3F0WA

Human numb-like protein, phosphotyrosine interaction domain
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
155
structure length
153
Chain Sequence
DLGTENLYFQSMASRPHQWQADEDAVRKGTCSFPVRYLGHVEVEESRGMHVCEDAVKKLKAMGSVKSVLWVSADGLRVVDDKTKDLLVDQTIEKVSFCAPDRNLDKAFSYICRDGTTRRWICHCFLALKDSGERLSHAVGCAFAACLERKQRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Human NUMB-like protein, phosphotyrosine interaction domain
rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Numb-like protein
total genus 39
structure length 153
sequence length 155
ec nomenclature
pdb deposition date 2008-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00640 PID Phosphotyrosine interaction domain (PTB/PID)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3f0wA00
3KRXA 3ODOA 3DXCA 4Z2NA 3PEGA 5D3WA 1U5EA 2GJYA 1I7AA 3PVUA 3DXEA 4KHBB 4C0AA 1XKEA 1Z87A 3A8PA 2P0FA 2NZ8B 2DYQA 2DA0A 1PMSA 1FAOA 1KZ7A 2DHIA 2D11A 2YSZA 5DIFB 1UPQA 2DHJA 2D9WA 1V5PA 3CXBB 1ZC3B 4HAUB 1WI1A 3ULBA 3HQCA 2H7DA 1UNPA 2W2XC 4TYZA 1MK7B 1B55A 2AEHA 2L1CA 4IOYX 3AU5A 5DI9B 2GS0A 1PFJA 2EJ8A 3A98B 3F0WA 2GCLA 2UZSA 4MK0A 2G35A 1V5MA 2DX1A 1TQZA 4HB0B 1OY2A 5JP4A 2DKQA 1E5WA 2N23A 1BTNA 1WG7A 3P7ZA 1WGUA 5DHFB 2M38A 3WA0A 4PNKA 3CIKA 5J3YA 1QQGA 2ELBA 4GMVA 2IFSA 2K00A 4HDQA 2YT1A 3BJIA 1RRPB 1X1FA 4K81A 1ZVRA 2D9VA 3ZVRA 1X05A 3SYXA 2YRYA 4NSWA 2P0DA 4ZRIA 1U5DA 3AJ4A 2IYBA 2P8VA 4CYEA 1M7RA 4DXAB 2OQBA 4KAXB 4B6HA 5JLJB 4EMOA 4TKNA 3P6AA 1FHOA 4HB3B 1OQNA 2VKIA 2LYDA 2Q13A 5GOWB 1FHWA 4DBBA 4XWXA 3TFMA 3PVLA 3AU4A 2RUKB 1RJ2A 2I1JA 2EMTA 2J0JA 4KHOA 1Y5OA 1W1HA 1MAIA 1MIXA 5C6RA 1EVHA 2MWNB 2CODA 2XQNM 4A6FA 3DXDA 3PP2A 3ODWA 2ROVA 1DROA 2EMSA 2LOZA 1P6SA 3HW2B 1IRSA 1XR0B 4WSFA 1BAKA 5KCVA 2CRFA 3D8FA 1UNQA 3U7DA 4HAZB 1SHCA 3FEHA 3ML4A 5D3VA 5HE2A 1DDWA 2YT0A 1FHXA 3F5RA 4GZUA 1U5GA 1H4RA 1UEFA 2Y8FA 2VRWB 2UZRA 2H7EA 1Q67A 1XCGA 2D9YA 3FM8C 2D4QA 2X18A 1U5FA 1EGXA 1BWNA 3SNHA 2I5FA 5HE1A 4H8SA 2LKOA 3MPXA 4D0NB 2DHKA 2J0MA 1LW3A 2Y8GA 4DX90 2COFA 4CHJA 2D9ZA 2L2IA 2RVBB 3PZDA 3NSUA 3TO1A 3ZDTA 3ULCA 4A6HA 4A5KA 4WVFB 4A6FB 4HAVB 4K17A 1MK9B 1NTYA 5J3TA 3SO6A 4GN1A 1V5UA 1U29A 3TCAA 3KY9A 3MDBC 2W2XD 3ODXA 2DN6A 1M7EA 1K5GB 2Z0OA 4HB2B 4Y94A 1FB8A 3O96A 2EC1A 2I1KA 2KGXB 3LJUX 3A8QA 1WJMA 3IVFA 4GXBA 2MDXA 5C16A 1FGZA 1V88A 5EFXA 2JP2A 2YS5A 4HHVA 2COCA 1UPRA 5KQ1A 1NTVA 5DH9B 4HDOA 1H10A 4EKUA 2DLWA 2W2WA 2Z0PA 2K2JA 4EJNA 2KCJA 2D10A 4A6KA 2NMBA 2HTHB 1FOEA 2DYNA 1LB1A 2AL6A 3KZ1A 3D8DA 4HAWB 2BCJA 3M1IB 3VOQA 1AQCA 1EAZA 3V5WA 4K2OA 1XX0A 1BTKA 2GCJA 5C5BA 5C79A 1EF1A 1TXDA 5L81A 1XD4A 1ZSQA 1Y19B 4IAPA 5DHAB 2J0KA 1U2BA 3PSCA 1MPHA 2J59M 2RGNB 4YONA 1I2HA 2COAA 2RSGA 1P5TA 5FI0A 2Z0QA 3N7CA 1X11A 2MKRA 4HATB 2CY5A 2V76A 2LG1A 4F7UP 4ZRKA 5C5BB 3U8ZA 2R09A 4NY0A 3UZTA 2D9XA 2YF0A 4HAXB 1DBHA 2Y7BA 3TVVA 3G9WA 1U27A 2OTXA 4KHAA 2MFQA 1N3HA 1WJ1A 5HE3A 3VIAA 1PLSA 3PVWA 1MIZB 4CHMA 2QKLA 1K5DB 1W1DA 