGTCSFPVRYLGHVEVEESRGMHVCEDAVKKLKAMGSVKSVLWVSADGLRVVDDKTKDLLVDQTIEKVSFCAPDRNLDKAFSYICRDGTTRRWICHCFLALKDSGERLSHAVGCAFAACLERKQRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Numb-like protein
publication title Human NUMB-like protein, phosphotyrosine interaction domain
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 39
structure length 153
sequence length 155
ec nomenclature
pdb deposition date 2008-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00640 PID Phosphotyrosine interaction domain (PTB/PID)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3f0wA00
2DKPA 2DX1A 2LOZA 1RJ2A 1B55A 2DN6A 5HE3A 3U8ZA 2D10A 5DHAB 5L81A 1FB8A 2COCA 1NI2A 3MDBC 2COAA 5J3QA 5JHHA 2QKLA 2PZ1A 3PVWA 2YSZA 1X05A 1U5EA 2W2XC 1WI1A 2AL6A 4NY0A 3QIJA 1UNQA 1ZSQA 2Q13A 2ROZB 2EMTA 1FHWA 2AEHA 4HAUB 3VIAA 3F5RA 1XODA 4CYEA 1SHCA 2XQNM 5DI9B 4ZRIA 5D3WA 3ZDTA 1EVHA 5KQ1A 4HB4B 1ZC4B 2CY5A 4ZRJA 2I5CA 1DDWA 2GCJA 2YRYA 1OY2A 5JLJB 2K2JA 1DROA 4L6EA 3PSCA 2ELBA 3TO1A 3SUZA 3A8PA 2KCJA 4B6HA 2EC1A 2IFSA 3TW1A 2RNRB 1M7EA 1V5MA 2OTXA 1OMWA 5FI0A 1MKEA 1U27A 3GYOA 4IAPA 2CY4A 3QBVB 2K2UA 3P7ZA 2FJLA 1Y19B 4EMOA 1WG7A 4HAYB 3F0WA 1U5FA 4DX90 3SNHA 5LONB 4MT7A 2YT0A 1V5PA 2YS1A 4TKNA 1DBHA 3PP2A 2Z0OA 2UVMA 4PNKA 3HQCA 1P6SA 1WJMA 2H7EA 5J3YA 3ULBA 1J19A 2ELAA 4A6FB 1PFJA 2R09A 3X23A 5D3XA 3P6AA 4A5KA 4IFSA 2I5FA 1XX0A 1XCGA 2MFQA 3A98B 1WJ1A 2I1JA 1P3RA 2YS5A 2HE7A 2RGNB 5DH9B 2MKRA 2R0DA 4HDOA 1GC6A 3DXDA 2JP2A 4KHOA 5FI1A 1U5GA 1FHXA 1MK9B 3AJ4A 2EMSA 4H8SA 3KSYA 1X11A 2M14A 4HB2B 4MK0A 1W1GA 3QWMA 2N23A 2Y7BA 4ZRKA 1FGYA 3N7CA 4HATB 3LJUX 1EAZA 4HAWB 2DTCA 3TCAA 1V89A 5GOWB 3V5WA 4GN1A 4HDQA 2P0HA 3SO6A 2MDXA 3D8FA 1GG3A 2CAYA 2CODA 1BTKA 1UNPA 3AU5A 2UZSA 2DKQA 3TFMA 1V88A 2UZRA 4GMVA 4HB0B 3U7DA 1V5UA 3IVFA 3ML4A 2W2XD 2RVBB 3MPXA 1NTYA 3O96A 3BJIA 4GPTB 1MK7B 1Q67A 1N3HA 2Z0PA 1BWNA 2MWNB 1MIZB 3OANA 1I7AA 4K2OA 1XKEA 1OQNA 2DHIA 2Y8FA 1M7RA 5J3TA 2LG1A 2LKOA 1W1HA 2DHKA 2W2WA 4HAVB 2QKMA 1K5DB 2LULA 2D4QA 4KVGB 1SGHA 2NMBA 3TVVA 2L2IA 1U5DA 2GS0A 2RLOA 2P0FA 1LB1A 3FSSA 2DX5A 2E2XA 3SYXA 3G9WA 3DXCA 1ZC3B 4KAXB 5DIFB 5D27A 5C5BA 5JP4A 1ZVRA 1ZM0A 2ZPYA 3GYPA 4GMXB 3FM8C 4BBKA 1FOEA 4EJNA 1UPQA 4DX8A 1NU2A 1X1GA 1FAOA 2D9ZA 2EJ8A 4K81A 4YONA 4F7UP 2DYQA 5C16A 3WYFB 2ADZA 2KGXB 3PZDA 2P0DA 3NSUA 4CHMA 1TQZA 2Y8GA 2LYDA 4DBBA 3FEHA 4K17A 2D9YA 3PEGA 3A8QA 4KHBB 2DYNA 3AU4A 2X18A 2ROVA 1UNRA 1MPHA 3HK0A 1KI1B 1V61A 2P8VA 4WJ7A 5CLQB 3M1IB 4C0AA 4HAZB 3RCPA 4YL8A 5C6RA 2HTHB 3WA0A 1J0WA 1FHOA 1WGQA 3D8EA 3KRWA 5CLLB 2NZ8B 1DDMA 5DHFB 2D2QA 2BCJA 4WVFB 4Y94A 5HE0A 3T06A 3ODXA 1MIXA 1AQCA 3PVLA 4GXBA 1LW3A 1EF1A 1PMSA 1WVHA 5LOPB 1BTNA 1GC7A 2DFKA 4HB3B 3DXEA 2V76A 1DYNA 2KUPA 3KY9A 1H10A 4HHVA 1E5WA 5KQ4A 1W1DA 5JHGA 1BAKA 3VOQA 3ODOA 1DDVA 2K00A 2LOXA 1Y5OA 2RSGA 1MAIA 3KRXA 3PVUA 1FGZA 2D11A 2COFA 1KZGA 1WGUA 4F7GA 3UZTA 1EGXA 2RUKB 2M38A 4F7HA 2CRFA 