3F0WA

Human numb-like protein, phosphotyrosine interaction domain
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
155
structure length
153
Chain Sequence
DLGTENLYFQSMASRPHQWQADEDAVRKGTCSFPVRYLGHVEVEESRGMHVCEDAVKKLKAMGSVKSVLWVSADGLRVVDDKTKDLLVDQTIEKVSFCAPDRNLDKAFSYICRDGTTRRWICHCFLALKDSGERLSHAVGCAFAACLERKQRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Numb-like protein
publication title Human NUMB-like protein, phosphotyrosine interaction domain
rcsb
source organism Homo sapiens
total genus 39
structure length 153
sequence length 155
ec nomenclature
pdb deposition date 2008-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00640 PID Phosphotyrosine interaction domain (PTB/PID)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3f0wA00
5D27A 3SUZA 5DH9B 1MPHA 2LULA 4H8SA 4HDQA 1WJMA 2GJYA 4IFSA 4CHJA 4A6HA 1BAKA 1V5UA 3PZDA 3TO1A 5KQ4A 1U29A 1H4RA 3WYFB 1GG3A 1U5EA 1XCGA 3FEHA 3ODOA 3DXCA 4HAXB 4YL8A 4EKUA 2NMBA 2Z0OA 2CODA 2DYNA 5EFXA 1QC6A 2COAA 2YS1A 5J3YA 4A6FB 2K2UA 4MY6A 1ZC3B 2DTCA 2MWNB 3ODXA 2YVCA 4B6HA 2CAYA 5C16A 4TKNA 2I5FA 2M38A 3ULCA 4A6KA 5C6RA 4K2PA 3KZ1A 1K5GB 1RJ2A 1KI1B 3ZVRA 1EVHA 3A98B 2D9VA 2W2XD 1FHXA 1GC6A 4WJ7A 1PLSA 5J3TA 2OTXA 3SNHA 4K2OA 1OMWA 4KHOA 1U5GA 3BINA 2H7EA 4HB0B 2R09A 1U5FA 1SHCA 2D9XA 1M7RA 2W2XC 2I1KA 5HE1A 3PSCA 2UVMA 2IFSA 1X1GA 4F7UP 3KRXA 1NTVA 5FI1A 3F0WA 3QBVB 4F7GA 4BBKA 1XKEA 4HAWB 2RUKB 3HW2B 2NZ8B 1WGUA 4PQ0A 3TW1A 3VIAA 3PP2A 3GYOA 1KZ7A 4GMVA 2ROZB 2Y8GA 1ZC4B 2L2IA 2L1CA 4K81A 3CIKA 1PFJA 2Y8FA 2KGXB 2DFKA 2ELBA 4HAYB 4IOYX 2PZ1A 4A6FA 2YF0A 4KAXB 2RSGA 1X05A 3PVLA 2D9ZA 3U8ZA 5JHGA 2N0YA 3X23A 1OY2A 3WA0A 2I5CA 4HAUB 1MKEA 4NY0A 2Y7BA 4HHVA 2YS5A 5D3YA 3N7CA 2E2XA 2V76A 3FM8C 3D8EA 2COFA 1NTYA 2DA0A 2D11A 3ML4A 2D10A 3MPXA 2EMSA 1MIXA 3KRWA 5KQ1A 2GCLA 2ELAA 5JHHA 5FI0A 5HE3A 1FHOA 2MKRA 1NI2A 2GS0A 1EAZA 4HB2B 1WGQA 2D4QA 1MIZB 2LYDA 2EC1A 3MDBC 2X18A 1Q67A 1IRSA 2OQBA 2DKQA 2P8VA 1WVHA 2K2JA 4ZRKA 3OANA 1FOEA 2DLWA 1N3HA 2LKOA 2ROVA 1WI1A 3U7DA 2YSZA 5D3VA 5LONB 3HK0A 4HAZB 2J59M 3SO6A 4DX90 2VKIA 1U5DA 4K17A 2HE7A 5HE2A 1DDMA 3M1IB 4KHAA 1XX0A 2W2WA 2KUPA 5CLLB 3CXBB 5J3QA 1LB1A 1Y5OA 2CY4A 2LG1A 2DHIA 3D8FA 4Y94A 1E5WA 4Z2NA 1WJ1A 4GN1A 1V5PA 2D9YA 4EJNA 1DROA 2UZSA 2IYBA 1DDWA 4HATB 3VOQA 2J0MA 3V5WA 3KSYA 5L81A 1FAOA 5D3WA 1M7EA 4KVGB 2RNRB 1EF1A 1ZSQA 2YRYA 1RRPB 1OQNA 3A8PA 4HB3B 2YS3A 3PVUA 4GMXB 2K00A 2RVBB 1BTKA 4HB4B 3AU5A 4KHBB 4CYEA 3ZDTA 2COCA 1I2HA 1W1DA 3TFMA 3PG7A 2EJ8A 1LW3A 4ZRIA 3QWMA 5JLJB 3O96A 4P7IA 3BJIA 5LOPB 1QQGA 3P7ZA 2N23A 1U2BA 3AU4A 1K5DB 4YONA 5HE0A 4TYZA 2Z0QA 4MT7A 4C0AA 3SV1A 3GYPA 1SGHA 4GPTB 5D3XA 4DXAB 1UPRA 2AL6A 5C5BB 2UZRA 2CY5A 3P6AA 1B55A 1ZM0A 3LJUX 2Z0PA 3AJ4A 4MK0A 4EMOA 2DX1A 5KCVA 4DBBA 3T06A 1MK9B 2LOZA 2H7DA 1AWEA 2ADZA 1V88A 3DXDA 2VRWB 1W1GA 2AEHA 1BWNA 1AQCA 2D2QA 4CHMA 1FB8A 1ZVRA 1UNRA 2P0DA 2DKPA 4L6EA 4D0NB 1BTNA 1J19A 1UEFA 3F5RA 3PEGA 