4PQ0A 5FI1A 2CAYA 1XODA 5LOPB 3KRWA 1UNRA 2ZPYA 3T06A 4IFSA 3GYOA 3TW1A 4MT7A 1J0WA 4HAYB 5CLLB 4K2PA 1P3RA 5JHHA 1NI2A 4MY6A 1MKEA 3QIJA 5CLQB 1J19A 4HB4B 2N0YA 2ELAA 2HE7A 1QC6A 3FSSA 1SGHA 2D2QA 3KSYA 1V61A 2ADZA 5D3YA 2KUPA 3GYPA 4GMXB 5LONB 2M14A 2LULA 3WYFB 4L6EA 1DDMA 1FGYA 3PG7A 2P0HA 1ZC4B 2DX5A 4F7GA 5JHGA 1ZM0A 3SV1A 2DFKA 2VSZA 1ISNA 5D3XA 1DDVA 1X86A 1KI1B 1WVHA 3D8EA 5D27A 3RCPA 5HE0A 1KZGA 3QBVB 2K2UA 2YS1A 3X23A 2FJLA 2YS3A 2LOXA 5KQ4A 3OANA 1GC6A 2PZ1A 1AWEA 1GG3A 1W1GA 2DTCA 1DYNA 5J3QA 2DKPA 2I5CA 2E2XA 2YVCA 2CY4A 4WJ7A 4BBKA 1GC7A 4GPTB 2UVMA 4ZRJA 2ROZB 1X1GA 1WGQA 4P7IA 1V89A 3QWMA 4Z2MB 4DX8A 2RLOA 2QKMA 3SUZA 2R0DA 1TJ6A 1OMWA 2RNRB 4F7HA 3HK0A 3BINA 1NU2A 4YL8A 4KVGB
chains in the Genus database with same CATH superfamily
3KRXA 3ODOA 4HSIA 3DXCA 4Z2NA 3PEGA 5D3WA 1U5EA 2GJYA 1I7AA 3PVUA 3DXEA 4KHBB 4C0AA 1XKEA 1Z87A 3A8PA 2P0FA 2NZ8B 2DYQA 2DA0A 1PMSA 1FAOA 1KZ7A 2DHIA 2D11A 2YSZA 5DIFB 1UPQA 2DHJA 2D9WA 1V5PA 2KUQA 3CXBB 3OHMB 1ZC3B 4HAUB 1WI1A 3ULBA 3HQCA 2H7DA 3NWDA 1UNPA 2Z59A 2W2XC 4TYZA 1MK7B 1B55A 2AEHA 2L1CA 4IOYX 3AU5A 5DI9B 2GS0A 1PFJA 2EJ8A 3A98B 3F0WA 2GCLA 2UZSA 4MK0A 2G35A 1V5MA 2DX1A 1TQZA 4OT1A 4HB0B 1OY2A 5JP4A 2DKQA 1E5WA 2N23A 4L1RA 1BTNA 1WG7A 3P7ZA 1WGUA 5DHFB 2M38A 1MI1A 3WA0A 2RRFA 4PNKA 3CIKA 5J3YA 2KR0A 1QQGA 2ELBA 4GMVA 2IFSA 2K00A 2YT1A 4HDQA 3BJIA 1RRPB 1X1FA 4K81A 1ZVRA 2D9VA 5I2MA 3ZVRA 1X05A 3SYXA 3U12A 2YRYA 4NSWA 2P0DA 4ZRIA 1U5DA 3AJ4A 2IYBA 2P8VA 4CYEA 1M7RA 1ZYIA 4DXAB 2OQBA 3DCXA 4KAXB 4B6HA 5JLJB 4EMOA 4QJ4B 4TKNA 4QJ3B 3A58A 3NW8A 5I2SA 3P6AA 1FHOA 4HB3B 1OQNA 2VKIA 2LYDA 2Q13A 4GOUA 5GOWB 1FHWA 4DBBA 4XWXA 3TFMA 3PVLA 3AU4A 2KIEA 2RUKB 1RJ2A 2I1JA 2EMTA 2J0JA 4KHOA 1Y5OA 1W1HA 1MAIA 1MIXA 5C6RA 1EVHA 2MWNB 2CODA 2XQNM 4A6FA 3DXDA 3PP2A 3ODWA 2ROVA 1DROA 2EMSA 2LOZA 1P6SA 3HW2B 1IRSA 1XR0B 4WSFA 1BAKA 5KCVA 2CRFA 3D8FA 1UNQA 3U7DA 4HAZB 1SHCA 3FEHA 3ML4A 5D3VA 5HE2A 1DDWA 2YT0A 1FHXA 3F5RA 4QXAB 4GZUA 1U5GA 1H4RA 1UEFA 2Y8FA 2VRWB 2UZRA 2H7EA 1Q67A 1XCGA 2D9YA 3FM8C 2D4QA 2X18A 1U5FA 1EGXA 1BWNA 3SNHA 2I5FA 5HE1A 2Z4DA 4H8SA 2LKOA 3MPXA 4D0NB 2DHKA 5M4YB 2J0MA 1LW3A 2Y8GA 4DX90 2COFA 4CHJA 2D9ZA 2L2IA 2RVBB 3PZDA 3NSUA 3TO1A 3ZDTA 3ULCA 4A6HA 4A5KA 4WVFB 4A6FB 4HAVB 4K17A 1MK9B 1NTYA 5J3TA 4DIXA 3SO6A 4GN1A 1V5UA 1U29A 3TCAA 3KY9A 3MDBC 2W2XD 3ODXA 5LG4B 2DN6A 1M7EA 1K5GB 2Z0OA 1T77A 4HB2B 4Y94A 1FB8A 3O96A 2EC1A 2I1KA 2KGXB 3LJUX 3A8QA 1WJMA 3IVFA 4GXBA 2MDXA 2GUMA 4CSQA 5C16A 1FGZA 1V88A 5EFXA 2JP2A 2YS5A 4HHVA 2COCA 1UPRA 5KQ1A 1NTVA 5DH9B 2KIGA 4HDOA 4QJ5B 1H10A 4EKUA 2DLWA 2W2WA 2Z0PA 2K2JA 4EJNA 2KCJA 2D10A 4A6KA 2NMBA 2HTHB 1FOEA 2DYNA 1LB1A 3B77A 2AL6A 3KZ1A 3D8DA 4HAWB 2BCJA 3M1IB 3VOQA 1AQCA 1EAZA 3V5WA 4K2OA 1XX0A 1BTKA 2GCJA 5C5BA 5C79A 1EF1A 1TXDA 5L81A 4D6WA 1XD4A 1ZSQA 1Y19B 4GNKB 2YT2A 4IAPA 2J0KA 5DHAB 1U2BA 2NBVA 3PSCA 1MPHA 2J59M 2RGNB 3NWFA 4YONA 1I2HA 2COAA 2RSGA 1P5TA 5FI0A 