3CXBB 2N0YA 3ODWA 2DA0A 2OQBA 2J0MA 1I2HA 1Z87A 2VSZA 3ULCA 4MY6A 1H4RA 4CHJA 2DHJA 2Z0QA 5C5BB 2L1CA 4A6HA 2DLWA 4P7IA 4EKUA 4NSWA 1TXDA 2YT1A 4K2PA 3D8DA 4GZUA 3KZ1A 3HW2B 2D9XA 2VRWB 2J59M 4XWXA 4PQ0A 3PG7A 5HE1A 2YF0A 3ZVRA 1KZ7A 1IRSA 1UEFA 2YVCA 4DXAB 1RRPB 4KHAA 1U2BA 2VKIA 2GJYA 4D0NB 1P5TA 2J0JA 1PLSA 4WSFA 1XR0B 5D3VA 1ISNA 4Z2NA 4IOYX 5D3YA 1NTVA 1UPRA 1AWEA 2H7DA 2J0KA 2IYBA 2YS3A 5EFXA 2GCLA 1U29A 1X86A 3SV1A 4Z2MB 5KCVA 4A6FA 1K5GB 1TJ6A 4TYZA 1X1FA 2G35A 4HAXB 5C79A 1XD4A 2D9VA 5HE2A 1QQGA 4A6KA 2D9WA 3CIKA 3BINA 1QC6A 2I1KA
chains in the Genus database with same CATH superfamily
2DKPA 2DX1A 3FVCA 2LOZA 1RJ2A 1B55A 2DN6A 4OT1A 3U12A 5HE3A 3U8ZA 2D10A 5DHAB 5L81A 1FB8A 2COCA 1NI2A 3MDBC 2COAA 5J3QA 5JHHA 2QKLA 2PZ1A 2KIGA 3PVWA 1MI1A 2YSZA 1X05A 1U5EA 2W2XC 1WI1A 2AL6A 4NY0A 3QIJA 1UNQA 1ZSQA 2Z14A 2Q13A 2KUQA 2ROZB 2EMTA 1FHWA 2AEHA 4HAUB 3VIAA 3F5RA 1XODA 4CYEA 1SHCA 2XQNM 5DI9B 4ZRIA 5D3WA 3ZDTA 1EVHA 2RRFA 5KQ1A 4HB4B 1ZC4B 2CY5A 4ZRJA 2I5CA 3HSAA 1DDWA 2GCJA 2YRYA 1OY2A 5JLJB 2K2JA 1DROA 4L6EA 3PSCA 2ELBA 4GOUA 3SUZA 3TO1A 3A8PA 2KCJA 4B6HA 2EC1A 2IFSA 3TW1A 2RNRB 1M7EA 1V5MA 2OTXA 1OMWA 5FI0A 1MKEA 1U27A 3GYOA 4IAPA 2CY4A 3QBVB 2K2UA 3P7ZA 2FJLA 1Y19B 4EMOA 1WG7A 4HAYB 3A58A 3F0WA 1U5FA 4DX90 3SNHA 5LONB 4MT7A 2YT0A 1V5PA 2YS1A 4TKNA 1DBHA 3PP2A 2Z13A 2Z0OA 2UVMA 4PNKA 3HQCA 1P6SA 1WJMA 2H7EA 4D6WA 5J3YA 3ULBA 1J19A 2ELAA 4A6FB 1PFJA 2R09A 3X23A 5D3XA 4KHBA 3P6AA 4A5KA 4IFSA 2K8EA 2I5FA 1XX0A 1XCGA 2MFQA 3A98B 1WJ1A 2I1JA 1P3RA 2YS5A 2HE7A 2RGNB 3OHMB 5DH9B 4L1RA 4HSIA 2MKRA 5LG4B 2R0DA 4HDOA 1GC6A 3DXDA 2JP2A 4KHOA 5FI1A 1U5GA 1FHXA 1MK9B 3AJ4A 2EMSA 4H8SA 3KSYA 1X11A 2M14A 4HB2B 4MK0A 1W1GA 3QWMA 2N23A 2Y7BA 2R2YA 4ZRKA 1FGYA 3N7CA 4HATB 3LJUX 1EAZA 4HAWB 2DTCA 3TCAA 1V89A 5GOWB 3V5WA 4GN1A 4HDQA 2P0HA 2KR0A 3SO6A 2MDXA 3D8FA 1GG3A 2CAYA 2CODA 1BTKA 1UNPA 3AU5A 2UZSA 2DKQA 3TFMA 1V88A 1ZYIA 2UZRA 4GMVA 4HB0B 3U7DA 5M4YB 1V5UA 3IVFA 3ML4A 2W2XD 2RVBB 3MPXA 1NTYA 3O96A 3BJIA 4GPTB 1MK7B 1Q67A 1N3HA 2Z0PA 1BWNA 2MWNB 1MIZB 3OANA 5I2MA 1I7AA 4K2OA 1XKEA 1OQNA 2DHIA 2Y8FA 1M7RA 5J3TA 2LG1A 2LKOA 1W1HA 2DHKA 2W2WA 4HAVB 2QKMA 1K5DB 2LULA 2D4QA 4KVGB 1SGHA 2NMBA 3TVVA 4GNKB 2L2IA 1U5DA 2GS0A 2RLOA 2P0FA 2ZKMX 1LB1A 3FSSA 2DX5A 2E2XA 3SYXA 3DCXA 3G9WA 3DXCA 1ZC3B 4QJ3B 4KAXB 5DIFB 5D27A 5IRSA 5C5BA 5JP4A 4DIXA 1ZVRA 1ZM0A 2ZPYA 3GYPA 4GMXB 3FM8C 4BBKA 1FOEA 4OSNA 4EJNA 1UPQA 4DX8A 1NU2A 1X1GA 1FAOA 2D9ZA 2EJ8A 4K81A 4YONA 4F7UP 2DYQA 5C16A 3WYFB 2ADZA 2KGXB 3PZDA 2P0DA 3NSUA 4CHMA 1TQZA 2Y8GA 2LYDA 4DBBA 3FEHA 4K17A 2D9YA 3PEGA 3A8QA 4KHBB 2DYNA 3AU4A 2X18A 2ROVA 1UNRA 1MPHA 3HK0A 1KI1B 1V61A 2P8VA 4WJ7A 3B77A 5CLQB 3M1IB 4C0AA 4HAZB 3RCPA 4YL8A 5C6RA 2HTHB 3WA0A 1J0WA 1FHOA 1WGQA 3NWDA 3D8EA 3KRWA 5CLLB 2NZ8B 1DDMA 5DHFB 2D2QA 2BCJA 4WVFB 4Y94A 5HE0A 3T06A 3ODXA 1MIXA 1AQCA 3PVLA 4GXBA 1LW3A 5I2SA 1EF1A 1PMSA 1WVHA 5LOPB 2Z4DA 