2HTHB 3G9WA 2CRFA 3FSSA 3UZTA 2YT1A 3PVWA 4PNKA 1X1FA 5CLQB 4GZUA 4Z2MB 3D8DA 1XD4A 1H10A 5GOWB 2GCJA 5DHAB 3SYXA 2MFQA 1NU2A 2QKMA 2P0FA 4WSFA 1Z87A 2DX5A 3ODWA 2XQNM 1PMSA 1V61A 2RLOA 1X11A 2MDXA 4ZRJA 1I7AA 1V5MA 1X86A 2RGNB 3IVFA 1W1HA 4F7HA 2VSZA 1UPQA 2YT0A 4GXBA 1MAIA 2D9WA 1P6SA 5C79A 2EMTA 2M14A 1GC7A 5C5BA 1DDVA 4HAVB 4NSWA 1U27A 4A5KA 1P3RA 1TQZA 2ZPYA 3TVVA 3ULBA 2DN6A 2QKLA 1TXDA 1ISNA 3KY9A 1J0WA 2J0JA 1TJ6A 2BCJA 5DIFB 2P0HA 2J0KA 3TCAA 1KZGA 1XR0B 2DYQA 2G35A 1DBHA 4DX8A 1FGZA 1WG7A 3NSUA 3RCPA 2DHJA 2Q13A 5JP4A 1UNPA 1MK7B 3HQCA 5DI9B 2JP2A 1UNQA 4XWXA 1P5TA 1FHWA 3A8QA 2I1JA 1Y19B 3QIJA 3DXEA 5DHFB 1DYNA 4HDOA 1FGYA 4WVFB 1XODA 2KCJA 2LOXA 2R0DA 2DHKA 2FJLA 1V89A 1EGXA 4IAPA
chains in the Genus database with same CATH superfamily
2YT2A 5D27A 3SUZA 5DH9B 1MPHA 2LULA 4H8SA 4HDQA 1WJMA 2GJYA 4IFSA 4CHJA 3B77A 4A6HA 1BAKA 1V5UA 3PZDA 3TO1A 5KQ4A 1U29A 1H4RA 3WYFB 1T77A 1GG3A 1U5EA 1XCGA 3FEHA 2K49A 3ODOA 2GUMA 3DXCA 4GNKB 4HAXB 4YL8A 4EKUA 2NMBA 2Z0OA 2CODA 2DYNA 5EFXA 1QC6A 2COAA 2YS1A 5J3YA 4A6FB 2K2UA 4MY6A 1ZC3B 2DTCA 2MWNB 3ODXA 2YVCA 4B6HA 2CAYA 5C16A 4GOUA 4TKNA 2I5FA 2M38A 3ULCA 4A6KA 5C6RA 4K2PA 3KZ1A 1K5GB 1RJ2A 1KI1B 3ZVRA 1EVHA 3A98B 2D9VA 2W2XD 1FHXA 1GC6A 4WJ7A 1PLSA 5J3TA 2OTXA 3SNHA 4K2OA 3HIEA 1OMWA 4KHOA 1U5GA 3BINA 2H7EA 4HB0B 2R09A 1U5FA 1SHCA 2D9XA 1M7RA 2W2XC 5I2MA 1MI1A 2Z4DA 2I1KA 5HE1A 3PSCA 2UVMA 2IFSA 1X1GA 4F7UP 3KRXA 1NTVA 5FI1A 4DIXA 3F0WA 3QBVB 4F7GA 4BBKA 1XKEA 4HAWB 2RUKB 3HW2B 2NZ8B 1WGUA 4PQ0A 2KUQA 3TW1A 4OT1A 3VIAA 3PP2A 3GYOA 1KZ7A 4GMVA 2ROZB 2Y8GA 1ZC4B 2L2IA 2L1CA 4K81A 3CIKA 1PFJA 2Y8FA 2KGXB 2DFKA 2ELBA 4HAYB 4IOYX 2KR0A 2PZ1A 4A6FA 2YF0A 4KAXB 2RSGA 1X05A 3PVLA 2D9ZA 2FJUB 3U8ZA 5JHGA 2N0YA 3X23A 1OY2A 3WA0A 2I5CA 4HAUB 1MKEA 4NY0A 1ZYIA 2Y7BA 4HHVA 2YS5A 5D3YA 3N7CA 2E2XA 2V76A 3FM8C 3D8EA 2COFA 1NTYA 2DA0A 2D11A 3ML4A 2D10A 3MPXA 2EMSA 2Z14A 1MIXA 3KRWA 5KQ1A 2GCLA 2ELAA 5JHHA 5FI0A 5HE3A 1FHOA 2MKRA 1NI2A 2GS0A 1EAZA 4HB2B 1WGQA 2D4QA 1MIZB 2LYDA 2EC1A 3MDBC 2X18A 1Q67A 1IRSA 2OQBA 2DKQA 2P8VA 3NWFA 1WVHA 2K2JA 4ZRKA 3OANA 1FOEA 2DLWA 1N3HA 2LKOA 2ROVA 1WI1A 3U7DA 2YSZA 5D3VA 3NWDA 3FVCA 5LONB 3HK0A 4HAZB 2J59M 3SO6A 4DX90 2VKIA 1U5DA 4K17A 2HE7A 5HE2A 1DDMA 3M1IB 4KHAA 1XX0A 2W2WA 2KUPA 5CLLB 3CXBB 5J3QA 1LB1A 1Y5OA 2CY4A 2LG1A 2DHIA 3D8FA 4Y94A 2KIGA 1E5WA 4Z2NA 1WJ1A 4GN1A 1V5PA 2D9YA 4EJNA 1DROA 2UZSA 2IYBA 1DDWA 4HATB 3VOQA 2J0MA 3V5WA 3KSYA 5L81A 1FAOA 5D3WA 1M7EA 4KVGB 2RNRB 1EF1A 1ZSQA 4QJ5B 2YRYA 3DCXA 1RRPB 1OQNA 3A8PA 5LG4B 4HB3B 2YS3A 3PVUA 4GMXB 2K00A 2RVBB 3OHMB 1BTKA 4HB4B 3AU5A 4KHBB 4CYEA 3ZDTA 2COCA 1I2HA 1W1DA 3TFMA 3PG7A 2EJ8A 1LW3A 4QXAB 4ZRIA 3QWMA 3NW8A 5JLJB 3O96A 4P7IA 3BJIA 5LOPB 1QQGA 3P7ZA 2N23A 1U2BA 3AU4A 1K5DB 4L1RA 4YONA 5HE0A 4TYZA 2Z0QA 4MT7A 2Z59A 4C0AA 3SV1A 3GYPA 1SGHA 4GPTB 5D3XA 4DXAB 1UPRA 2AL6A 5C5BB 2UZRA 2CY5A 3P6AA 1B55A 4QJ3B 1ZM0A 3LJUX 4D6WA 3NWAA 2Z0PA 