2Z0QA 3N7CA 1X11A 2MKRA 4HATB 2K8EA 2CY5A 2V76A 2LG1A 4F7UP 4ZRKA 5C5BB 3U8ZA 2R09A 4NY0A 3UZTA 2D9XA 2YF0A 4HAXB 1DBHA 2Y7BA 3TVVA 3G9WA 1U27A 2OTXA 4KHAA 2MFQA 1N3HA 1WJ1A 5HE3A 3VIAA 1PLSA 3PVWA 1MIZB 4CHMA 2QKLA 1K5DB 1W1DA 4PQ0A 5FI1A 2CAYA 1XODA 5LOPB 3KRWA 1UNRA 2ZPYA 3T06A 2Z13A 4IFSA 3GYOA 3TW1A 4MT7A 1J0WA 4HAYB 5CLLB 4KHBA 4K2PA 1P3RA 5JHHA 1NI2A 4MY6A 1MKEA 3QIJA 5CLQB 1J19A 4HB4B 5IRSA 2N0YA 2ELAA 2HE7A 1QC6A 3FSSA 1SGHA 2D2QA 3KSYA 1V61A 2ADZA 5D3YA 2KUPA 3NWAA 3GYPA 2K49A 4GMXB 5LONB 2M14A 2LULA 3WYFB 4L6EA 1DDMA 1FGYA 3PG7A 4OSNA 2P0HA 1ZC4B 2DX5A 4F7GA 5JHGA 1ZM0A 3SV1A 2DFKA 2VSZA 1ISNA 5D3XA 1DDVA 1X86A 1KI1B 1WVHA 3D8EA 5D27A 3RCPA 5HE0A 1KZGA 3QBVB 2K2UA 2YS1A 2R2YA 3X23A 2FJLA 2FJUB 2YS3A 2LOXA 5KQ4A 3OANA 1GC6A 2PZ1A 1AWEA 1GG3A 1W1GA 2DTCA 3HSAA 1DYNA 5J3QA 2DKPA 2I5CA 2E2XA 2YVCA 2CY4A 4WJ7A 4BBKA 1GC7A 2Z14A 4GPTB 2UVMA 4ZRJA 2ROZB 1X1GA 1WGQA 4P7IA 3FVCA 1V89A 3QWMA 3HIEA 4Z2MB 4DX8A 2RLOA 2QKMA 3SUZA 2R0DA 1TJ6A 1OMWA 2RNRB 4F7HA 3HK0A 3BINA 1NU2A 4YL8A 4KVGB 2ZKMX
chains in the Genus database with same CATH topology
3KRXA 3ODOA 3DXCA 4Z2NA 3PEGA 5D3WA 1U5EA 2GJYA 1I7AA 3PVUA 3DXEA 4KHBB 4C0AA 1XKEA 1Z87A 3A8PA 2P0FA 2NZ8B 2DYQA 2DA0A 1PMSA 1FAOA 1KZ7A 2DHIA 2D11A 2YSZA 5DIFB 1UPQA 2DHJA 2D9WA 1V5PA 3CXBB 1ZC3B 4HAUB 1WI1A 3ULBA 3HQCA 2H7DA 1UNPA 2W2XC 4TYZA 1MK7B 1B55A 2AEHA 2L1CA 4IOYX 3AU5A 5DI9B 2GS0A 1PFJA 2EJ8A 3A98B 3F0WA 2GCLA 2UZSA 4MK0A 2G35A 1V5MA 2DX1A 1TQZA 4HB0B 1OY2A 5JP4A 2DKQA 1E5WA 2N23A 1BTNA 1WG7A 3P7ZA 1WGUA 5DHFB 2M38A 3WA0A 4PNKA 3CIKA 5J3YA 1QQGA 2ELBA 4GMVA 2IFSA 2K00A 4HDQA 2YT1A 3BJIA 1RRPB 1X1FA 4K81A 1ZVRA 2D9VA 3ZVRA 1X05A 3SYXA 2YRYA 4NSWA 2P0DA 4ZRIA 1U5DA 3AJ4A 2IYBA 2P8VA 4CYEA 1M7RA 4DXAB 2OQBA 4KAXB 4B6HA 5JLJB 4EMOA 4TKNA 3P6AA 1FHOA 4HB3B 1OQNA 2VKIA 2LYDA 2Q13A 5GOWB 1FHWA 4DBBA 4XWXA 3TFMA 3PVLA 3AU4A 2RUKB 1RJ2A 2I1JA 2EMTA 2J0JA 4KHOA 1Y5OA 1W1HA 1MAIA 1MIXA 5C6RA 1EVHA 2MWNB 2CODA 2XQNM 4A6FA 3DXDA 3PP2A 3ODWA 2ROVA 1DROA 2EMSA 2LOZA 1P6SA 3HW2B 1IRSA 1XR0B 4WSFA 1BAKA 5KCVA 2CRFA 3D8FA 1UNQA 3U7DA 4HAZB 1SHCA 3FEHA 3ML4A 5D3VA 5HE2A 1DDWA 2YT0A 1FHXA 3F5RA 4GZUA 1U5GA 1H4RA 1UEFA 2Y8FA 2VRWB 2UZRA 2H7EA 1Q67A 1XCGA 2D9YA 3FM8C 2D4QA 2X18A 1U5FA 1EGXA 1BWNA 3SNHA 2I5FA 5HE1A 4H8SA 2LKOA 3MPXA 4D0NB 2DHKA 2J0MA 1LW3A 2Y8GA 4DX90 2COFA 4CHJA 2D9ZA 2L2IA 2RVBB 3PZDA 3NSUA 3TO1A 3ZDTA 3ULCA 4A6HA 4A5KA 4WVFB 4A6FB 4HAVB 4K17A 1MK9B 1NTYA 5J3TA 3SO6A 4GN1A 1V5UA 1U29A 3TCAA 3KY9A 3MDBC 2W2XD 3ODXA 2DN6A 1M7EA 1K5GB 2Z0OA 4HB2B 4Y94A 1FB8A 3O96A 2EC1A 2I1KA 2KGXB 3LJUX 3A8QA 1WJMA 3IVFA 4GXBA 2MDXA 5C16A 1FGZA 1V88A 5EFXA 2JP2A 2YS5A 4HHVA 2COCA 1UPRA 5KQ1A 1NTVA 5DH9B 4HDOA 1H10A 4EKUA 2DLWA 2W2WA 2Z0PA 2K2JA 4EJNA 2KCJA 2D10A 4A6KA 2NMBA 2HTHB 1FOEA 2DYNA 1LB1A 2AL6A 3KZ1A 3D8DA 4HAWB 2BCJA 3M1IB 3VOQA 1AQCA 1EAZA 3V5WA 4K2OA 1XX0A 1BTKA 2GCJA 5C5BA 5C79A 1EF1A 1TXDA 5L81A 1XD4A 1ZSQA 1Y19B 4IAPA 