3F0WA

Human numb-like protein, phosphotyrosine interaction domain
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
155
structure length
153
Chain Sequence
b'DLGTENLYFQSMASRPHQWQADEDAVRKGTCSFPVRYLGHVEVEESRGMHVCEDAVKKLKAMGSVKSVLWVSADGLRVVDDKTKDLLVDQTIEKVSFCAPDRNLDKAFSYICRDGTTRRWICHCFLALKDSGERLSHAVGCAFAACLERKQRR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Numb-like protein
publication title Human NUMB-like protein, phosphotyrosine interaction domain
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 39
structure length 153
sequence length 155
ec nomenclature
pdb deposition date 2008-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00640 PID Phosphotyrosine interaction domain (PTB/PID)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3f0wA00
5HE3A 1Y19B 2M38A 3BINA 1DDWA 2YS5A 5D3WA 3PSCA 1OMWA 2CODA 1I2HA 2D9XA 1WI1A 1V5UA 3P7ZA 1V88A 1U29A 2YS3A 2Y7BA 5JLJB 1ZVRA 4HAWB 4F7HA 2MFQA 3DXEA 1UPRA 3PVUA 3A98B 3NSUA 2DHIA 1PLSA 1DYNA 1WGQA 1PMSA 3PVLA 4H8SA 3F0WA 1J19A 2EC1A 1MPHA 2KUPA 4PNKA 2K00A 5FI1A 4Z2NA 3ULCA 1UNRA 3O96A 4HDOA 4K81A 2P0DA 1XCGA 4HB0B 2CAYA 4WJ7A 1OY2A 2RGNB 4GMXB 1BTKA 5KCVA 1P3RA 2MWNB 2Z0OA 4K2OA 2R09A 4HAVB 2CY5A 1EAZA 4ZRJA 1PFJA 1ZC3B 3KY9A 4CHJA 2W2XD 2YF0A 1NTVA 2RVBB 3TCAA 4YONA 3FSSA 1UNQA 2VRWB 2DHKA 5C6RA 1MKEA 3WYFB 2ELBA 1GC6A 4P7IA 5CLQB 4DXAB 2DA0A 3QBVB 5DHAB 1V5MA 2QKLA 4IOYX 1W1GA 1V89A 1XD4A 5J3YA 3HW2B 3M1IB 2RLOA 3KRXA 4HB3B 4IFSA 2GS0A 3P6AA 4F7GA 2PZ1A 4BBKA 3HQCA 5JHHA 1MIZB 4D0NB 2G35A 4HAZB 2K2JA 2DFKA 1XX0A 2HE7A 2LOXA 1QC6A 1IRSA 1FGZA 1MAIA 2GCLA 3OANA 2J0MA 3D8FA 3PEGA 3CIKA 4A6KA 4C0AA 1WGUA 5CLLB 5C16A 3UZTA 1UEFA 3DXCA 1UNPA 3G9WA 3PZDA 1TJ6A 3PG7A 4KAXB 2UVMA 2YVCA 2E2XA 1DDVA 1X86A 4TKNA 2D4QA 5KQ4A 2H7DA 2D9WA 1K5DB 3N7CA 3AU5A 2UZSA 1B55A 4HAXB 3A8QA 2LYDA 5J3TA 4DX90 3V5WA 2R0DA 1FB8A 1V5PA 2DKPA 3QWMA 1Y5OA 1NU2A 3DXDA 1MK7B 2ELAA 1U5FA 2AEHA 3TO1A 2D10A 5FI0A 2CRFA 1XKEA 1EF1A 2YRYA 2OTXA 2W2XC 2DKQA 1NI2A 1X05A 3MDBC 4ZRKA 2COAA 4WVFB 1EVHA 4F7UP 2GJYA 3TW1A 1EGXA 1WG7A 3SV1A 2V76A 2N23A 2BCJA 3PP2A 1BWNA 2CY4A 2EMSA 1P5TA 4DBBA 4HB2B 2GCJA 3SNHA 5HE2A 1XODA 1WVHA 1SHCA 2YT1A 2RSGA 3SUZA 3VOQA 2FJLA 2D9ZA 2I1JA 