3AJ4A 4MK0A 4EMOA 2DX1A 4CSQA 5KCVA 4DBBA 3T06A 1MK9B 2LOZA 2H7DA 1AWEA 2ADZA 1V88A 3DXDA 2VRWB 1W1GA 2AEHA 1BWNA 1AQCA 2D2QA 4CHMA 1FB8A 1ZVRA 1UNRA 2P0DA 2DKPA 4L6EA 5IRSA 4D0NB 1BTNA 1J19A 1UEFA 3F5RA 3PEGA 2HTHB 3G9WA 2CRFA 3FSSA 4KHBA 3UZTA 2YT1A 3PVWA 4PNKA 1X1FA 5CLQB 4GZUA 4Z2MB 3D8DA 1XD4A 1H10A 5GOWB 2GCJA 3A58A 5DHAB 3SYXA 2MFQA 1NU2A 2QKMA 2P0FA 2ZKMX 4WSFA 1Z87A 3HSAA 4HSIA 2DX5A 3ODWA 2XQNM 1PMSA 1V61A 2RLOA 1X11A 2MDXA 4ZRJA 2R2YA 1I7AA 1V5MA 1X86A 2RGNB 3IVFA 4OSNA 1W1HA 4F7HA 2VSZA 1UPQA 2YT0A 4GXBA 1MAIA 2D9WA 1P6SA 5C79A 2EMTA 2M14A 1GC7A 5C5BA 1DDVA 4HAVB 4NSWA 1U27A 4A5KA 1P3RA 1TQZA 2ZPYA 3TVVA 3ULBA 2DN6A 2QKLA 1TXDA 1ISNA 1J0WA 3KY9A 2J0JA 1TJ6A 2BCJA 5DIFB 2P0HA 2J0KA 2NBVA 1KZGA 3TCAA 1XR0B 5M4YB 2DYQA 2K8EA 2KIEA 2G35A 1DBHA 4DX8A 1FGZA 1WG7A 3NSUA 3RCPA 2DHJA 5I2SA 2Q13A 4QJ4B 5JP4A 1UNPA 1MK7B 2RRFA 3HQCA 5DI9B 2JP2A 1UNQA 4XWXA 1P5TA 1FHWA 3A8QA 2I1JA 1Y19B 3QIJA 3DXEA 5DHFB 1DYNA 4HDOA 1FGYA 2Z13A 4WVFB 1XODA 2KCJA 2LOXA 2R0DA 2DHKA 2FJLA 3U12A 1V89A 1EGXA 4IAPA
chains in the Genus database with same CATH topology
5D27A 3SUZA 5DH9B 1MPHA 2LULA 4H8SA 4HDQA 1WJMA 2GJYA 4IFSA 4CHJA 4A6HA 1BAKA 1V5UA 3PZDA 3TO1A 5KQ4A 1U29A 1H4RA 3WYFB 1GG3A 1U5EA 1XCGA 3FEHA 3ODOA 3DXCA 4HAXB 4YL8A 4EKUA 2NMBA 2Z0OA 2CODA 2DYNA 5EFXA 1QC6A 2COAA 2YS1A 5J3YA 4A6FB 2K2UA 4MY6A 1ZC3B 2DTCA 2MWNB 3ODXA 2YVCA 4B6HA 2CAYA 5C16A 4TKNA 2I5FA 2M38A 3ULCA 4A6KA 5C6RA 4K2PA 3KZ1A 1K5GB 1RJ2A 1KI1B 3ZVRA 1EVHA 3A98B 2D9VA 2W2XD 1FHXA 1GC6A 4WJ7A 1PLSA 5J3TA 2OTXA 3SNHA 4K2OA 1OMWA 4KHOA 1U5GA 3BINA 2H7EA 4HB0B 2R09A 1U5FA 1SHCA 2D9XA 1M7RA 2W2XC 2I1KA 5HE1A 3PSCA 2UVMA 2IFSA 1X1GA 4F7UP 3KRXA 1NTVA 5FI1A 3F0WA 3QBVB 4F7GA 4BBKA 1XKEA 4HAWB 2RUKB 3HW2B 2NZ8B 1WGUA 4PQ0A 3TW1A 3VIAA 3PP2A 3GYOA 1KZ7A 4GMVA 2ROZB 2Y8GA 1ZC4B 2L2IA 2L1CA 4K81A 3CIKA 1PFJA 2Y8FA 2KGXB 2DFKA 2ELBA 4HAYB 4IOYX 2PZ1A 4A6FA 2YF0A 4KAXB 2RSGA 1X05A 3PVLA 2D9ZA 3U8ZA 5JHGA 2N0YA 3X23A 1OY2A 3WA0A 2I5CA 4HAUB 1MKEA 4NY0A 2Y7BA 4HHVA 2YS5A 5D3YA 3N7CA 2E2XA 2V76A 3FM8C 3D8EA 2COFA 1NTYA 2DA0A 2D11A 3ML4A 2D10A 3MPXA 2EMSA 1MIXA 3KRWA 5KQ1A 2GCLA 2ELAA 5JHHA 5FI0A 5HE3A 1FHOA 2MKRA 1NI2A 2GS0A 1EAZA 4HB2B 1WGQA 2D4QA 1MIZB 2LYDA 2EC1A 3MDBC 2X18A 1Q67A 1IRSA 2OQBA 2DKQA 2P8VA 1WVHA 2K2JA 4ZRKA 3OANA 1FOEA 2DLWA 1N3HA 2LKOA 2ROVA 1WI1A 3U7DA 2YSZA 5D3VA 5LONB 3HK0A 4HAZB 2J59M 3SO6A 4DX90 2VKIA 1U5DA 4K17A 2HE7A 5HE2A 1DDMA 3M1IB 4KHAA 1XX0A 2W2WA 2KUPA 5CLLB 3CXBB 5J3QA 1LB1A 1Y5OA 2CY4A 2LG1A 2DHIA 3D8FA 4Y94A 1E5WA 4Z2NA 1WJ1A 4GN1A 1V5PA 2D9YA 4EJNA 1DROA 2UZSA 2IYBA 1DDWA 4HATB 3VOQA 2J0MA 3V5WA 3KSYA 5L81A 1FAOA 5D3WA 1M7EA 4KVGB 2RNRB 1EF1A 1ZSQA 2YRYA 1RRPB 1OQNA 3A8PA 4HB3B 2YS3A 3PVUA 4GMXB 2K00A 2RVBB 1BTKA 4HB4B 3AU5A 4KHBB 4CYEA 3ZDTA 2COCA 1I2HA 1W1DA 3TFMA 3PG7A 2EJ8A 1LW3A 4ZRIA 3QWMA 5JLJB 3O96A 4P7IA 3BJIA 5LOPB 1QQGA 3P7ZA 2N23A 1U2BA 3AU4A 1K5DB 4YONA 5HE0A 4TYZA 2Z0QA 4MT7A 