5DHAB 2J0KA 1U2BA 3PSCA 1MPHA 2J59M 2RGNB 4YONA 1I2HA 2COAA 2RSGA 1P5TA 5FI0A 2Z0QA 3N7CA 1X11A 2MKRA 4HATB 2CY5A 2V76A 2LG1A 4F7UP 4ZRKA 5C5BB 3U8ZA 2R09A 4NY0A 3UZTA 2D9XA 2YF0A 4HAXB 1DBHA 2Y7BA 3TVVA 3G9WA 1U27A 2OTXA 4KHAA 2MFQA 1N3HA 1WJ1A 5HE3A 3VIAA 1PLSA 3PVWA 1MIZB 4CHMA 2QKLA 1K5DB 1W1DA 4PQ0A 5FI1A 2CAYA 1XODA 5LOPB 3KRWA 1UNRA 2ZPYA 3T06A 4IFSA 3GYOA 3TW1A 4MT7A 1J0WA 4HAYB 5CLLB 4K2PA 1P3RA 5JHHA 1NI2A 4MY6A 1MKEA 3QIJA 5CLQB 1J19A 4HB4B 2N0YA 2ELAA 2HE7A 1QC6A 3FSSA 1SGHA 2D2QA 3KSYA 1V61A 2ADZA 5D3YA 2KUPA 3GYPA 4GMXB 5LONB 2M14A 2LULA 3WYFB 4L6EA 1DDMA 1FGYA 3PG7A 2P0HA 1ZC4B 2DX5A 4F7GA 5JHGA 1ZM0A 3SV1A 2DFKA 2VSZA 1ISNA 5D3XA 1DDVA 1X86A 1KI1B 1WVHA 3D8EA 5D27A 3RCPA 5HE0A 1KZGA 3QBVB 2K2UA 2YS1A 3X23A 2FJLA 2YS3A 2LOXA 5KQ4A 3OANA 1GC6A 2PZ1A 1AWEA 1GG3A 1W1GA 2DTCA 1DYNA 5J3QA 2DKPA 2I5CA 2E2XA 2YVCA 2CY4A 4WJ7A 4BBKA 1GC7A 4GPTB 2UVMA 4ZRJA 2ROZB 1X1GA 1WGQA 4P7IA 1V89A 3QWMA 4Z2MB 4DX8A 2RLOA 2QKMA 3SUZA 2R0DA 1TJ6A 1OMWA 2RNRB 4F7HA 3HK0A 3BINA 1NU2A 4YL8A 4KVGB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KRX A;  3ODO A;  3DXC A;  4Z2N A;  3PEG A;  5D3W A;  1U5E A;  2GJY A;  1I7A A;  3PVU A;  3DXE A;  4KHB B;  4C0A A;  1XKE A;  1Z87 A;  3A8P A;  2P0F A;  2NZ8 B;  2DYQ A;  2DA0 A;  1PMS A;  1FAO A;  1KZ7 A;  2DHI A;  2D11 A;  2YSZ A;  5DIF B;  1UPQ A;  2DHJ A;  2D9W A;  1V5P A;  3CXB B;  1ZC3 B;  4HAU B;  1WI1 A;  3ULB A;  3HQC A;  2H7D A;  1UNP A;  2W2X C;  4TYZ A;  1MK7 B;  1B55 A;  2AEH A;  2L1C A;  4IOY X;  3AU5 A;  5DI9 B;  2GS0 A;  1PFJ A;  2EJ8 A;  3A98 B;  3F0W A;  2GCL A;  2UZS A;  4MK0 A;  2G35 A;  1V5M A;  2DX1 A;  1TQZ A;  4HB0 B;  1OY2 A;  5JP4 A;  2DKQ A;  1E5W A;  2N23 A;  1BTN A;  1WG7 A;  3P7Z A;  1WGU A;  5DHF B;  2M38 A;  3WA0 A;  4PNK A;  3CIK A;  5J3Y A;  1QQG A;  2ELB A;  4GMV A;  2IFS A;  2K00 A;  4HDQ A;  2YT1 A;  3BJI A;  1RRP B;  1X1F A;  4K81 A;  1ZVR A;  2D9V A;  3ZVR A;  1X05 A;  3SYX A;  2YRY A;  4NSW A;  2P0D A;  4ZRI A;  1U5D A;  3AJ4 A;  2IYB A;  2P8V A;  4CYE A;  1M7R A;  4DXA B;  2OQB A;  4KAX B;  4B6H A;  5JLJ B;  4EMO A;  4TKN A;  3P6A A;  1FHO A;  4HB3 B;  1OQN A;  2VKI A;  2LYD A;  2Q13 A;  5GOW B;  1FHW A;  4DBB A;  4XWX A;  3TFM A;  3PVL A;  3AU4 A;  2RUK B;  1RJ2 A;  2I1J A;  2EMT A;  2J0J A;  4KHO A;  1Y5O A;  1W1H A;  1MAI A;  1MIX A;  5C6R A;  1EVH A;  2MWN B;  2COD A;  2XQN M;  4A6F A;  3DXD A;  3PP2 A;  3ODW A;  2ROV A;  1DRO A;  2EMS A;  2LOZ A;  1P6S A;  3HW2 B;  1IRS A;  1XR0 B;  4WSF A;  1BAK A;  5KCV A;  2CRF A;  3D8F A;  1UNQ A;  3U7D A;  4HAZ B;  1SHC A;  3FEH A;  3ML4 A;  5D3V A;  5HE2 A;  1DDW A;  2YT0 A;  1FHX A;  3F5R A;  4GZU A;  1U5G A;  1H4R A;  1UEF A;  2Y8F A;  2VRW B;  2UZR A;  2H7E A;  1Q67 A;  1XCG A;  2D9Y A;  3FM8 C;  2D4Q A;  2X18 A;  1U5F A;  1EGX A;  1BWN A;  3SNH A;  2I5F A;  5HE1 A;  4H8S A;  2LKO A;  3MPX A;  4D0N B;  2DHK A;  2J0M A;  1LW3 A;  2Y8G A;  4DX9 