1BTNA 4EJNA 3AU4A 4CYEA 1U5GA 4EMOA 4GPTB 2Y8FA 2AL6A 1TQZA 3MPXA 2L1CA 5L81A 4A6HA 3ODWA 1X1FA 2OQBA 3PVWA 1TXDA 4HAUB 2EJ8A 2Z0PA 2ADZA 3KZ1A 1LW3A 2ROVA 1X1GA 2P0HA 2D2QA 3ODXA 4EKUA 1DBHA 2JP2A 2I1KA 1RJ2A 1GC7A 3CXBB 4DX8A 5D3XA 2YS1A 2DN6A 1FGYA 1P6SA 1MIXA 4NSWA 1DDMA 2LOZA 4KHAA 4HATB 3VIAA 2H7EA 2K2UA 5D27A 1H10A 1Z87A 5DH9B 3ULBA 1J0WA 1UPQA 4L6EA 4HDQA 4IAPA 1MK9B 5C79A 2LULA 2XQNM 5D3YA 1KZGA 3GYPA 2ROZB 1V61A 4GN1A 4TYZA 1U5EA 2YSZA 3HK0A 4WSFA 1U27A 2NMBA 4Y94A 3KSYA 3TVVA 5KQ1A 2QKMA 4PQ0A 4KHBB 3TFMA 2NZ8B 1K5GB 2N0YA 2X18A 5EFXA 2L2IA 3T06A 2EMTA 1WJMA 4HHVA 3ODOA 2DX1A 4HB4B 4KHOA 3ZVRA 1W1HA 3F5RA 2W2WA 3A8PA 2DYNA 2HTHB 5C5BB 5J3QA 5HE1A 1LB1A 1ISNA 4MK0A 2YT0A 1ZSQA 4Z2MB 2M14A 3WA0A 3BJIA 1ZC4B 1KZ7A 2LKOA 5JHGA 1FHXA 4HAYB 1N3HA 2VSZA 3D8DA 1AWEA 4XWXA 2DYQA 1Q67A 3ML4A 4GXBA 3U7DA 1FHOA 4K2PA 2COCA 4YL8A 1NTYA 5DIFB 5DI9B 5C5BA 1BAKA 1W1DA 1RRPB 2D11A 2DHJA 2KCJA 4KVGB 3IVFA 1U5DA 1WJ1A 4K17A 2MKRA 2MDXA 2D9YA 2I5FA 5GOWB 4MT7A 2J0KA 3ZDTA 1E5WA 3D8EA 5LONB 2VKIA 2J59M 5D3VA 5HE0A 1I7AA 1XR0B 1FHWA 2I5CA 3KRWA 2P8VA 1KI1B 2DX5A 4A5KA 4A6FB 5JP4A 3X23A 5DHFB 1M7EA 2P0FA 4B6HA 1ZM0A 1FAOA 1OQNA 2IYBA 3SO6A 4GMVA 3GYOA 2LG1A 2Z0QA 3FM8C 3QIJA 3LJUX 3RCPA 4MY6A 1SGHA 2UZRA 1QQGA 1X11A 2ZPYA 1FOEA 2RNRB 2J0JA 1M7RA 2Y8GA 2COFA 2DTCA 2KGXB 1H4RA 1U2BA 2Q13A 3AJ4A 4A6FA 1GG3A 2RUKB 4NY0A 2DLWA 4GZUA 5LOPB 3FEHA 3SYXA 3U8ZA 4ZRIA 2D9VA 1AQCA 1DROA 2IFSA 4CHMA
chains in the Genus database with same CATH superfamily
5HE3A 1Y19B 2M38A 3BINA 1DDWA 4HSIA 2YS5A 5D3WA 3PSCA 1OMWA 2CODA 1I2HA 2D9XA 1WI1A 1V5UA 3P7ZA 1V88A 1U29A 2YS3A 2Y7BA 4QJ4B 5JLJB 1ZVRA 4HAWB 3NWFA 4F7HA 2MFQA 3DXEA 1UPRA 3PVUA 3A98B 3NSUA 2DHIA 4KHBA 1PLSA 1DYNA 1WGQA 1PMSA 3PVLA 4H8SA 3F0WA 1J19A 2EC1A 1MPHA 2KUPA 4PNKA 2K00A 5FI1A 4Z2NA 3ULCA 1UNRA 3O96A 1T77A 4HDOA 4K81A 2P0DA 1XCGA 4HB0B 2CAYA 4WJ7A 1OY2A 2RGNB 4GMXB 1BTKA 5KCVA 1P3RA 2MWNB 2Z0OA 4K2OA 2R09A 3NWDA 4HAVB 3DCXA 2CY5A 1EAZA 4ZRJA 1PFJA 1ZC3B 3HSAA 3KY9A 4CHJA 2W2XD 2YF0A 1NTVA 2RVBB 3TCAA 4YONA 3FSSA 1UNQA 2VRWB 2DHKA 3OHMB 5C6RA 1MKEA 3WYFB 2ELBA 1GC6A 4P7IA 5CLQB 4DXAB 2DA0A 3QBVB 5DHAB 1V5MA 2QKLA 4IOYX 1W1GA 1V89A 1XD4A 5J3YA 4QJ5B 3HW2B 