4C0AA 3SV1A 3GYPA 1SGHA 4GPTB 5D3XA 4DXAB 1UPRA 2AL6A 5C5BB 2UZRA 2CY5A 3P6AA 1B55A 1ZM0A 3LJUX 2Z0PA 3AJ4A 4MK0A 4EMOA 2DX1A 5KCVA 4DBBA 3T06A 1MK9B 2LOZA 2H7DA 1AWEA 2ADZA 1V88A 3DXDA 2VRWB 1W1GA 2AEHA 1BWNA 1AQCA 2D2QA 4CHMA 1FB8A 1ZVRA 1UNRA 2P0DA 2DKPA 4L6EA 4D0NB 1BTNA 1J19A 1UEFA 3F5RA 3PEGA 2HTHB 3G9WA 2CRFA 3FSSA 3UZTA 2YT1A 3PVWA 4PNKA 1X1FA 5CLQB 4GZUA 4Z2MB 3D8DA 1XD4A 1H10A 5GOWB 2GCJA 5DHAB 3SYXA 2MFQA 1NU2A 2QKMA 2P0FA 4WSFA 1Z87A 2DX5A 3ODWA 2XQNM 1PMSA 1V61A 2RLOA 1X11A 2MDXA 4ZRJA 1I7AA 1V5MA 1X86A 2RGNB 3IVFA 1W1HA 4F7HA 2VSZA 1UPQA 2YT0A 4GXBA 1MAIA 2D9WA 1P6SA 5C79A 2EMTA 2M14A 1GC7A 5C5BA 1DDVA 4HAVB 4NSWA 1U27A 4A5KA 1P3RA 1TQZA 2ZPYA 3TVVA 3ULBA 2DN6A 2QKLA 1TXDA 1ISNA 3KY9A 1J0WA 2J0JA 1TJ6A 2BCJA 5DIFB 2P0HA 2J0KA 3TCAA 1KZGA 1XR0B 2DYQA 2G35A 1DBHA 4DX8A 1FGZA 1WG7A 3NSUA 3RCPA 2DHJA 2Q13A 5JP4A 1UNPA 1MK7B 3HQCA 5DI9B 2JP2A 1UNQA 4XWXA 1P5TA 1FHWA 3A8QA 2I1JA 1Y19B 3QIJA 3DXEA 5DHFB 1DYNA 4HDOA 1FGYA 4WVFB 1XODA 2KCJA 2LOXA 2R0DA 2DHKA 2FJLA 1V89A 1EGXA 4IAPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5D27 A;  3SUZ A;  5DH9 B;  1MPH A;  2LUL A;  4H8S A;  4HDQ A;  1WJM A;  2GJY A;  4IFS A;  4CHJ A;  4A6H A;  1BAK A;  1V5U A;  3PZD A;  3TO1 A;  5KQ4 A;  1U29 A;  1H4R A;  3WYF B;  1GG3 A;  1U5E A;  1XCG A;  3FEH A;  3ODO A;  3DXC A;  4HAX B;  4YL8 A;  4EKU A;  2NMB A;  2Z0O A;  2COD A;  2DYN A;  5EFX A;  1QC6 A;  2COA A;  2YS1 A;  5J3Y A;  4A6F B;  2K2U A;  4MY6 A;  1ZC3 B;  2DTC A;  2MWN B;  3ODX A;  2YVC A;  4B6H A;  2CAY A;  5C16 A;  4TKN A;  2I5F A;  2M38 A;  3ULC A;  4A6K A;  5C6R A;  4K2P A;  3KZ1 A;  1K5G B;  1RJ2 A;  1KI1 B;  3ZVR A;  1EVH A;  3A98 B;  2D9V A;  2W2X D;  1FHX A;  1GC6 A;  4WJ7 A;  1PLS A;  5J3T A;  2OTX A;  3SNH A;  4K2O A;  1OMW A;  4KHO A;  1U5G A;  3BIN A;  2H7E A;  4HB0 B;  2R09 A;  1U5F A;  1SHC A;  2D9X A;  1M7R A;  2W2X C;  2I1K A;  5HE1 A;  3PSC A;  2UVM A;  2IFS A;  1X1G A;  4F7U P;  3KRX A;  1NTV A;  5FI1 A;  3F0W A;  3QBV B;  4F7G A;  4BBK A;  1XKE A;  4HAW B;  2RUK B;  3HW2 B;  2NZ8 B;  1WGU A;  4PQ0 A;  3TW1 A;  3VIA A;  3PP2 A;  3GYO A;  1KZ7 A;  4GMV A;  2ROZ B;  2Y8G A;  1ZC4 B;  2L2I A;  2L1C A;  4K81 A;  3CIK A;  1PFJ A;  2Y8F A;  2KGX B;  2DFK A;  2ELB A;  4HAY B;  4IOY X;  2PZ1 A;  4A6F A;  2YF0 A;  4KAX B;  2RSG A;  1X05 A;  3PVL A;  2D9Z A;  3U8Z A;  5JHG A;  2N0Y A;  3X23 A;  1OY2 A;  3WA0 A;  2I5C A;  4HAU B;  1MKE A;  4NY0 A;  2Y7B A;  4HHV A;  2YS5 A;  5D3Y A;  3N7C A;  2E2X A;  2V76 A;  3FM8 C;  3D8E A;  2COF A;  1NTY A;  2DA0 A;  2D11 A;  3ML4 A;  2D10 A;  3MPX A;  2EMS A;  1MIX A;  3KRW A;  5KQ1 A;  2GCL A;  2ELA A;  5JHH A;  5FI0 A;  5HE3 A;  1FHO A;  2MKR A;  1NI2 A;  2GS0 A;  1EAZ A;  4HB2 B;  1WGQ A;  2D4Q A;  1MIZ B;  2LYD A;  2EC1 A;  3MDB C;  2X18 A;  1Q67 A;  1IRS A;  2OQB A;  2DKQ A;  2P8V A;  1WVH A;  2K2J A;  4ZRK A;  3OAN A;  1FOE A;  2DLW A;  1N3H A;  2LKO A;  2ROV