0;  2COF A;  4CHJ A;  2D9Z A;  2L2I A;  2RVB B;  3PZD A;  3NSU A;  3TO1 A;  3ZDT A;  3ULC A;  4A6H A;  4A5K A;  4WVF B;  4A6F B;  4HAV B;  4K17 A;  1MK9 B;  1NTY A;  5J3T A;  3SO6 A;  4GN1 A;  1V5U A;  1U29 A;  3TCA A;  3KY9 A;  3MDB C;  2W2X D;  3ODX A;  2DN6 A;  1M7E A;  1K5G B;  2Z0O A;  4HB2 B;  4Y94 A;  1FB8 A;  3O96 A;  2EC1 A;  2I1K A;  2KGX B;  3LJU X;  3A8Q A;  1WJM A;  3IVF A;  4GXB A;  2MDX A;  5C16 A;  1FGZ A;  1V88 A;  5EFX A;  2JP2 A;  2YS5 A;  4HHV A;  2COC A;  1UPR A;  5KQ1 A;  1NTV A;  5DH9 B;  4HDO A;  1H10 A;  4EKU A;  2DLW A;  2W2W A;  2Z0P A;  2K2J A;  4EJN A;  2KCJ A;  2D10 A;  4A6K A;  2NMB A;  2HTH B;  1FOE A;  2DYN A;  1LB1 A;  2AL6 A;  3KZ1 A;  3D8D A;  4HAW B;  2BCJ A;  3M1I B;  3VOQ A;  1AQC A;  1EAZ A;  3V5W A;  4K2O A;  1XX0 A;  1BTK A;  2GCJ A;  5C5B A;  5C79 A;  1EF1 A;  1TXD A;  5L81 A;  1XD4 A;  1ZSQ A;  1Y19 B;  4IAP A;  5DHA B;  2J0K A;  1U2B A;  3PSC A;  1MPH A;  2J59 M;  2RGN B;  4YON A;  1I2H A;  2COA A;  2RSG A;  1P5T A;  5FI0 A;  2Z0Q A;  3N7C A;  1X11 A;  2MKR A;  4HAT B;  2CY5 A;  2V76 A;  2LG1 A;  4F7U P;  4ZRK A;  5C5B B;  3U8Z A;  2R09 A;  4NY0 A;  3UZT A;  2D9X A;  2YF0 A;  4HAX B;  1DBH A;  2Y7B A;  3TVV A;  3G9W A;  1U27 A;  2OTX A;  4KHA A;  2MFQ A;  1N3H A;  1WJ1 A;  5HE3 A;  3VIA A;  1PLS A;  3PVW A;  1MIZ B;  4CHM A;  2QKL A;  1K5D B;  1W1D A;  4PQ0 A;  5FI1 A;  2CAY A;  1XOD A;  5LOP B;  3KRW A;  1UNR A;  2ZPY A;  3T06 A;  4IFS A;  3GYO A;  3TW1 A;  4MT7 A;  1J0W A;  4HAY B;  5CLL B;  4K2P A;  1P3R A;  5JHH A;  1NI2 A;  4MY6 A;  1MKE A;  3QIJ A;  5CLQ B;  1J19 A;  4HB4 B;  2N0Y A;  2ELA A;  2HE7 A;  1QC6 A;  3FSS A;  1SGH A;  2D2Q A;  3KSY A;  1V61 A;  2ADZ A;  5D3Y A;  2KUP A;  3GYP A;  4GMX B;  5LON B;  2M14 A;  2LUL A;  3WYF B;  4L6E A;  1DDM A;  1FGY A;  3PG7 A;  2P0H A;  1ZC4 B;  2DX5 A;  4F7G A;  5JHG A;  1ZM0 A;  3SV1 A;  2DFK A;  2VSZ A;  1ISN A;  5D3X A;  1DDV A;  1X86 A;  1KI1 B;  1WVH A;  3D8E A;  5D27 A;  3RCP A;  5HE0 A;  1KZG A;  3QBV B;  2K2U A;  2YS1 A;  3X23 A;  2FJL A;  2YS3 A;  2LOX A;  5KQ4 A;  3OAN A;  1GC6 A;  2PZ1 A;  1AWE A;  1GG3 A;  1W1G A;  2DTC A;  1DYN A;  5J3Q A;  2DKP A;  2I5C A;  2E2X A;  2YVC A;  2CY4 A;  4WJ7 A;  4BBK A;  1GC7 A;  4GPT B;  2UVM A;  4ZRJ A;  2ROZ B;  1X1G A;  1WGQ A;  4P7I A;  1V89 A;  3QWM A;  4Z2M B;  4DX8 A;  2RLO A;  2QKM A;  3SUZ A;  2R0D A;  1TJ6 A;  1OMW A;  2RNR B;  4F7H A;  3HK0 A;  3BIN A;  1NU2 A;  4YL8 A;  4KVG B; 
#chains in the Genus database with same CATH topology