1BTNA 1GC7A 2GUMA 2DFKA 2Z59A 4HB3B 2YT2A 3DXEA 2V76A 1DYNA 2KUPA 3KY9A 1H10A 4HHVA 1E5WA 5KQ4A 1W1DA 5JHGA 1BAKA 3VOQA 3ODOA 1DDVA 2K00A 2LOXA 1Y5OA 2RSGA 4QJ4B 2NBVA 1MAIA 3KRXA 3PVUA 1FGZA 2D11A 2COFA 4QJ5B 1KZGA 3HIEA 1WGUA 4F7GA 3UZTA 1EGXA 2RUKB 2M38A 4F7HA 3NWAA 2CRFA 3CXBB 2N0YA 3ODWA 2DA0A 2OQBA 2J0MA 2KIEA 1I2HA 1Z87A 1T77A 2VSZA 3ULCA 4MY6A 2K49A 1H4RA 2FJUB 4CHJA 2DHJA 2Z0QA 5C5BB 4CSQA 2L1CA 4A6HA 2DLWA 4P7IA 4EKUA 4NSWA 1TXDA 3NWFA 2YT1A 4K2PA 3D8DA 4GZUA 3KZ1A 3HW2B 2D9XA 2VRWB 2J59M 4XWXA 4PQ0A 3PG7A 5HE1A 2YF0A 3ZVRA 1KZ7A 1IRSA 1UEFA 2YVCA 4DXAB 1RRPB 4KHAA 1U2BA 2VKIA 2GJYA 4D0NB 1P5TA 2J0JA 1PLSA 4WSFA 1XR0B 5D3VA 1ISNA 4Z2NA 4IOYX 5D3YA 1NTVA 1UPRA 1AWEA 2H7DA 2J0KA 2IYBA 2YS3A 5EFXA 2GCLA 1U29A 1X86A 3SV1A 4Z2MB 5KCVA 4A6FA 1K5GB 1TJ6A 4TYZA 1X1FA 2G35A 4HAXB 5C79A 1XD4A 2D9VA 4QXAB 5HE2A 1QQGA 4A6KA 3NW8A 2D9WA 3CIKA 3BINA 1QC6A 2I1KA
chains in the Genus database with same CATH topology
2DKPA 2DX1A 2LOZA 1RJ2A 1B55A 2DN6A 5HE3A 3U8ZA 2D10A 5DHAB 5L81A 1FB8A 2COCA 1NI2A 3MDBC 2COAA 5J3QA 5JHHA 2QKLA 2PZ1A 3PVWA 2YSZA 1X05A 1U5EA 2W2XC 1WI1A 2AL6A 4NY0A 3QIJA 1UNQA 1ZSQA 2Q13A 2ROZB 2EMTA 1FHWA 2AEHA 4HAUB 3VIAA 3F5RA 1XODA 4CYEA 1SHCA 2XQNM 5DI9B 4ZRIA 5D3WA 3ZDTA 1EVHA 5KQ1A 4HB4B 1ZC4B 2CY5A 4ZRJA 2I5CA 1DDWA 2GCJA 2YRYA 1OY2A 5JLJB 2K2JA 1DROA 4L6EA 3PSCA 2ELBA 3TO1A 3SUZA 3A8PA 2KCJA 4B6HA 2EC1A 2IFSA 3TW1A 2RNRB 1M7EA 1V5MA 2OTXA 1OMWA 5FI0A 1MKEA 1U27A 3GYOA 4IAPA 2CY4A 3QBVB 2K2UA 3P7ZA 2FJLA 1Y19B 4EMOA 1WG7A 4HAYB 3F0WA 1U5FA 4DX90 3SNHA 5LONB 4MT7A 2YT0A 1V5PA 2YS1A 4TKNA 1DBHA 3PP2A 2Z0OA 2UVMA 4PNKA 3HQCA 1P6SA 1WJMA 2H7EA 5J3YA 3ULBA 1J19A 2ELAA 4A6FB 1PFJA 2R09A 3X23A 5D3XA 3P6AA 4A5KA 4IFSA 2I5FA 1XX0A 1XCGA 2MFQA 3A98B 1WJ1A 2I1JA 1P3RA 2YS5A 2HE7A 2RGNB 5DH9B 2MKRA 2R0DA 4HDOA 1GC6A 3DXDA 2JP2A 4KHOA 5FI1A 1U5GA 1FHXA 1MK9B 3AJ4A 2EMSA 4H8SA 3KSYA 1X11A 2M14A 4HB2B 4MK0A 1W1GA 3QWMA 2N23A 2Y7BA 4ZRKA 1FGYA 3N7CA 4HATB 3LJUX 1EAZA 4HAWB 2DTCA 3TCAA 1V89A 5GOWB 3V5WA 4GN1A 4HDQA 2P0HA 3SO6A 2MDXA 3D8FA 1GG3A 2CAYA 2CODA 1BTKA 1UNPA 3AU5A 2UZSA 2DKQA 3TFMA 1V88A 2UZRA 4GMVA 4HB0B 3U7DA 1V5UA 3IVFA 3ML4A 2W2XD 2RVBB 3MPXA 1NTYA 3O96A 3BJIA 4GPTB 1MK7B 1Q67A 1N3HA 2Z0PA 1BWNA 2MWNB 1MIZB 3OANA 1I7AA 4K2OA 1XKEA 1OQNA 2DHIA 2Y8FA 1M7RA 5J3TA 2LG1A 2LKOA 1W1HA 2DHKA 2W2WA 4HAVB 2QKMA 1K5DB 2LULA 2D4QA 4KVGB 1SGHA 2NMBA 3TVVA 2L2IA 1U5DA 2GS0A 2RLOA 2P0FA 1LB1A 3FSSA 2DX5A 2E2XA 3SYXA 3G9WA 3DXCA 1ZC3B 4KAXB 5DIFB 5D27A 5C5BA 5JP4A 1ZVRA 1ZM0A 2ZPYA 3GYPA 4GMXB 3FM8C 4BBKA 1FOEA 4EJNA 1UPQA 4DX8A 1NU2A 1X1GA 1FAOA 2D9ZA 2EJ8A 4K81A 4YONA 4F7UP 2DYQA 5C16A 3WYFB 2ADZA 2KGXB 3PZDA 2P0DA 3NSUA 4CHMA 1TQZA 2Y8GA 2LYDA 4DBBA 3FEHA 4K17A 2D9YA 3PEGA 3A8QA 4KHBB 2DYNA 3AU4A 2X18A 2ROVA 1UNRA 1MPHA 3HK0A 1KI1B 1V61A 2P8VA 4WJ7A 5CLQB 3M1IB 4C0AA 4HAZB 3RCPA 4YL8A 5C6RA 2HTHB 3WA0A 1J0WA 1FHOA 1WGQA 3D8EA 3KRWA 5CLLB 