3M1IB 2RLOA 3KRXA 4HB3B 4IFSA 2GS0A 3P6AA 4F7GA 2PZ1A 4BBKA 3HQCA 5JHHA 1MIZB 1MI1A 4D0NB 2G35A 4HAZB 5I2MA 2K2JA 5I2SA 2DFKA 1XX0A 2HE7A 2LOXA 1QC6A 1IRSA 1FGZA 2K8EA 1MAIA 2GCLA 3OANA 3FVCA 2J0MA 3D8FA 3PEGA 3CIKA 4L1RA 4A6KA 4C0AA 1WGUA 5CLLB 5C16A 3UZTA 1UEFA 3DXCA 1UNPA 3G9WA 3B77A 3PZDA 1TJ6A 3PG7A 4KAXB 2UVMA 2KR0A 2YVCA 2E2XA 1DDVA 1X86A 4TKNA 2D4QA 5KQ4A 2H7DA 2D9WA 1K5DB 3N7CA 3AU5A 2UZSA 1B55A 4HAXB 3A8QA 2Z59A 4OT1A 2LYDA 5J3TA 4DX90 3V5WA 2R0DA 1FB8A 1V5PA 2DKPA 3QWMA 1Y5OA 1NU2A 3DXDA 1MK7B 2ELAA 1U5FA 2AEHA 3TO1A 2D10A 5FI0A 2Z14A 2CRFA 2KUQA 2Z13A 1XKEA 1EF1A 2YRYA 2OTXA 2W2XC 2DKQA 1NI2A 1X05A 3MDBC 4ZRKA 2COAA 4WVFB 1EVHA 4F7UP 2GJYA 3TW1A 1EGXA 1WG7A 3SV1A 2V76A 2N23A 2BCJA 3PP2A 1BWNA 2CY4A 2EMSA 1P5TA 4DBBA 4HB2B 2GCJA 3SNHA 5HE2A 5LG4B 1XODA 1WVHA 1SHCA 2YT1A 2RSGA 3SUZA 3VOQA 2FJLA 2D9ZA 2I1JA 1BTNA 4EJNA 3AU4A 4CYEA 1U5GA 4EMOA 4GPTB 2Y8FA 2AL6A 1TQZA 3MPXA 2L1CA 5L81A 4A6HA 3ODWA 1X1FA 2OQBA 3PVWA 1TXDA 4HAUB 2EJ8A 2Z0PA 2ADZA 2YT2A 3KZ1A 1LW3A 2ROVA 1X1GA 2KIEA 2P0HA 2D2QA 3ODXA 4EKUA 1DBHA 2JP2A 2I1KA 1RJ2A 1GC7A 4QJ3B 3CXBB 4DX8A 5D3XA 4GNKB 2KIGA 2YS1A 2DN6A 1FGYA 1P6SA 1MIXA 4NSWA 1DDMA 2LOZA 4DIXA 4KHAA 2GUMA 4HATB 3VIAA 2H7EA 2K2UA 5D27A 1H10A 1Z87A 5DH9B 3ULBA 1J0WA 1UPQA 4L6EA 4HDQA 4IAPA 1MK9B 5C79A 4D6WA 2LULA 2XQNM 5D3YA 1KZGA 2R2YA 3GYPA 2ROZB 1V61A 4GN1A 4TYZA 4QXAB 1U5EA 2YSZA 3HK0A 4WSFA 1U27A 2NMBA 4Y94A 3KSYA 3TVVA 5KQ1A 2QKMA 4PQ0A 4KHBB 3TFMA 2NZ8B 1K5GB 2N0YA 2X18A 5EFXA 3A58A 2L2IA 3T06A 2EMTA 1WJMA 4HHVA 5M4YB 3ODOA 4OSNA 2DX1A 4HB4B 4KHOA 3ZVRA 1W1HA 3F5RA 4GOUA 2W2WA 3A8PA 1ZYIA 2DYNA 2HTHB 5C5BB 3NW8A 5J3QA 5HE1A 1LB1A 1ISNA 4MK0A 2YT0A 1ZSQA 4Z2MB 2M14A 3WA0A 3BJIA 1ZC4B 1KZ7A 2LKOA 5JHGA 1FHXA 4HAYB 1N3HA 5IRSA 2VSZA 3D8DA 1AWEA 4XWXA 2DYQA 1Q67A 2RRFA 3ML4A 4GXBA 3U7DA 1FHOA 4K2PA 2COCA 4YL8A 1NTYA 5DIFB 5DI9B 2K49A 5C5BA 1BAKA 1W1DA 1RRPB 2D11A 2DHJA 2KCJA 4KVGB 3IVFA 1U5DA 1WJ1A 4K17A 2MKRA 2MDXA 2D9YA 2I5FA 2FJUB 2ZKMX 5GOWB 4MT7A 2J0KA 3ZDTA 1E5WA 3D8EA 5LONB 2VKIA 2J59M 5D3VA 5HE0A 1I7AA 1XR0B 1FHWA 2I5CA 2NBVA 3KRWA 2P8VA 1KI1B 2DX5A 4A5KA 4A6FB 5JP4A 3X23A 5DHFB 1M7EA 2P0FA 4B6HA 1ZM0A 2Z4DA 3U12A 1FAOA 1OQNA 2IYBA 3SO6A 4GMVA 3GYOA 2LG1A 2Z0QA 3FM8C 3QIJA 3LJUX 3RCPA 4MY6A 1SGHA 2UZRA 3NWAA 1QQGA 1X11A 2ZPYA 1FOEA 2RNRB 2J0JA 1M7RA 2Y8GA 2COFA 2DTCA 2KGXB 1H4RA 1U2BA 3HIEA 2Q13A 3AJ4A 4A6FA 1GG3A 2RUKB 4CSQA 4NY0A 2DLWA 4GZUA 5LOPB 3FEHA 3SYXA 3U8ZA 4ZRIA 2D9VA 1AQCA 1DROA 2IFSA 4CHMA