A;  1WI1 A;  3U7D A;  2YSZ A;  5D3V A;  5LON B;  3HK0 A;  4HAZ B;  2J59 M;  3SO6 A;  4DX9 0;  2VKI A;  1U5D A;  4K17 A;  2HE7 A;  5HE2 A;  1DDM A;  3M1I B;  4KHA A;  1XX0 A;  2W2W A;  2KUP A;  5CLL B;  3CXB B;  5J3Q A;  1LB1 A;  1Y5O A;  2CY4 A;  2LG1 A;  2DHI A;  3D8F A;  4Y94 A;  1E5W A;  4Z2N A;  1WJ1 A;  4GN1 A;  1V5P A;  2D9Y A;  4EJN A;  1DRO A;  2UZS A;  2IYB A;  1DDW A;  4HAT B;  3VOQ A;  2J0M A;  3V5W A;  3KSY A;  5L81 A;  1FAO A;  5D3W A;  1M7E A;  4KVG B;  2RNR B;  1EF1 A;  1ZSQ A;  2YRY A;  1RRP B;  1OQN A;  3A8P A;  4HB3 B;  2YS3 A;  3PVU A;  4GMX B;  2K00 A;  2RVB B;  1BTK A;  4HB4 B;  3AU5 A;  4KHB B;  4CYE A;  3ZDT A;  2COC A;  1I2H A;  1W1D A;  3TFM A;  3PG7 A;  2EJ8 A;  1LW3 A;  4ZRI A;  3QWM A;  5JLJ B;  3O96 A;  4P7I A;  3BJI A;  5LOP B;  1QQG A;  3P7Z A;  2N23 A;  1U2B A;  3AU4 A;  1K5D B;  4YON A;  5HE0 A;  4TYZ A;  2Z0Q A;  4MT7 A;  4C0A A;  3SV1 A;  3GYP A;  1SGH A;  4GPT B;  5D3X A;  4DXA B;  1UPR A;  2AL6 A;  5C5B B;  2UZR A;  2CY5 A;  3P6A A;  1B55 A;  1ZM0 A;  3LJU X;  2Z0P A;  3AJ4 A;  4MK0 A;  4EMO A;  2DX1 A;  5KCV A;  4DBB A;  3T06 A;  1MK9 B;  2LOZ A;  2H7D A;  1AWE A;  2ADZ A;  1V88 A;  3DXD A;  2VRW B;  1W1G A;  2AEH A;  1BWN A;  1AQC A;  2D2Q A;  4CHM A;  1FB8 A;  1ZVR A;  1UNR A;  2P0D A;  2DKP A;  4L6E A;  4D0N B;  1BTN A;  1J19 A;  1UEF A;  3F5R A;  3PEG A;  2HTH B;  3G9W A;  2CRF A;  3FSS A;  3UZT A;  2YT1 A;  3PVW A;  4PNK A;  1X1F A;  5CLQ B;  4GZU A;  4Z2M B;  3D8D A;  1XD4 A;  1H10 A;  5GOW B;  2GCJ A;  5DHA B;  3SYX A;  2MFQ A;  1NU2 A;  2QKM A;  2P0F A;  4WSF A;  1Z87 A;  2DX5 A;  3ODW A;  2XQN M;  1PMS A;  1V61 A;  2RLO A;  1X11 A;  2MDX A;  4ZRJ A;  1I7A A;  1V5M A;  1X86 A;  2RGN B;  3IVF A;  1W1H A;  4F7H A;  2VSZ A;  1UPQ A;  2YT0 A;  4GXB A;  1MAI A;  2D9W A;  1P6S A;  5C79 A;  2EMT A;  2M14 A;  1GC7 A;  5C5B A;  1DDV A;  4HAV B;  4NSW A;  1U27 A;  4A5K A;  1P3R A;  1TQZ A;  2ZPY A;  3TVV A;  3ULB A;  2DN6 A;  2QKL A;  1TXD A;  1ISN A;  3KY9 A;  1J0W A;  2J0J A;  1TJ6 A;  2BCJ A;  5DIF B;  2P0H A;  2J0K A;  3TCA A;  1KZG A;  1XR0 B;  2DYQ A;  2G35 A;  1DBH A;  4DX8 A;  1FGZ A;  1WG7 A;  3NSU A;  3RCP A;  2DHJ A;  2Q13 A;  5JP4 A;  1UNP A;  1MK7 B;  3HQC A;  5DI9 B;  2JP2 A;  1UNQ A;  4XWX A;  1P5T A;  1FHW A;  3A8Q A;  2I1J A;  1Y19 B;  3QIJ A;  3DXE A;  5DHF B;  1DYN A;  4HDO A;  1FGY A;  4WVF B;  1XOD A;  2KCJ A;  2LOX A;  2R0D A;  2DHK A;  2FJL A;  1V89 A;  1EGX A;  4IAP A; 
#chains in the Genus database with same CATH topology