2NZ8B 1DDMA 5DHFB 2D2QA 2BCJA 4WVFB 4Y94A 5HE0A 3T06A 3ODXA 1MIXA 1AQCA 3PVLA 4GXBA 1LW3A 1EF1A 1PMSA 1WVHA 5LOPB 1BTNA 1GC7A 2DFKA 4HB3B 3DXEA 2V76A 1DYNA 2KUPA 3KY9A 1H10A 4HHVA 1E5WA 5KQ4A 1W1DA 5JHGA 1BAKA 3VOQA 3ODOA 1DDVA 2K00A 2LOXA 1Y5OA 2RSGA 1MAIA 3KRXA 3PVUA 1FGZA 2D11A 2COFA 1KZGA 1WGUA 4F7GA 3UZTA 1EGXA 2RUKB 2M38A 4F7HA 2CRFA 3CXBB 2N0YA 3ODWA 2DA0A 2OQBA 2J0MA 1I2HA 1Z87A 2VSZA 3ULCA 4MY6A 1H4RA 4CHJA 2DHJA 2Z0QA 5C5BB 2L1CA 4A6HA 2DLWA 4P7IA 4EKUA 4NSWA 1TXDA 2YT1A 4K2PA 3D8DA 4GZUA 3KZ1A 3HW2B 2D9XA 2VRWB 2J59M 4XWXA 4PQ0A 3PG7A 5HE1A 2YF0A 3ZVRA 1KZ7A 1IRSA 1UEFA 2YVCA 4DXAB 1RRPB 4KHAA 1U2BA 2VKIA 2GJYA 4D0NB 1P5TA 2J0JA 1PLSA 4WSFA 1XR0B 5D3VA 1ISNA 4Z2NA 4IOYX 5D3YA 1NTVA 1UPRA 1AWEA 2H7DA 2J0KA 2IYBA 2YS3A 5EFXA 2GCLA 1U29A 1X86A 3SV1A 4Z2MB 5KCVA 4A6FA 1K5GB 1TJ6A 4TYZA 1X1FA 2G35A 4HAXB 5C79A 1XD4A 2D9VA 5HE2A 1QQGA 4A6KA 2D9WA 3CIKA 3BINA 1QC6A 2I1KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DKP A;  2DX1 A;  2LOZ A;  1RJ2 A;  1B55 A;  2DN6 A;  5HE3 A;  3U8Z A;  2D10 A;  5DHA B;  5L81 A;  1FB8 A;  2COC A;  1NI2 A;  3MDB C;  2COA A;  5J3Q A;  5JHH A;  2QKL A;  2PZ1 A;  3PVW A;  2YSZ A;  1X05 A;  1U5E A;  2W2X C;  1WI1 A;  2AL6 A;  4NY0 A;  3QIJ A;  1UNQ A;  1ZSQ A;  2Q13 A;  2ROZ B;  2EMT A;  1FHW A;  2AEH A;  4HAU B;  3VIA A;  3F5R A;  1XOD A;  4CYE A;  1SHC A;  2XQN M;  5DI9 B;  4ZRI A;  5D3W A;  3ZDT A;  1EVH A;  5KQ1 A;  4HB4 B;  1ZC4 B;  2CY5 A;  4ZRJ A;  2I5C A;  1DDW A;  2GCJ A;  2YRY A;  1OY2 A;  5JLJ B;  2K2J A;  1DRO A;  4L6E A;  3PSC A;  2ELB A;  3TO1 A;  3SUZ A;  3A8P A;  2KCJ A;  4B6H A;  2EC1 A;  2IFS A;  3TW1 A;  2RNR B;  1M7E A;  1V5M A;  2OTX A;  1OMW A;  5FI0 A;  1MKE A;  1U27 A;  3GYO A;  4IAP A;  2CY4 A;  3QBV B;  2K2U A;  3P7Z A;  2FJL A;  1Y19 B;  4EMO A;  1WG7 A;  4HAY B;  3F0W A;  1U5F A;  4DX9 0;  3SNH A;  5LON B;  4MT7 A;  2YT0 A;  1V5P A;  2YS1 A;  4TKN A;  1DBH A;  3PP2 A;  2Z0O A;  2UVM A;  4PNK A;  3HQC A;  1P6S A;  1WJM A;  2H7E A;  5J3Y A;  3ULB A;  1J19 A;  2ELA A;  4A6F B;  1PFJ A;  2R09 A;  3X23 A;  5D3X A;  3P6A A;  4A5K A;  4IFS A;  2I5F A;  1XX0 A;  1XCG A;  2MFQ A;  3A98 B;  1WJ1 A;  2I1J A;  1P3R A;  2YS5 A;  2HE7 A;  2RGN B;  5DH9 B;  2MKR A;  2R0D A;  4HDO A;  1GC6 A;  3DXD A;  2JP2 A;  4KHO A;  5FI1 A;  1U5G A;  1FHX A;  1MK9 B;  3AJ4 A;  2EMS A;  4H8S A;  3KSY A;  1X11 A;  2M14 A;  4HB2 B;  4MK0 A;  1W1G A;  3QWM A;  2N23 A;  2Y7B A;  4ZRK A;  1FGY A;  3N7C A;  4HAT B;  3LJU X;  1EAZ A;  4HAW B;  2DTC A;  3TCA A;  1V89 A;  5GOW B;  3V5W A;  4GN1 A;  4HDQ A;  2P0H A;  3SO6 A;  2MDX A;  3D8F A;  1GG3 A;  2CAY A;  2COD A;  1BTK A;  1UNP A;  3AU5 A;  2UZS A;  2DKQ A;  3TFM A;  1V88 A;  2UZR A;  4GMV A;  4HB0 B;  3U7D A;  1V5U A;  3IVF A;  3ML4 A;  2W2X D;  2RVB B;  3MPX A;  1NTY A;  3O96 A;  3BJI A;  4GPT B;  1MK7 B;  1Q67 A;  1N3H A;  2Z0P A;  1BWN A;  2MWN B;  1MIZ B;  3OAN A;  1I7A A;  4K2O A;  1XKE A;  1OQN A;  2DHI A;  2Y8F A;  1M7R A;  5J3T A;  2LG1 A;  2LKO A;  1W1H A;  2DHK A;  2W2W A;  4HAV B;  2QKM A;  1K5D B;  2LUL A;  2D4Q A;  4KVG B;  1SGH A;  2NMB A;  3TVV A;  2L2I A;  1U5D A;  2GS0 A;  2RLO A;  2P0F A;  1LB1 A;  3FSS A;  2DX5 A;  2E2X A;  3SYX A;  3G9W A;  3DXC A;  1ZC3 B;  4KAX B;  5DIF B;  5D27 A;  5C5B A;  5JP4 A;  1ZVR A;  1ZM0 A;  2ZPY A;  3GYP A;  4GMX B;  3FM8 C;  4BBK A;  1FOE A;  4EJN A;  1UPQ A;  4DX8 A;  1NU2 A;  1X1G A;  1FAO A;  2D9Z A;  2EJ8 A;  4K81 A;  4YON A;  4F7U P;  2DYQ A;  5C16 A;  3WYF B;  2ADZ A;  2KGX B;  3PZD A;  2P0D A;  3NSU A;  4CHM A;  1TQZ A;  2Y8G A;  2LYD A;  4DBB A;  3FEH A;  4K17 A;  2D9Y A;  3PEG A;  3A8Q A;  4KHB B;  2DYN A;  3AU4 A;  2X18 A;  2ROV A;  1UNR A;  1MPH A;  3HK0 A;  1KI1 B;  1V61 A;  2P8V A;  4WJ7 A;  5CLQ B;  3M1I B;  4C0A A;  4HAZ B;  3RCP A;  4YL8 A;  5C6R A;  2HTH B;  3WA0 A;  1J0W A;  1FHO A;  1WGQ A;  3D8E A;  3KRW A;  5CLL B;  2NZ8 B;  1DDM A;  5DHF B;  2D2Q A;  2BCJ A;  4WVF B;  4Y94 A;  5HE0 A;  3T06 A;  3ODX A;  1MIX A;  1AQC A;  3PVL A;  4GXB A;  1LW3 A;  1EF1 A;  1PMS A;  1WVH A;  5LOP B;  1BTN A;  1GC7 A;  2DFK A;  4HB3 B;  3DXE A;  2V76 A;  1DYN A;  2KUP A;  3KY9 A;  1H10 A;  4HHV A;  1E5W A;  5KQ4 A;  1W1D A;  5JHG A;  1BAK A;  3VOQ A;  3ODO A;  1DDV A;  2K00 A;  2LOX A;  1Y5O A;  2RSG A;  1MAI A;  3KRX A;  3PVU A;  1FGZ A;  2D11 A;  2COF A;  1KZG A;  1WGU A;  4F7G A;  3UZT A;  1EGX A;  2RUK B;  2M38 A;  4F7H A;  2CRF A;  3CXB B;  2N0Y A;  3ODW A;  2DA0 A;  2OQB A;  2J0M A;  1I2H A;  1Z87 A;  2VSZ A;  3ULC A;  4MY6 A;  1H4R A;  4CHJ A;  2DHJ A;  2Z0Q A;  5C5B B;  2L1C A;  4A6H A;  2DLW A;  4P7I A;  4EKU A;  4NSW A;  1TXD A;  2YT1 A;  4K2P A;  3D8D A;  4GZU A;  3KZ1 A;  3HW2 B;  2D9X A;  2VRW B;  2J59 M;  4XWX A;  4PQ0 A;  3PG7 A;  5HE1 A;  2YF0 A;  3ZVR A;  1KZ7 A;  1IRS A;  1UEF A;  2YVC A;  4DXA B;  1RRP B;  4KHA A;  1U2B A;  2VKI A;  2GJY A;  4D0N B;  1P5T A;  2J0J A;  1PLS A;  4WSF A;  1XR0 B;  5D3V A;  1ISN A;  4Z2N A;  4IOY X;  5D3Y A;  1NTV A;  1UPR A;  1AWE A;  2H7D A;  2J0K A;  2IYB A;  2YS3 A;  5EFX A;  2GCL A;  1U29 A;  1X86 A;  3SV1 A;  4Z2M B;  5KCV A;  4A6F A;  1K5G B;  1TJ6 A;  4TYZ A;  1X1F A;  2G35 A;  4HAX B;  5C79 A;  1XD4 A;  2D9V A;  5HE2 A;  1QQG A;  4A6K A;  2D9W A;  3CIK A;  3BIN A;  1QC6 A;  2I1K A; 
#chains in the Genus database with same CATH topology
 2DKP A;  2DX1 A;  3FVC A;  2LOZ A;  1RJ2 A;  1B55 A;  2DN6 A;  4OT1 A;  3U12 A;  5HE3 A;  3U8Z A;  2D10 A;  5DHA B;  5L81 A;  1FB8 A;  2COC A;  1NI2 A;  3MDB C;  2COA A;  5J3Q A;  5JHH A;  2QKL A;  2PZ1 A;  2KIG A;  3PVW A;  1MI1 A;  2YSZ A;  1X05 A;  1U5E A;  2W2X C;  1WI1 A;  2AL6 A;  4NY0 A;  3QIJ A;  1UNQ A;  1ZSQ A;  2Z14 A;  2Q13 A;  2KUQ A;  2ROZ B;  2EMT A;  1FHW A;  2AEH A;  4HAU B;  3VIA A;  3F5R A;  1XOD A;  4CYE A;  1SHC A;  2XQN M;  5DI9 