 3KRX A;  3ODO A;  4HSI A;  3DXC A;  4Z2N A;  3PEG A;  5D3W A;  1U5E A;  2GJY A;  1I7A A;  3PVU A;  3DXE A;  4KHB B;  4C0A A;  1XKE A;  1Z87 A;  3A8P A;  2P0F A;  2NZ8 B;  2DYQ A;  2DA0 A;  1PMS A;  1FAO A;  1KZ7 A;  2DHI A;  2D11 A;  2YSZ A;  5DIF B;  1UPQ A;  2DHJ A;  2D9W A;  1V5P A;  2KUQ A;  3CXB B;  3OHM B;  1ZC3 B;  4HAU B;  1WI1 A;  3ULB A;  3HQC A;  2H7D A;  3NWD A;  1UNP A;  2Z59 A;  2W2X C;  4TYZ A;  1MK7 B;  1B55 A;  2AEH A;  2L1C A;  4IOY X;  3AU5 A;  5DI9 B;  2GS0 A;  1PFJ A;  2EJ8 A;  3A98 B;  3F0W A;  2GCL A;  2UZS A;  4MK0 A;  2G35 A;  1V5M A;  2DX1 A;  1TQZ A;  4OT1 A;  4HB0 B;  1OY2 A;  5JP4 A;  2DKQ A;  1E5W A;  2N23 A;  4L1R A;  1BTN A;  1WG7 A;  3P7Z A;  1WGU A;  5DHF B;  2M38 A;  1MI1 A;  3WA0 A;  2RRF A;  4PNK A;  3CIK A;  5J3Y A;  2KR0 A;  1QQG A;  2ELB A;  4GMV A;  2IFS A;  2K00 A;  2YT1 A;  4HDQ A;  3BJI A;  1RRP B;  1X1F A;  4K81 A;  1ZVR A;  2D9V A;  5I2M A;  3ZVR A;  1X05 A;  3SYX A;  3U12 A;  2YRY A;  4NSW A;  2P0D A;  4ZRI A;  1U5D A;  3AJ4 A;  2IYB A;  2P8V A;  4CYE A;  1M7R A;  1ZYI A;  4DXA B;  2OQB A;  3DCX A;  4KAX B;  4B6H A;  5JLJ B;  4EMO A;  4QJ4 B;  4TKN A;  4QJ3 B;  3A58 A;  3NW8 A;  5I2S A;  3P6A A;  1FHO A;  4HB3 B;  1OQN A;  2VKI A;  2LYD A;  2Q13 A;  4GOU A;  5GOW B;  1FHW A;  4DBB A;  4XWX A;  3TFM A;  3PVL A;  3AU4 A;  2KIE A;  2RUK B;  1RJ2 A;  2I1J A;  2EMT A;  2J0J A;  4KHO A;  1Y5O A;  1W1H A;  1MAI A;  1MIX A;  5C6R A;  1EVH A;  2MWN B;  2COD A;  2XQN M;  4A6F A;  3DXD A;  3PP2 A;  3ODW A;  2ROV A;  1DRO A;  2EMS A;  2LOZ A;  1P6S A;  3HW2 B;  1IRS A;  1XR0 B;  4WSF A;  1BAK A;  5KCV A;  2CRF A;  3D8F A;  1UNQ A;  3U7D A;  4HAZ B;  1SHC A;  3FEH A;  3ML4 A;  5D3V A;  5HE2 A;  1DDW A;  2YT0 A;  1FHX A;  3F5R A;  4QXA B;  4GZU A;  1U5G A;  1H4R A;  1UEF A;  2Y8F A;  2VRW B;  2UZR A;  2H7E A;  1Q67 A;  1XCG A;  2D9Y A;  3FM8 C;  2D4Q A;  2X18 A;  1U5F A;  1EGX A;  1BWN A;  3SNH A;  2I5F A;  5HE1 A;  2Z4D A;  4H8S A;  2LKO A;  3MPX A;  4D0N B;  2DHK A;  5M4Y B;  2J0M A;  1LW3 A;  2Y8G A;  4DX9 0;  2COF A;  4CHJ A;  2D9Z A;  2L2I A;  2RVB B;  3PZD A;  3NSU A;  3TO1 A;  3ZDT A;  3ULC A;  4A6H A;  4A5K A;  4WVF B;  4A6F B;  4HAV B;  4K17 A;  1MK9 B;  1NTY A;  5J3T A;  4DIX A;  3SO6 A;  4GN1 A;  1V5U A;  1U29 A;  3TCA A;  3KY9 A;  3MDB C;  2W2X D;  3ODX A;  5LG4 B;  2DN6 A;  1M7E A;  1K5G B;  2Z0O A;  1T77 A;  4HB2 B;  4Y94 A;  1FB8 A;  3O96 A;  2EC1 A;  2I1K A;  2KGX B;  3LJU X;  3A8Q A;  1WJM A;  3IVF A;  4GXB A;  2MDX A;  2GUM A;  4CSQ A;  5C16 A;  1FGZ A;  1V88 A;  5EFX A;  2JP2 A;  2YS5 A;  4HHV A;  2COC A;  1UPR A;  5KQ1 A;  1NTV A;  5DH9 B;  2KIG A;  4HDO A;  4QJ5 B;  1H10 A;  4EKU A;  2DLW A;  2W2W A;  2Z0P A;  2K2J A;  4EJN A;  2KCJ A;  2D10 A;  4A6K A;  2NMB A;  2HTH B;  1FOE A;  2DYN A;  1LB1 A;  3B77 A;  2AL6 A;  3KZ1 A;  3D8D A;  4HAW B;  2BCJ A;  3M1I B;  3VOQ A;  1AQC A;  1EAZ A;  3V5W A;  4K2O A;  1XX0 A;  1BTK A;  2GCJ A;  5C5B A;  5C79 A;  1EF1 A;  1TXD A;  5L81 A;  4D6W A;  1XD4 A;  1ZSQ A;  1Y19 B;  4GNK B;  2YT2 A;  4IAP A;  2J0K A;  5DHA B;  1U2B A;  2NBV A;  3PSC A;  1MPH A;  2J59 M;  2RGN B;  3NWF A;  4YON A;  1I2H A;  2COA A;  2RSG A;  1P5T A;  5FI0 A;  2Z0Q A;  3N7C A;  1X11 A;  2MKR A;  4HAT B;  2K8E A;  2CY5 A;  2V76 A;  2LG1 A;  4F7U P;  4ZRK A;  5C5B B;  3U8Z A;  2R09 A;  