chains in the Genus database with same CATH topology
5HE3A 1Y19B 2M38A 3BINA 1DDWA 2YS5A 5D3WA 3PSCA 1OMWA 2CODA 1I2HA 2D9XA 1WI1A 1V5UA 3P7ZA 1V88A 1U29A 2YS3A 2Y7BA 5JLJB 1ZVRA 4HAWB 4F7HA 2MFQA 3DXEA 1UPRA 3PVUA 3A98B 3NSUA 2DHIA 1PLSA 1DYNA 1WGQA 1PMSA 3PVLA 4H8SA 3F0WA 1J19A 2EC1A 1MPHA 2KUPA 4PNKA 2K00A 5FI1A 4Z2NA 3ULCA 1UNRA 3O96A 4HDOA 4K81A 2P0DA 1XCGA 4HB0B 2CAYA 4WJ7A 1OY2A 2RGNB 4GMXB 1BTKA 5KCVA 1P3RA 2MWNB 2Z0OA 4K2OA 2R09A 4HAVB 2CY5A 1EAZA 4ZRJA 1PFJA 1ZC3B 3KY9A 4CHJA 2W2XD 2YF0A 1NTVA 2RVBB 3TCAA 4YONA 3FSSA 1UNQA 2VRWB 2DHKA 5C6RA 1MKEA 3WYFB 2ELBA 1GC6A 4P7IA 5CLQB 4DXAB 2DA0A 3QBVB 5DHAB 1V5MA 2QKLA 4IOYX 1W1GA 1V89A 1XD4A 5J3YA 3HW2B 3M1IB 2RLOA 3KRXA 4HB3B 4IFSA 2GS0A 3P6AA 4F7GA 2PZ1A 4BBKA 3HQCA 5JHHA 1MIZB 4D0NB 2G35A 4HAZB 2K2JA 2DFKA 1XX0A 2HE7A 2LOXA 1QC6A 1IRSA 1FGZA 1MAIA 2GCLA 3OANA 2J0MA 3D8FA 3PEGA 3CIKA 4A6KA 4C0AA 1WGUA 5CLLB 5C16A 3UZTA 1UEFA 3DXCA 1UNPA 3G9WA 3PZDA 1TJ6A 3PG7A 4KAXB 2UVMA 2YVCA 2E2XA 1DDVA 1X86A 4TKNA 2D4QA 5KQ4A 2H7DA 2D9WA 1K5DB 3N7CA 3AU5A 2UZSA 1B55A 4HAXB 3A8QA 2LYDA 5J3TA 4DX90 3V5WA 2R0DA 1FB8A 1V5PA 2DKPA 3QWMA 1Y5OA 1NU2A 3DXDA 1MK7B 2ELAA 1U5FA 2AEHA 3TO1A 2D10A 5FI0A 2CRFA 1XKEA 1EF1A 2YRYA 2OTXA 2W2XC 2DKQA 1NI2A 1X05A 3MDBC 4ZRKA 2COAA 4WVFB 1EVHA 4F7UP 2GJYA 3TW1A 1EGXA 1WG7A 3SV1A 2V76A 2N23A 2BCJA 3PP2A 1BWNA 2CY4A 2EMSA 1P5TA 4DBBA 4HB2B 2GCJA 3SNHA 5HE2A 1XODA 1WVHA 1SHCA 2YT1A 2RSGA 3SUZA 3VOQA 2FJLA 2D9ZA 2I1JA 1BTNA 4EJNA 3AU4A 4CYEA 1U5GA 4EMOA 4GPTB 2Y8FA 2AL6A 1TQZA 3MPXA 2L1CA 5L81A 4A6HA 3ODWA 1X1FA 2OQBA 3PVWA 1TXDA 4HAUB 2EJ8A 2Z0PA 2ADZA 3KZ1A 1LW3A 2ROVA 1X1GA 2P0HA 2D2QA 3ODXA 4EKUA 1DBHA 2JP2A 2I1KA 1RJ2A 1GC7A 3CXBB 4DX8A 5D3XA 2YS1A 2DN6A 1FGYA 1P6SA 1MIXA 4NSWA 1DDMA 2LOZA 4KHAA 4HATB 3VIAA 2H7EA 2K2UA 5D27A 1H10A 1Z87A 5DH9B 3ULBA 1J0WA 1UPQA 4L6EA 4HDQA 4IAPA 1MK9B 5C79A 2LULA 2XQNM 5D3YA 1KZGA 3GYPA 2ROZB 1V61A 4GN1A 4TYZA 1U5EA 2YSZA 