 2YT2 A;  5D27 A;  3SUZ A;  5DH9 B;  1MPH A;  2LUL A;  4H8S A;  4HDQ A;  1WJM A;  2GJY A;  4IFS A;  4CHJ A;  3B77 A;  4A6H A;  1BAK A;  1V5U A;  3PZD A;  3TO1 A;  5KQ4 A;  1U29 A;  1H4R A;  3WYF B;  1T77 A;  1GG3 A;  1U5E A;  1XCG A;  3FEH A;  2K49 A;  3ODO A;  2GUM A;  3DXC A;  4GNK B;  4HAX B;  4YL8 A;  4EKU A;  2NMB A;  2Z0O A;  2COD A;  2DYN A;  5EFX A;  1QC6 A;  2COA A;  2YS1 A;  5J3Y A;  4A6F B;  2K2U A;  4MY6 A;  1ZC3 B;  2DTC A;  2MWN B;  3ODX A;  2YVC A;  4B6H A;  2CAY A;  5C16 A;  4GOU A;  4TKN A;  2I5F A;  2M38 A;  3ULC A;  4A6K A;  5C6R A;  4K2P A;  3KZ1 A;  1K5G B;  1RJ2 A;  1KI1 B;  3ZVR A;  1EVH A;  3A98 B;  2D9V A;  2W2X D;  1FHX A;  1GC6 A;  4WJ7 A;  1PLS A;  5J3T A;  2OTX A;  3SNH A;  4K2O A;  3HIE A;  1OMW A;  4KHO A;  1U5G A;  3BIN A;  2H7E A;  4HB0 B;  2R09 A;  1U5F A;  1SHC A;  2D9X A;  1M7R A;  2W2X C;  5I2M A;  1MI1 A;  2Z4D A;  2I1K A;  5HE1 A;  3PSC A;  2UVM A;  2IFS A;  1X1G A;  4F7U P;  3KRX A;  1NTV A;  5FI1 A;  4DIX A;  3F0W A;  3QBV B;  4F7G A;  4BBK A;  1XKE A;  4HAW B;  2RUK B;  3HW2 B;  2NZ8 B;  1WGU A;  4PQ0 A;  2KUQ A;  3TW1 A;  4OT1 A;  3VIA A;  3PP2 A;  3GYO A;  1KZ7 A;  4GMV A;  2ROZ B;  2Y8G A;  1ZC4 B;  2L2I A;  2L1C A;  4K81 A;  3CIK A;  1PFJ A;  2Y8F A;  2KGX B;  2DFK A;  2ELB A;  4HAY B;  4IOY X;  2KR0 A;  2PZ1 A;  4A6F A;  2YF0 A;  4KAX B;  2RSG A;  1X05 A;  3PVL A;  2D9Z A;  2FJU B;  3U8Z A;  5JHG A;  2N0Y A;  3X23 A;  1OY2 A;  3WA0 A;  2I5C A;  4HAU B;  1MKE A;  4NY0 A;  1ZYI A;  2Y7B A;  4HHV A;  2YS5 A;  5D3Y A;  3N7C A;  2E2X A;  2V76 A;  3FM8 C;  3D8E A;  2COF A;  1NTY A;  2DA0 A;  2D11 A;  3ML4 A;  2D10 A;  3MPX A;  2EMS A;  2Z14 A;  1MIX A;  3KRW A;  5KQ1 A;  2GCL A;  2ELA A;  5JHH A;  5FI0 A;  5HE3 A;  1FHO A;  2MKR A;  1NI2 A;  2GS0 A;  1EAZ A;  4HB2 B;  1WGQ A;  2D4Q A;  1MIZ B;  2LYD A;  2EC1 A;  3MDB C;  2X18 A;  1Q67 A;  1IRS A;  2OQB A;  2DKQ A;  2P8V A;  3NWF A;  1WVH A;  2K2J A;  4ZRK A;  3OAN A;  1FOE A;  2DLW A;  1N3H A;  2LKO A;  2ROV A;  1WI1 A;  3U7D A;  2YSZ A;  5D3V A;  3NWD A;  3FVC A;  5LON B;  3HK0 A;  4HAZ B;  2J59 M;  3SO6 A;  4DX9 0;  2VKI A;  1U5D A;  4K17 A;  2HE7 A;  5HE2 A;  1DDM A;  3M1I B;  4KHA A;  1XX0 A;  2W2W A;  2KUP A;  5CLL B;  3CXB B;  5J3Q A;  1LB1 A;  1Y5O A;  2CY4 A;  2LG1 A;  2DHI A;  3D8F A;  4Y94 A;  2KIG A;  1E5W A;  4Z2N A;  1WJ1 A;  4GN1 A;  1V5P A;  2D9Y A;  4EJN A;  1DRO A;  2UZS A;  2IYB A;  1DDW A;  4HAT B;  3VOQ A;  2J0M A;  3V5W A;  3KSY A;  5L81 A;  1FAO A;  5D3W A;  1M7E A;  4KVG B;  2RNR B;  1EF1 A;  1ZSQ A;  4QJ5 B;  2YRY A;  3DCX A;  1RRP B;  1OQN A;  3A8P A;  5LG4 B;  4HB3 B;  2YS3 A;  3PVU A;  4GMX B;  2K00 A;  2RVB B;  3OHM B;  1BTK A;  4HB4 B;  3AU5 A;  4KHB B;  4CYE A;  3ZDT A;  2COC A;  1I2H A;  1W1D A;  3TFM A;  3PG7 A;  2EJ8 A;  1LW3 A;  4QXA B;  4ZRI A;  3QWM A;  3NW8 A;  5JLJ B;  3O96 A;  4P7I A;  3BJI A;  5LOP B;  1QQG A;  3P7Z A;  2N23 A;  1U2B A;  3AU4 A;  1K5D B;  4L1R A;  4YON A;  5HE0 A;  4TYZ A;  2Z0Q A;  4MT7 A;  2Z59 A;  4C0A A;  3SV1 A;  3GYP A;  1SGH A;  4GPT B;  5D3X A;  4DXA B;  1UPR A;  2AL6 A;  5C5B B;  2UZR A;  2CY5 A;  3P6A A;  1B55 A;  4QJ3 B;  1ZM0 A;  3LJU X;  4D6W A;  3NWA A;  2Z0P A;  3AJ4 A;  4MK0 A;  4EMO A;  2DX1 A;  4CSQ A;  5KCV A;  4DBB A;  3T06 A;  1MK9 B;  2LOZ A;  2H7D A;  1AWE A;  2ADZ A;  1V88 