B;  4ZRI A;  5D3W A;  3ZDT A;  1EVH A;  2RRF A;  5KQ1 A;  4HB4 B;  1ZC4 B;  2CY5 A;  4ZRJ A;  2I5C A;  3HSA A;  1DDW A;  2GCJ A;  2YRY A;  1OY2 A;  5JLJ B;  2K2J A;  1DRO A;  4L6E A;  3PSC A;  2ELB A;  4GOU A;  3SUZ A;  3TO1 A;  3A8P A;  2KCJ A;  4B6H A;  2EC1 A;  2IFS A;  3TW1 A;  2RNR B;  1M7E A;  1V5M A;  2OTX A;  1OMW A;  5FI0 A;  1MKE A;  1U27 A;  3GYO A;  4IAP A;  2CY4 A;  3QBV B;  2K2U A;  3P7Z A;  2FJL A;  1Y19 B;  4EMO A;  1WG7 A;  4HAY B;  3A58 A;  3F0W A;  1U5F A;  4DX9 0;  3SNH A;  5LON B;  4MT7 A;  2YT0 A;  1V5P A;  2YS1 A;  4TKN A;  1DBH A;  3PP2 A;  2Z13 A;  2Z0O A;  2UVM A;  4PNK A;  3HQC A;  1P6S A;  1WJM A;  2H7E A;  4D6W A;  5J3Y A;  3ULB A;  1J19 A;  2ELA A;  4A6F B;  1PFJ A;  2R09 A;  3X23 A;  5D3X A;  4KHB A;  3P6A A;  4A5K A;  4IFS A;  2K8E A;  2I5F A;  1XX0 A;  1XCG A;  2MFQ A;  3A98 B;  1WJ1 A;  2I1J A;  1P3R A;  2YS5 A;  2HE7 A;  2RGN B;  3OHM B;  5DH9 B;  4L1R A;  4HSI A;  2MKR A;  5LG4 B;  2R0D A;  4HDO A;  1GC6 A;  3DXD A;  2JP2 A;  4KHO A;  5FI1 A;  1U5G A;  1FHX A;  1MK9 B;  3AJ4 A;  2EMS A;  4H8S A;  3KSY A;  1X11 A;  2M14 A;  4HB2 B;  4MK0 A;  1W1G A;  3QWM A;  2N23 A;  2Y7B A;  2R2Y A;  4ZRK A;  1FGY A;  3N7C A;  4HAT B;  3LJU X;  1EAZ A;  4HAW B;  2DTC A;  3TCA A;  1V89 A;  5GOW B;  3V5W A;  4GN1 A;  4HDQ A;  2P0H A;  2KR0 A;  3SO6 A;  2MDX A;  3D8F A;  1GG3 A;  2CAY A;  2COD A;  1BTK A;  1UNP A;  3AU5 A;  2UZS A;  2DKQ A;  3TFM A;  1V88 A;  1ZYI A;  2UZR A;  4GMV A;  4HB0 B;  3U7D A;  5M4Y B;  1V5U A;  3IVF A;  3ML4 A;  2W2X D;  2RVB B;  3MPX A;  1NTY A;  3O96 A;  3BJI A;  4GPT B;  1MK7 B;  1Q67 A;  1N3H A;  2Z0P A;  1BWN A;  2MWN B;  1MIZ B;  3OAN A;  5I2M A;  1I7A A;  4K2O A;  1XKE A;  1OQN A;  2DHI A;  2Y8F A;  1M7R A;  5J3T A;  2LG1 A;  2LKO A;  1W1H A;  2DHK A;  2W2W A;  4HAV B;  2QKM A;  1K5D B;  2LUL A;  2D4Q A;  4KVG B;  1SGH A;  2NMB A;  3TVV A;  4GNK B;  2L2I A;  1U5D A;  2GS0 A;  2RLO A;  2P0F A;  2ZKM X;  1LB1 A;  3FSS A;  2DX5 A;  2E2X A;  3SYX A;  3DCX A;  3G9W A;  3DXC A;  1ZC3 B;  4QJ3 B;  4KAX B;  5DIF B;  5D27 A;  5IRS A;  5C5B A;  5JP4 A;  4DIX A;  1ZVR A;  1ZM0 A;  2ZPY A;  3GYP A;  4GMX B;  3FM8 C;  4BBK A;  1FOE A;  4OSN A;  4EJN A;  1UPQ A;  4DX8 A;  1NU2 A;  1X1G A;  1FAO A;  2D9Z A;  2EJ8 A;  4K81 A;  4YON A;  4F7U P;  2DYQ A;  5C16 A;  3WYF B;  2ADZ A;  2KGX B;  3PZD A;  2P0D A;  3NSU A;  4CHM A;  1TQZ A;  2Y8G A;  2LYD A;  4DBB A;  3FEH A;  4K17 A;  2D9Y A;  3PEG A;  3A8Q A;  4KHB B;  2DYN A;  3AU4 A;  2X18 A;  2ROV A;  1UNR A;  1MPH A;  3HK0 A;  1KI1 B;  1V61 A;  2P8V A;  4WJ7 A;  3B77 A;  5CLQ B;  3M1I B;  4C0A A;  4HAZ B;  3RCP A;  4YL8 A;  5C6R A;  2HTH B;  3WA0 A;  1J0W A;  1FHO A;  1WGQ A;  3NWD A;  3D8E A;  3KRW A;  5CLL B;  2NZ8 B;  1DDM A;  5DHF B;  2D2Q A;  2BCJ A;  4WVF B;  4Y94 A;  5HE0 A;  3T06 A;  3ODX A;  1MIX A;  1AQC A;  3PVL A;  4GXB A;  1LW3 A;  5I2S A;  1EF1 