3HK0A 4WSFA 1U27A 2NMBA 4Y94A 3KSYA 3TVVA 5KQ1A 2QKMA 4PQ0A 4KHBB 3TFMA 2NZ8B 1K5GB 2N0YA 2X18A 5EFXA 2L2IA 3T06A 2EMTA 1WJMA 4HHVA 3ODOA 2DX1A 4HB4B 4KHOA 3ZVRA 1W1HA 3F5RA 2W2WA 3A8PA 2DYNA 2HTHB 5C5BB 5J3QA 5HE1A 1LB1A 1ISNA 4MK0A 2YT0A 1ZSQA 4Z2MB 2M14A 3WA0A 3BJIA 1ZC4B 1KZ7A 2LKOA 5JHGA 1FHXA 4HAYB 1N3HA 2VSZA 3D8DA 1AWEA 4XWXA 2DYQA 1Q67A 3ML4A 4GXBA 3U7DA 1FHOA 4K2PA 2COCA 4YL8A 1NTYA 5DIFB 5DI9B 5C5BA 1BAKA 1W1DA 1RRPB 2D11A 2DHJA 2KCJA 4KVGB 3IVFA 1U5DA 1WJ1A 4K17A 2MKRA 2MDXA 2D9YA 2I5FA 5GOWB 4MT7A 2J0KA 3ZDTA 1E5WA 3D8EA 5LONB 2VKIA 2J59M 5D3VA 5HE0A 1I7AA 1XR0B 1FHWA 2I5CA 3KRWA 2P8VA 1KI1B 2DX5A 4A5KA 4A6FB 5JP4A 3X23A 5DHFB 1M7EA 2P0FA 4B6HA 1ZM0A 1FAOA 1OQNA 2IYBA 3SO6A 4GMVA 3GYOA 2LG1A 2Z0QA 3FM8C 3QIJA 3LJUX 3RCPA 4MY6A 1SGHA 2UZRA 1QQGA 1X11A 2ZPYA 1FOEA 2RNRB 2J0JA 1M7RA 2Y8GA 2COFA 2DTCA 2KGXB 1H4RA 1U2BA 2Q13A 3AJ4A 4A6FA 1GG3A 2RUKB 4NY0A 2DLWA 4GZUA 5LOPB 3FEHA 3SYXA 3U8ZA 4ZRIA 2D9VA 1AQCA 1DROA 2IFSA 4CHMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HE3 A;  1Y19 B;  2M38 A;  3BIN A;  1DDW A;  2YS5 A;  5D3W A;  3PSC A;  1OMW A;  2COD A;  1I2H A;  2D9X A;  1WI1 A;  1V5U A;  3P7Z A;  1V88 A;  1U29 A;  2YS3 A;  2Y7B A;  5JLJ B;  1ZVR A;  4HAW B;  4F7H A;  2MFQ A;  3DXE A;  1UPR A;  3PVU A;  3A98 B;  3NSU A;  2DHI A;  1PLS A;  1DYN A;  1WGQ A;  1PMS A;  3PVL A;  4H8S A;  3F0W A;  1J19 A;  2EC1 A;  1MPH A;  2KUP A;  4PNK A;  2K00 A;  5FI1 A;  4Z2N A;  3ULC A;  1UNR A;  3O96 A;  4HDO A;  4K81 A;  2P0D A;  1XCG A;  4HB0 B;  2CAY A;  4WJ7 A;  1OY2 A;  2RGN B;  4GMX B;  1BTK A;  5KCV A;  1P3R A;  2MWN B;  2Z0O A;  4K2O A;  2R09 A;  4HAV B;  2CY5 A;  1EAZ A;  4ZRJ A;  1PFJ A;  1ZC3 B;  3KY9 A;  4CHJ A;  2W2X D;  2YF0 A;  1NTV A;  2RVB B;  3TCA A;  4YON A;  3FSS A;  1UNQ A;  2VRW B;  2DHK A;  5C6R A;  1MKE A;  3WYF B;  2ELB A;  1GC6 A;  4P7I A;  5CLQ B;  4DXA B;  2DA0 A;  3QBV B;  5DHA B;  1V5M A;  2QKL A;  4IOY X;  1W1G A;  1V89 A;  1XD4 A;  5J3Y A;  3HW2 B;  3M1I B;  2RLO A;  3KRX A;  4HB3 B;  4IFS A;  2GS0 A;  3P6A A;  4F7G A;  2PZ1 A;  4BBK A;  3HQC A;  5JHH A;  1MIZ B;  4D0N B;  2G35 A;  4HAZ B;  2K2J A;  2DFK A;  1XX0 A;  2HE7 A;  2LOX A;  1QC6 A;  1IRS A;  1FGZ A;  1MAI A;  2GCL A;  3OAN A;  2J0M A;  3D8F A;  3PEG A;  3CIK A;  4A6K A;  4C0A A;  1WGU A;  5CLL B;  5C16 A;  3UZT A;  1UEF A;  3DXC A;  1UNP A;  3G9W A;  3PZD A;  1TJ6 A;  3PG7 A;  4KAX B;  2UVM A;  2YVC A;  2E2X A;  1DDV A;  1X86 A;  4TKN A;  2D4Q A;  5KQ4 A;  2H7D A;  2D9W A;  1K5D B;  3N7C A;  3AU5 A;  2UZS A;  1B55 A;  4HAX B;  3A8Q A;  2LYD A;  5J3T A;  4DX9 0;  3V5W A;  2R0D A;  1FB8 A;  1V5P A;  2DKP A;  3QWM A;  1Y5O A;  1NU2 A;  3DXD A;  1MK7 B;  2ELA A;  1U5F A;  2AEH A;  3TO1 A;  2D10 A;  5FI0 A;  2CRF A;  1XKE A;  1EF1 A;  2YRY A;  2OTX A;  2W2X C;  2DKQ A;  1NI2 A;  1X05 A;  3MDB C;  4ZRK A;  2COA A;  4WVF B;  1EVH A;  4F7U P;  2GJY A;  3TW1 A;  1EGX A;  1WG7 A;  3SV1 A;  2V76 A;  2N23 A;  2BCJ A;  3PP2 A;  1BWN A;  2CY4 A;  2EMS A;  1P5T A;  4DBB A;  4HB2 B;  2GCJ A;  3SNH A;  5HE2 A;  1XOD A;  1WVH A;  1SHC A;  2YT1 A;  2RSG A;  3SUZ A;  3VOQ A;  2FJL A;  2D9Z A;  2I1J A;  1BTN A;  4EJN A;  3AU4 A;  4CYE A;  1U5G A;  4EMO A;  4GPT B;  2Y8F A;  2AL6 A;  1TQZ A;  3MPX A;  2L1C A;  5L81 A;  4A6H A;  3ODW A;  1X1F A;  2OQB A;  3PVW A;  1TXD A;  4HAU B;  2EJ8 A;  2Z0P A;  2ADZ A;  3KZ1 A;  1LW3 A;  2ROV A;  1X1G A;  2P0H A;  2D2Q A;  3ODX A;  4EKU A;  1DBH A;  2JP2 A;  2I1K A;  1RJ2 A;  1GC7 A;  3CXB B;  4DX8 A;  5D3X A;  2YS1 A;  2DN6 A;  1FGY A;  1P6S A;  1MIX A;  4NSW A;  1DDM A;  2LOZ A;  4KHA A;  4HAT B;  3VIA A;  2H7E A;  2K2U A;  5D27 A;  1H10 A;  1Z87 A;  5DH9 B;  3ULB A;  1J0W A;  1UPQ A;  4L6E A;  4HDQ A;  4IAP A;  1MK9 B;  5C79 A;  2LUL A;  2XQN M;  5D3Y A;  1KZG A;  3GYP A;  2ROZ B;  1V61 A;  4GN1 A;  4TYZ A;  1U5E A;  2YSZ A;  3HK0 A;  4WSF A;  1U27 A;  2NMB A;  4Y94 A;  3KSY A;  3TVV A;  5KQ1 A;  2QKM A;  4PQ0 A;  4KHB B;  3TFM A;  2NZ8 B;  1K5G B;  2N0Y A;  2X18 A;  5EFX A;  2L2I A;  3T06 A;  2EMT A;  1WJM A;  4HHV A;  3ODO A;  2DX1 A;  4HB4 B;  4KHO A;  3ZVR A;  1W1H A;  3F5R A;  2W2W A;  3A8P A;  2DYN A;  2HTH B;  5C5B B;  5J3Q A;  5HE1 A;  1LB1 A;  1ISN A;  4MK0 A;  2YT0 A;  1ZSQ A;  4Z2M B;  2M14 A;  3WA0 A;  3BJI A;  1ZC4 B;  1KZ7 A;  2LKO A;  5JHG A;  1FHX A;  4HAY B;  1N3H A;  2VSZ A;  3D8D A;  1AWE A;  4XWX A;  2DYQ A;  1Q67 A;  3ML4 A;  4GXB A;  3U7D