A;  3DXD A;  2VRW B;  1W1G A;  2AEH A;  1BWN A;  1AQC A;  2D2Q A;  4CHM A;  1FB8 A;  1ZVR A;  1UNR A;  2P0D A;  2DKP A;  4L6E A;  5IRS A;  4D0N B;  1BTN A;  1J19 A;  1UEF A;  3F5R A;  3PEG A;  2HTH B;  3G9W A;  2CRF A;  3FSS A;  4KHB A;  3UZT A;  2YT1 A;  3PVW A;  4PNK A;  1X1F A;  5CLQ B;  4GZU A;  4Z2M B;  3D8D A;  1XD4 A;  1H10 A;  5GOW B;  2GCJ A;  3A58 A;  5DHA B;  3SYX A;  2MFQ A;  1NU2 A;  2QKM A;  2P0F A;  2ZKM X;  4WSF A;  1Z87 A;  3HSA A;  4HSI A;  2DX5 A;  3ODW A;  2XQN M;  1PMS A;  1V61 A;  2RLO A;  1X11 A;  2MDX A;  4ZRJ A;  2R2Y A;  1I7A A;  1V5M A;  1X86 A;  2RGN B;  3IVF A;  4OSN A;  1W1H A;  4F7H A;  2VSZ A;  1UPQ A;  2YT0 A;  4GXB A;  1MAI A;  2D9W A;  1P6S A;  5C79 A;  2EMT A;  2M14 A;  1GC7 A;  5C5B A;  1DDV A;  4HAV B;  4NSW A;  1U27 A;  4A5K A;  1P3R A;  1TQZ A;  2ZPY A;  3TVV A;  3ULB A;  2DN6 A;  2QKL A;  1TXD A;  1ISN A;  1J0W A;  3KY9 A;  2J0J A;  1TJ6 A;  2BCJ A;  5DIF B;  2P0H A;  2J0K A;  2NBV A;  1KZG A;  3TCA A;  1XR0 B;  5M4Y B;  2DYQ A;  2K8E A;  2KIE A;  2G35 A;  1DBH A;  4DX8 A;  1FGZ A;  1WG7 A;  3NSU A;  3RCP A;  2DHJ A;  5I2S A;  2Q13 A;  4QJ4 B;  5JP4 A;  1UNP A;  1MK7 B;  2RRF A;  3HQC A;  5DI9 B;  2JP2 A;  1UNQ A;  4XWX A;  1P5T A;  1FHW A;  3A8Q A;  2I1J A;  1Y19 B;  3QIJ A;  3DXE A;  5DHF B;  1DYN A;  4HDO A;  1FGY A;  2Z13 A;  4WVF B;  1XOD A;  2KCJ A;  2LOX A;  2R0D A;  2DHK A;  2FJL A;  3U12 A;  1V89 A;  1EGX A;  4IAP A; 
#chains in the Genus database with same CATH homology
 5D27 A;  3SUZ A;  5DH9 B;  1MPH A;  2LUL A;  4H8S A;  4HDQ A;  1WJM A;  2GJY A;  4IFS A;  4CHJ A;  4A6H A;  1BAK A;  1V5U A;  3PZD A;  3TO1 A;  5KQ4 A;  1U29 A;  1H4R A;  3WYF B;  1GG3 A;  1U5E A;  1XCG A;  3FEH A;  3ODO A;  3DXC A;  4HAX B;  4YL8 A;  4EKU A;  2NMB A;  2Z0O A;  2COD A;  2DYN A;  5EFX A;  1QC6 A;  2COA A;  2YS1 A;  5J3Y A;  4A6F B;  2K2U A;  4MY6 A;  1ZC3 B;  2DTC A;  2MWN B;  3ODX A;  2YVC A;  4B6H A;  2CAY A;  5C16 A;  4TKN A;  2I5F A;  2M38 A;  3ULC A;  4A6K A;  5C6R A;  4K2P A;  3KZ1 A;  1K5G B;  1RJ2 A;  1KI1 B;  3ZVR A;  1EVH A;  3A98 B;  2D9V A;  2W2X D;  1FHX A;  1GC6 A;  4WJ7 A;  1PLS A;  5J3T A;  2OTX A;  3SNH A;  4K2O A;  1OMW A;  4KHO A;  1U5G A;  3BIN A;  2H7E A;  4HB0 B;  2R09 A;  1U5F A;  1SHC A;  2D9X A;  1M7R A;  2W2X C;  2I1K A;  5HE1 A;  3PSC A;  2UVM A;  2IFS A;  1X1G A;  4F7U P;  3KRX A;  1NTV A;  5FI1 A;  3F0W A;  3QBV B;  4F7G A;  4BBK A;  1XKE A;  4HAW B;  2RUK B;  3HW2 B;  2NZ8 B;  1WGU A;  4PQ0 A;  3TW1 A;  3VIA A;  3PP2 A;  3GYO A;  1KZ7 A;  4GMV A;  2ROZ B;  2Y8G A;  1ZC4 B;  2L2I A;  2L1C A;  4K81 A;  3CIK A;  1PFJ A;  2Y8F A;  2KGX B;  2DFK A;  2ELB A;  4HAY B;  4IOY X;  2PZ1 A;  4A6F A;  2YF0 A;  4KAX B;  2RSG A;  1X05 A;  3PVL A;  2D9Z A;  3U8Z A;  5JHG A;  2N0Y A;  3X23 A;  1OY2 A;  3WA0 A;  2I5C A;  4HAU B;  1MKE A;  4NY0 A;  2Y7B A;  4HHV A;  2YS5 A;  5D3Y A;  3N7C A;  2E2X A;  2V76 A;  3FM8 C;  