4NY0 A;  3UZT A;  2D9X A;  2YF0 A;  4HAX B;  1DBH A;  2Y7B A;  3TVV A;  3G9W A;  1U27 A;  2OTX A;  4KHA A;  2MFQ A;  1N3H A;  1WJ1 A;  5HE3 A;  3VIA A;  1PLS A;  3PVW A;  1MIZ B;  4CHM A;  2QKL A;  1K5D B;  1W1D A;  4PQ0 A;  5FI1 A;  2CAY A;  1XOD A;  5LOP B;  3KRW A;  1UNR A;  2ZPY A;  3T06 A;  2Z13 A;  4IFS A;  3GYO A;  3TW1 A;  4MT7 A;  1J0W A;  4HAY B;  5CLL B;  4KHB A;  4K2P A;  1P3R A;  5JHH A;  1NI2 A;  4MY6 A;  1MKE A;  3QIJ A;  5CLQ B;  1J19 A;  4HB4 B;  5IRS A;  2N0Y A;  2ELA A;  2HE7 A;  1QC6 A;  3FSS A;  1SGH A;  2D2Q A;  3KSY A;  1V61 A;  2ADZ A;  5D3Y A;  2KUP A;  3NWA A;  3GYP A;  2K49 A;  4GMX B;  5LON B;  2M14 A;  2LUL A;  3WYF B;  4L6E A;  1DDM A;  1FGY A;  3PG7 A;  4OSN A;  2P0H A;  1ZC4 B;  2DX5 A;  4F7G A;  5JHG A;  1ZM0 A;  3SV1 A;  2DFK A;  2VSZ A;  1ISN A;  5D3X A;  1DDV A;  1X86 A;  1KI1 B;  1WVH A;  3D8E A;  5D27 A;  3RCP A;  5HE0 A;  1KZG A;  3QBV B;  2K2U A;  2YS1 A;  2R2Y A;  3X23 A;  2FJL A;  2FJU B;  2YS3 A;  2LOX A;  5KQ4 A;  3OAN A;  1GC6 A;  2PZ1 A;  1AWE A;  1GG3 A;  1W1G A;  2DTC A;  3HSA A;  1DYN A;  5J3Q A;  2DKP A;  2I5C A;  2E2X A;  2YVC A;  2CY4 A;  4WJ7 A;  4BBK A;  1GC7 A;  2Z14 A;  4GPT B;  2UVM A;  4ZRJ A;  2ROZ B;  1X1G A;  1WGQ A;  4P7I A;  3FVC A;  1V89 A;  3QWM A;  3HIE A;  4Z2M B;  4DX8 A;  2RLO A;  2QKM A;  3SUZ A;  2R0D A;  1TJ6 A;  1OMW A;  2RNR B;  4F7H A;  3HK0 A;  3BIN A;  1NU2 A;  4YL8 A;  4KVG B;  2ZKM X; 
#chains in the Genus database with same CATH homology
 3KRX A;  3ODO A;  3DXC A;  4Z2N A;  3PEG A;  5D3W A;  1U5E A;  2GJY A;  1I7A A;  3PVU A;  3DXE A;  4KHB B;  4C0A A;  1XKE A;  1Z87 A;  3A8P A;  2P0F A;  2NZ8 B;  2DYQ A;  2DA0 A;  1PMS A;  1FAO A;  1KZ7 A;  2DHI A;  2D11 A;  2YSZ A;  5DIF B;  1UPQ A;  2DHJ A;  2D9W A;  1V5P A;  3CXB B;  1ZC3 B;  4HAU B;  1WI1 A;  3ULB A;  3HQC A;  2H7D A;  1UNP A;  2W2X C;  4TYZ A;  1MK7 B;  1B55 A;  2AEH A;  2L1C A;  4IOY X;  3AU5 A;  5DI9 B;  2GS0 A;  1PFJ A;  2EJ8 A;  3A98 B;  3F0W A;  2GCL A;  2UZS A;  4MK0 A;  2G35 A;  1V5M A;  2DX1 A;  1TQZ A;  4HB0 B;  1OY2 A;  5JP4 A;  2DKQ A;  1E5W A;  2N23 A;  1BTN A;  1WG7 A;  3P7Z A;  1WGU A;  5DHF B;  2M38 A;  3WA0 A;  4PNK A;  3CIK A;  5J3Y A;  1QQG A;  2ELB A;  4GMV A;  2IFS A;  2K00 A;  4HDQ A;  2YT1 A;  3BJI A;  1RRP B;  1X1F A;  4K81 A;  1ZVR A;  2D9V A;  3ZVR A;  1X05 A;  3SYX A;  2YRY A;  4NSW A;  2P0D A;  4ZRI A;  1U5D A;  3AJ4 A;  2IYB A;  2P8V A;  4CYE A;  1M7R A;  4DXA B;  2OQB A;  4KAX B;  4B6H A;  5JLJ B;  4EMO A;  4TKN A;  3P6A A;  1FHO A;  4HB3 B;  1OQN A;  2VKI A;  2LYD A;  2Q13 A;  5GOW B;  1FHW A;  4DBB A;  4XWX A;  3TFM A;  3PVL A;  3AU4 A;  2RUK B;  1RJ2 A;  2I1J A;  2EMT A;  2J0J A;  4KHO A;  1Y5O A;  1W1H A;  1MAI A;  1MIX A;  5C6R A;  1EVH A;  2MWN B;  2COD A;  2XQN M;  4A6F A;  3DXD A;  3PP2 A;  3ODW A;  2ROV A;  1DRO A;  2EMS A;  2LOZ A;  1P6S A;  3HW2 B;  1IRS A;  1XR0 B;  4WSF A;  1BAK A;  5KCV