A;  1FHO A;  4K2P A;  2COC A;  4YL8 A;  1NTY A;  5DIF B;  5DI9 B;  5C5B A;  1BAK A;  1W1D A;  1RRP B;  2D11 A;  2DHJ A;  2KCJ A;  4KVG B;  3IVF A;  1U5D A;  1WJ1 A;  4K17 A;  2MKR A;  2MDX A;  2D9Y A;  2I5F A;  5GOW B;  4MT7 A;  2J0K A;  3ZDT A;  1E5W A;  3D8E A;  5LON B;  2VKI A;  2J59 M;  5D3V A;  5HE0 A;  1I7A A;  1XR0 B;  1FHW A;  2I5C A;  3KRW A;  2P8V A;  1KI1 B;  2DX5 A;  4A5K A;  4A6F B;  5JP4 A;  3X23 A;  5DHF B;  1M7E A;  2P0F A;  4B6H A;  1ZM0 A;  1FAO A;  1OQN A;  2IYB A;  3SO6 A;  4GMV A;  3GYO A;  2LG1 A;  2Z0Q A;  3FM8 C;  3QIJ A;  3LJU X;  3RCP A;  4MY6 A;  1SGH A;  2UZR A;  1QQG A;  1X11 A;  2ZPY A;  1FOE A;  2RNR B;  2J0J A;  1M7R A;  2Y8G A;  2COF A;  2DTC A;  2KGX B;  1H4R A;  1U2B A;  2Q13 A;  3AJ4 A;  4A6F A;  1GG3 A;  2RUK B;  4NY0 A;  2DLW A;  4GZU A;  5LOP B;  3FEH A;  3SYX A;  3U8Z A;  4ZRI A;  2D9V A;  1AQC A;  1DRO A;  2IFS A;  4CHM A; 
#chains in the Genus database with same CATH topology
 5HE3 A;  1Y19 B;  2M38 A;  3BIN A;  1DDW A;  4HSI A;  2YS5 A;  5D3W A;  3PSC A;  1OMW A;  2COD A;  1I2H A;  2D9X A;  1WI1 A;  1V5U A;  3P7Z A;  1V88 A;  1U29 A;  2YS3 A;  2Y7B A;  4QJ4 B;  5JLJ B;  1ZVR A;  4HAW B;  3NWF A;  4F7H A;  2MFQ A;  3DXE A;  1UPR A;  3PVU A;  3A98 B;  3NSU A;  2DHI A;  4KHB A;  1PLS A;  1DYN A;  1WGQ A;  1PMS A;  3PVL A;  4H8S A;  3F0W A;  1J19 A;  2EC1 A;  1MPH A;  2KUP A;  4PNK A;  2K00 A;  5FI1 A;  4Z2N A;  3ULC A;  1UNR A;  3O96 A;  1T77 A;  4HDO A;  4K81 A;  2P0D A;  1XCG A;  4HB0 B;  2CAY A;  4WJ7 A;  1OY2 A;  2RGN B;  4GMX B;  1BTK A;  5KCV A;  1P3R A;  2MWN B;  2Z0O A;  4K2O A;  2R09 A;  3NWD A;  4HAV B;  3DCX A;  2CY5 A;  1EAZ A;  4ZRJ A;  1PFJ A;  1ZC3 B;  3HSA A;  3KY9 A;  4CHJ A;  2W2X D;  2YF0 A;  1NTV A;  2RVB B;  3TCA A;  4YON A;  3FSS A;  1UNQ A;  2VRW B;  2DHK A;  3OHM B;  5C6R A;  1MKE A;  3WYF B;  2ELB A;  1GC6 A;  4P7I A;  5CLQ B;  4DXA B;  2DA0 A;  3QBV B;  5DHA B;  1V5M A;  2QKL A;  4IOY X;  1W1G A;  1V89 A;  1XD4 A;  5J3Y A;  4QJ5 B;  3HW2 B;  3M1I B;  2RLO A;  3KRX A;  4HB3 B;  4IFS A;  2GS0 A;  3P6A A;  4F7G A;  2PZ1 A;  4BBK A;  3HQC A;  5JHH A;  1MIZ B;  1MI1 A;  4D0N B;  2G35 A;  4HAZ B;  5I2M A;  2K2J A;  5I2S A;  2DFK A;  