3D8E A;  2COF A;  1NTY A;  2DA0 A;  2D11 A;  3ML4 A;  2D10 A;  3MPX A;  2EMS A;  1MIX A;  3KRW A;  5KQ1 A;  2GCL A;  2ELA A;  5JHH A;  5FI0 A;  5HE3 A;  1FHO A;  2MKR A;  1NI2 A;  2GS0 A;  1EAZ A;  4HB2 B;  1WGQ A;  2D4Q A;  1MIZ B;  2LYD A;  2EC1 A;  3MDB C;  2X18 A;  1Q67 A;  1IRS A;  2OQB A;  2DKQ A;  2P8V A;  1WVH A;  2K2J A;  4ZRK A;  3OAN A;  1FOE A;  2DLW A;  1N3H A;  2LKO A;  2ROV A;  1WI1 A;  3U7D A;  2YSZ A;  5D3V A;  5LON B;  3HK0 A;  4HAZ B;  2J59 M;  3SO6 A;  4DX9 0;  2VKI A;  1U5D A;  4K17 A;  2HE7 A;  5HE2 A;  1DDM A;  3M1I B;  4KHA A;  1XX0 A;  2W2W A;  2KUP A;  5CLL B;  3CXB B;  5J3Q A;  1LB1 A;  1Y5O A;  2CY4 A;  2LG1 A;  2DHI A;  3D8F A;  4Y94 A;  1E5W A;  4Z2N A;  1WJ1 A;  4GN1 A;  1V5P A;  2D9Y A;  4EJN A;  1DRO A;  2UZS A;  2IYB A;  1DDW A;  4HAT B;  3VOQ A;  2J0M A;  3V5W A;  3KSY A;  5L81 A;  1FAO A;  5D3W A;  1M7E A;  4KVG B;  2RNR B;  1EF1 A;  1ZSQ A;  2YRY A;  1RRP B;  1OQN A;  3A8P A;  4HB3 B;  2YS3 A;  3PVU A;  4GMX B;  2K00 A;  2RVB B;  1BTK A;  4HB4 B;  3AU5 A;  4KHB B;  4CYE A;  3ZDT A;  2COC A;  1I2H A;  1W1D A;  3TFM A;  3PG7 A;  2EJ8 A;  1LW3 A;  4ZRI A;  3QWM A;  5JLJ B;  3O96 A;  4P7I A;  3BJI A;  5LOP B;  1QQG A;  3P7Z A;  2N23 A;  1U2B A;  3AU4 A;  1K5D B;  4YON A;  5HE0 A;  4TYZ A;  2Z0Q A;  4MT7 A;  4C0A A;  3SV1 A;  3GYP A;  1SGH A;  4GPT B;  5D3X A;  4DXA B;  1UPR A;  2AL6 A;  5C5B B;  2UZR A;  2CY5 A;  3P6A A;  1B55 A;  1ZM0 A;  3LJU X;  2Z0P A;  3AJ4 A;  4MK0 A;  4EMO A;  2DX1 A;  5KCV A;  4DBB A;  3T06 A;  1MK9 B;  2LOZ A;  2H7D A;  1AWE A;  2ADZ A;  1V88 A;  3DXD A;  2VRW B;  1W1G A;  2AEH A;  1BWN A;  1AQC A;  2D2Q A;  4CHM A;  1FB8 A;  1ZVR A;  1UNR A;  2P0D A;  2DKP A;  4L6E A;  4D0N B;  1BTN A;  1J19 A;  1UEF A;  3F5R A;  3PEG A;  2HTH B;  3G9W A;  2CRF A;  3FSS A;  3UZT A;  2YT1 A;  3PVW A;  4PNK A;  1X1F A;  5CLQ B;  4GZU A;  4Z2M B;  3D8D A;  1XD4 A;  1H10 A;  5GOW B;  2GCJ A;  5DHA B;  3SYX A;  2MFQ A;  1NU2 A;  2QKM A;  2P0F A;  4WSF A;  1Z87 A;  2DX5 A;  3ODW A;  2XQN M;  1PMS A;  1V61 A;  2RLO A;  1X11 A;  2MDX A;  4ZRJ A;  1I7A A;  1V5M A;  1X86 A;  2RGN B;  3IVF A;  1W1H A;  4F7H A;  2VSZ A;  1UPQ A;  2YT0 A;  4GXB A;  1MAI A;  2D9W A;  1P6S A;  5C79 A;  2EMT A;  2M14 A;  1GC7 A;  5C5B A;  1DDV A;  4HAV B;  4NSW A;  1U27 A;  4A5K A;  1P3R A;  1TQZ A;  2ZPY A;  3TVV A;  3ULB A;  2DN6 A;  2QKL A;  1TXD A;  1ISN A;  3KY9 A;  1J0W A;  2J0J A;  1TJ6 A;  2BCJ A;  5DIF B;  2P0H A;  2J0K A;  3TCA A;  1KZG A;  1XR0 B;  2DYQ A;  2G35 A;  1DBH A;  4DX8 A;  1FGZ A;  1WG7 A;  3NSU A;  3RCP A;  2DHJ A;  2Q13 A;  5JP4 A;  1UNP A;  1MK7 B;  3HQC A;  5DI9 B;  2JP2 A;  1UNQ A;  4XWX A;  1P5T A;  1FHW A;  3A8Q A;  2I1J A;  1Y19 B;  3QIJ A;  3DXE A;  5DHF B;  1DYN A;  4HDO A;  1FGY A;  4WVF B;  1XOD A;  2KCJ A;  2LOX A;  2R0D A;  2DHK A;  2FJL A;  1V89 A;  1EGX A;  4IAP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...