A;  2CRF A;  3D8F A;  1UNQ A;  3U7D A;  4HAZ B;  1SHC A;  3FEH A;  3ML4 A;  5D3V A;  5HE2 A;  1DDW A;  2YT0 A;  1FHX A;  3F5R A;  4GZU A;  1U5G A;  1H4R A;  1UEF A;  2Y8F A;  2VRW B;  2UZR A;  2H7E A;  1Q67 A;  1XCG A;  2D9Y A;  3FM8 C;  2D4Q A;  2X18 A;  1U5F A;  1EGX A;  1BWN A;  3SNH A;  2I5F A;  5HE1 A;  4H8S A;  2LKO A;  3MPX A;  4D0N B;  2DHK A;  2J0M A;  1LW3 A;  2Y8G A;  4DX9 0;  2COF A;  4CHJ A;  2D9Z A;  2L2I A;  2RVB B;  3PZD A;  3NSU A;  3TO1 A;  3ZDT A;  3ULC A;  4A6H A;  4A5K A;  4WVF B;  4A6F B;  4HAV B;  4K17 A;  1MK9 B;  1NTY A;  5J3T A;  3SO6 A;  4GN1 A;  1V5U A;  1U29 A;  3TCA A;  3KY9 A;  3MDB C;  2W2X D;  3ODX A;  2DN6 A;  1M7E A;  1K5G B;  2Z0O A;  4HB2 B;  4Y94 A;  1FB8 A;  3O96 A;  2EC1 A;  2I1K A;  2KGX B;  3LJU X;  3A8Q A;  1WJM A;  3IVF A;  4GXB A;  2MDX A;  5C16 A;  1FGZ A;  1V88 A;  5EFX A;  2JP2 A;  2YS5 A;  4HHV A;  2COC A;  1UPR A;  5KQ1 A;  1NTV A;  5DH9 B;  4HDO A;  1H10 A;  4EKU A;  2DLW A;  2W2W A;  2Z0P A;  2K2J A;  4EJN A;  2KCJ A;  2D10 A;  4A6K A;  2NMB A;  2HTH B;  1FOE A;  2DYN A;  1LB1 A;  2AL6 A;  3KZ1 A;  3D8D A;  4HAW B;  2BCJ A;  3M1I B;  3VOQ A;  1AQC A;  1EAZ A;  3V5W A;  4K2O A;  1XX0 A;  1BTK A;  2GCJ A;  5C5B A;  5C79 A;  1EF1 A;  1TXD A;  5L81 A;  1XD4 A;  1ZSQ A;  1Y19 B;  4IAP A;  5DHA B;  2J0K A;  1U2B A;  3PSC A;  1MPH A;  2J59 M;  2RGN B;  4YON A;  1I2H A;  2COA A;  2RSG A;  1P5T A;  5FI0 A;  2Z0Q A;  3N7C A;  1X11 A;  2MKR A;  4HAT B;  2CY5 A;  2V76 A;  2LG1 A;  4F7U P;  4ZRK A;  5C5B B;  3U8Z A;  2R09 A;  4NY0 A;  3UZT A;  2D9X A;  2YF0 A;  4HAX B;  1DBH A;  2Y7B A;  3TVV A;  3G9W A;  1U27 A;  2OTX A;  4KHA A;  2MFQ A;  1N3H A;  1WJ1 A;  5HE3 A;  3VIA A;  1PLS A;  3PVW A;  1MIZ B;  4CHM A;  2QKL A;  1K5D B;  1W1D A;  4PQ0 A;  5FI1 A;  2CAY A;  1XOD A;  5LOP B;  3KRW A;  1UNR A;  2ZPY A;  3T06 A;  4IFS A;  3GYO A;  3TW1 A;  4MT7 A;  1J0W A;  4HAY B;  5CLL B;  4K2P A;  1P3R A;  5JHH A;  1NI2 A;  4MY6 A;  1MKE A;  3QIJ A;  5CLQ B;  1J19 A;  4HB4 B;  2N0Y A;  2ELA A;  2HE7 A;  1QC6 A;  3FSS A;  1SGH A;  2D2Q A;  3KSY A;  1V61 A;  2ADZ A;  5D3Y A;  2KUP A;  3GYP A;  4GMX B;  5LON B;  2M14 A;  2LUL A;  3WYF B;  4L6E A;  1DDM A;  1FGY A;  3PG7 A;  2P0H A;  1ZC4 B;  2DX5 A;  4F7G A;  5JHG A;  1ZM0 A;  3SV1 A;  2DFK A;  2VSZ A;  1ISN A;  5D3X A;  1DDV A;  1X86 A;  1KI1 B;  1WVH A;  3D8E A;  5D27 A;  3RCP A;  5HE0 A;  1KZG A;  3QBV B;  2K2U A;  2YS1 A;  3X23 A;  2FJL A;  2YS3 A;  2LOX A;  5KQ4 A;  3OAN A;  1GC6 A;  2PZ1 A;  1AWE A;  1GG3 A;  1W1G A;  2DTC A;  1DYN A;  5J3Q A;  2DKP A;  2I5C A;  2E2X A;  2YVC A;  2CY4 A;  4WJ7 A;  4BBK A;  1GC7 A;  4GPT B;  2UVM A;  4ZRJ A;  2ROZ B;  1X1G A;  1WGQ A;  4P7I A;  1V89 A;  3QWM A;  4Z2M B;  4DX8 A;  2RLO A;  2QKM A;  3SUZ A;  2R0D A;  1TJ6 A;  1OMW A;  2RNR B;  4F7H A;  3HK0 A;  3BIN A;  1NU2 A;  4YL8 A;  4KVG B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...