A;  1PMS A;  1WVH A;  5LOP B;  2Z4D A;  1BTN A;  1GC7 A;  2GUM A;  2DFK A;  2Z59 A;  4HB3 B;  2YT2 A;  3DXE A;  2V76 A;  1DYN A;  2KUP A;  3KY9 A;  1H10 A;  4HHV A;  1E5W A;  5KQ4 A;  1W1D A;  5JHG A;  1BAK A;  3VOQ A;  3ODO A;  1DDV A;  2K00 A;  2LOX A;  1Y5O A;  2RSG A;  4QJ4 B;  2NBV A;  1MAI A;  3KRX A;  3PVU A;  1FGZ A;  2D11 A;  2COF A;  4QJ5 B;  1KZG A;  3HIE A;  1WGU A;  4F7G A;  3UZT A;  1EGX A;  2RUK B;  2M38 A;  4F7H A;  3NWA A;  2CRF A;  3CXB B;  2N0Y A;  3ODW A;  2DA0 A;  2OQB A;  2J0M A;  2KIE A;  1I2H A;  1Z87 A;  1T77 A;  2VSZ A;  3ULC A;  4MY6 A;  2K49 A;  1H4R A;  2FJU B;  4CHJ A;  2DHJ A;  2Z0Q A;  5C5B B;  4CSQ A;  2L1C A;  4A6H A;  2DLW A;  4P7I A;  4EKU A;  4NSW A;  1TXD A;  3NWF A;  2YT1 A;  4K2P A;  3D8D A;  4GZU A;  3KZ1 A;  3HW2 B;  2D9X A;  2VRW B;  2J59 M;  4XWX A;  4PQ0 A;  3PG7 A;  5HE1 A;  2YF0 A;  3ZVR A;  1KZ7 A;  1IRS A;  1UEF A;  2YVC A;  4DXA B;  1RRP B;  4KHA A;  1U2B A;  2VKI A;  2GJY A;  4D0N B;  1P5T A;  2J0J A;  1PLS A;  4WSF A;  1XR0 B;  5D3V A;  1ISN A;  4Z2N A;  4IOY X;  5D3Y A;  1NTV A;  1UPR A;  1AWE A;  2H7D A;  2J0K A;  2IYB A;  2YS3 A;  5EFX A;  2GCL A;  1U29 A;  1X86 A;  3SV1 A;  4Z2M B;  5KCV A;  4A6F A;  1K5G B;  1TJ6 A;  4TYZ A;  1X1F A;  2G35 A;  4HAX B;  5C79 A;  1XD4 A;  2D9V A;  4QXA B;  5HE2 A;  1QQG A;  4A6K A;  3NW8 A;  2D9W A;  3CIK A;  3BIN A;  1QC6 A;  2I1K A; 
#chains in the Genus database with same CATH homology
 2DKP A;  2DX1 A;  2LOZ A;  1RJ2 A;  1B55 A;  2DN6 A;  5HE3 A;  3U8Z A;  2D10 A;  5DHA B;  5L81 A;  1FB8 A;  2COC A;  1NI2 A;  3MDB C;  2COA A;  5J3Q A;  5JHH A;  2QKL A;  2PZ1 A;  3PVW A;  2YSZ A;  1X05 A;  1U5E A;  2W2X C;  1WI1 A;  2AL6 A;  4NY0 A;  3QIJ A;  1UNQ A;  1ZSQ A;  2Q13 A;  2ROZ B;  2EMT A;  1FHW A;  2AEH A;  4HAU B;  3VIA A;  3F5R A;  1XOD A;  4CYE A;  1SHC A;  2XQN M;  5DI9 B;  4ZRI A;  5D3W A;  3ZDT A;  1EVH A;  5KQ1 A;  4HB4 B;  1ZC4 B;  2CY5 A;  4ZRJ A;  2I5C A;  1DDW A;  2GCJ A;  2YRY A;  1OY2 A;  5JLJ B;  2K2J A;  1DRO A;  4L6E A;  3PSC A;  2ELB A;  3TO1 A;  3SUZ A;  3A8P A;  2KCJ A;  4B6H A;  2EC1 A;  2IFS A;  3TW1 A;  2RNR B;  1M7E A;  1V5M A;  2OTX A;  1OMW A;  5FI0 A;  1MKE A;  1U27 A;  3GYO A;  4IAP A;  2CY4 A;  3QBV B;  2K2U A;  3P7Z A;  2FJL A;  1Y19 B;  4EMO A;  1WG7 A;  4HAY B;  3F0W A;  1U5F A;  4DX9 0;  3SNH A;  5LON B;  4MT7 A;  2YT0 A;  1V5P A;  2YS1 A;  4TKN A;  1DBH A;  3PP2 A;  2Z0O A;  2UVM A;  4PNK A;  3HQC A;  1P6S A;  1WJM A;  2H7E A;  5J3Y A;  3ULB A;  1J19 A;  2ELA A;  4A6F B;  1PFJ A;  2R09 A;  3X23 A;  5D3X A;  3P6A A;  4A5K A;  4IFS A;  2I5F A;  1XX0 A;  1XCG A;  2MFQ A;  3A98 B;  1WJ1 A;  2I1J A;  1P3R A;  2YS5 A;  2HE7 A;  2RGN B;  5DH9 B;  2MKR A;  2R0D A;  4HDO A;  1GC6 A;  3DXD A;  2JP2 A;  4KHO A;  5FI1 A;  1U5G A;  1FHX A;  1MK9 B;  3AJ4 A;  2EMS A;  4H8S A;  3KSY A;  1X11 A;  2M14 A;  4HB2 B;  4MK0 A;  1W1G A;  3QWM A;  2N23 A;  2Y7B A;  4ZRK A;  1FGY A;  3N7C A;  4HAT B;  3LJU X;  1EAZ A;  4HAW B;  2DTC A;  3TCA A;  1V89 A;  5GOW B;  3V5W A;  4GN1 A;  4HDQ A;  2P0H A;  3SO6 A;  2MDX A;  3D8F A;  1GG3 A;  2CAY A;  2COD A;  1BTK A;  1UNP A;  3AU5 A;  2UZS A;  2DKQ A;  3TFM A;  1V88 A;  2UZR A;  4GMV A;  4HB0 B;  3U7D A;  1V5U A;  3IVF A;  3ML4 A;  2W2X D;  2RVB B;  3MPX A;  1NTY A;  3O96 A;  3BJI A;  4GPT B;  1MK7 B;  1Q67 A;  1N3H A;  2Z0P A;  1BWN A;  2MWN B;  1MIZ B;  3OAN A;  1I7A A;  4K2O A;  1XKE A;  1OQN A;  2DHI A;  2Y8F A;  1M7R A;  5J3T A;  2LG1 A;  2LKO A;  1W1H A;  2DHK A;  2W2W A;  4HAV B;  2QKM A;  1K5D B;  2LUL A;  2D4Q A;  4KVG B;  1SGH A;  2NMB A;  3TVV A;  2L2I A;  1U5D A;  2GS0 A;  2RLO A;  2P0F A;  1LB1 A;  3FSS A;  2DX5 A;  2E2X A;  3SYX A;  3G9W A;  3DXC A;  1ZC3 B;  4KAX B;  5DIF B;  5D27 A;  5C5B A;  5JP4 A;  1ZVR A;  1ZM0 A;  2ZPY A;  3GYP A;  4GMX B;  3FM8 C;  4BBK A;  1FOE A;  4EJN A;  1UPQ A;  4DX8 A;  1NU2 A;  1X1G A;  1FAO A;  2D9Z A;  2EJ8 A;  4K81 A;  4YON A;  4F7U P;  2DYQ A;  5C16 A;  3WYF B;  2ADZ A;  2KGX B;  3PZD A;  2P0D A;  3NSU A;  4CHM A;  1TQZ A;  2Y8G A;  2LYD A;  4DBB A;  3FEH A;  4K17 A;  2D9Y A;  3PEG A;  3A8Q A;  4KHB B;  2DYN A;  3AU4 A;  2X18 A;  2ROV A;  1UNR A;  1MPH A;  3HK0 A;  1KI1 B;  1V61 A;  2P8V A;  4WJ7 A;  5CLQ B;  3M1I B;  4C0A A;  4HAZ B;  3RCP A;  4YL8 A;  5C6R A;  2HTH B;  3WA0 A;  1J0W A;  1FHO A;  1WGQ A;  3D8E A;  3KRW A;  5CLL B;  2NZ8 B;  1DDM A;  5DHF B;  2D2Q A;  2BCJ A;  4WVF B;  4Y94 A;  5HE0 A;  3T06 A;  3ODX A;  1MIX A;  1AQC A;  3PVL A;  4GXB A;  1LW3 A;  1EF1 A;  1PMS A;  1WVH A;  5LOP B;  1BTN A;  1GC7 A;  2DFK A;  4HB3 B;  3DXE A;  2V76 A;  1DYN A;  2KUP A;  3KY9 A;  1H10 A;  4HHV A;  1E5W A;  5KQ4 A;  1W1D A;  5JHG A;  1BAK A;  3VOQ A;  3ODO A;  1DDV A;  2K00 A;  2LOX A;  1Y5O A;  2RSG A;  1MAI A;  3KRX A;  3PVU A;  1FGZ A;  2D11 A;  2COF A;  1KZG A;  1WGU A;  4F7G A;  3UZT A;  1EGX A;  2RUK B;  2M38 A;  4F7H A;  2CRF A;  3CXB B;  2N0Y A;  3ODW A;  2DA0 A;  2OQB A;  2J0M A;  1I2H A;  1Z87 A;  2VSZ A;  3ULC A;  4MY6 A;  1H4R A;  4CHJ A;  2DHJ A;  2Z0Q A;  5C5B B;  2L1C A;  4A6H A;  2DLW A;  4P7I A;  4EKU A;  4NSW A;  1TXD A;  2YT1 A;  4K2P A;  3D8D A;  4GZU A;  3KZ1 A;  3HW2 B;  2D9X A;  2VRW B;  2J59 M;  4XWX A;  4PQ0 A;  3PG7 A;  5HE1 A;  2YF0 A;  3ZVR A;  1KZ7 A;  1IRS A;  1UEF A;  2YVC A;  4DXA B;  1RRP B;  4KHA A;  1U2B A;  2VKI A;  2GJY A;  4D0N B;  1P5T A;  2J0J A;  1PLS A;  4WSF A;  1XR0 B;  5D3V A;  1ISN A;  4Z2N A;  4IOY X;  5D3Y A;  1NTV A;  1UPR A;  1AWE A;  2H7D A;  2J0K A;  2IYB A;  2YS3 A;  5EFX A;  2GCL A;  1U29 A;  1X86 A;  3SV1 A;  4Z2M B;  5KCV A;  4A6F A;  1K5G B;  1TJ6 A;  4TYZ A;  1X1F A;  2G35 A;  4HAX B;  5C79 A;  1XD4 A;  2D9V A;  5HE2 A;  1QQG A;  4A6K A;  2D9W A;  3CIK A;  3BIN A;  1QC6 A;  2I1K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...