1XX0 A;  2HE7 A;  2LOX A;  1QC6 A;  1IRS A;  1FGZ A;  2K8E A;  1MAI A;  2GCL A;  3OAN A;  3FVC A;  2J0M A;  3D8F A;  3PEG A;  3CIK A;  4L1R A;  4A6K A;  4C0A A;  1WGU A;  5CLL B;  5C16 A;  3UZT A;  1UEF A;  3DXC A;  1UNP A;  3G9W A;  3B77 A;  3PZD A;  1TJ6 A;  3PG7 A;  4KAX B;  2UVM A;  2KR0 A;  2YVC A;  2E2X A;  1DDV A;  1X86 A;  4TKN A;  2D4Q A;  5KQ4 A;  2H7D A;  2D9W A;  1K5D B;  3N7C A;  3AU5 A;  2UZS A;  1B55 A;  4HAX B;  3A8Q A;  2Z59 A;  4OT1 A;  2LYD A;  5J3T A;  4DX9 0;  3V5W A;  2R0D A;  1FB8 A;  1V5P A;  2DKP A;  3QWM A;  1Y5O A;  1NU2 A;  3DXD A;  1MK7 B;  2ELA A;  1U5F A;  2AEH A;  3TO1 A;  2D10 A;  5FI0 A;  2Z14 A;  2CRF A;  2KUQ A;  2Z13 A;  1XKE A;  1EF1 A;  2YRY A;  2OTX A;  2W2X C;  2DKQ A;  1NI2 A;  1X05 A;  3MDB C;  4ZRK A;  2COA A;  4WVF B;  1EVH A;  4F7U P;  2GJY A;  3TW1 A;  1EGX A;  1WG7 A;  3SV1 A;  2V76 A;  2N23 A;  2BCJ A;  3PP2 A;  1BWN A;  2CY4 A;  2EMS A;  1P5T A;  4DBB A;  4HB2 B;  2GCJ A;  3SNH A;  5HE2 A;  5LG4 B;  1XOD A;  1WVH A;  1SHC A;  2YT1 A;  2RSG A;  3SUZ A;  3VOQ A;  2FJL A;  2D9Z A;  2I1J A;  1BTN A;  4EJN A;  3AU4 A;  4CYE A;  1U5G A;  4EMO A;  4GPT B;  2Y8F A;  2AL6 A;  1TQZ A;  3MPX A;  2L1C A;  5L81 A;  4A6H A;  3ODW A;  1X1F A;  2OQB A;  3PVW A;  1TXD A;  4HAU B;  2EJ8 A;  2Z0P A;  2ADZ A;  2YT2 A;  3KZ1 A;  1LW3 A;  2ROV A;  1X1G A;  2KIE A;  2P0H A;  2D2Q A;  3ODX A;  4EKU A;  1DBH A;  2JP2 A;  2I1K A;  1RJ2 A;  1GC7 A;  4QJ3 B;  3CXB B;  4DX8 A;  5D3X A;  4GNK B;  2KIG A;  2YS1 A;  2DN6 A;  1FGY A;  1P6S A;  1MIX A;  4NSW A;  1DDM A;  2LOZ A;  4DIX A;  4KHA A;  2GUM A;  4HAT B;  3VIA A;  2H7E A;  2K2U A;  5D27 A;  1H10 A;  1Z87 A;  5DH9 B;  3ULB A;  1J0W A;  1UPQ A;  4L6E A;  4HDQ A;  4IAP A;  1MK9 B;  5C79 A;  4D6W A;  2LUL A;  2XQN M;  5D3Y A;  1KZG A;  2R2Y A;  3GYP A;  2ROZ B;  1V61 A;  4GN1 A;  4TYZ A;  4QXA B;  1U5E A;  2YSZ A;  3HK0 A;  4WSF A;  1U27 A;  2NMB A;  4Y94 A;  3KSY A;  3TVV A;  5KQ1 A;  2QKM A;  4PQ0 A;  4KHB B;  3TFM A;  2NZ8 B;  1K5G B;  2N0Y A;  2X18 A;  5EFX A;  3A58 A;  2L2I A;  3T06 A;  2EMT A;  1WJM A;  4HHV A;  5M4Y B;  3ODO A;  4OSN A;  2DX1 A;  4HB4 B;  4KHO A;  3ZVR A;  1W1H A;  3F5R A;  4GOU A;  2W2W A;  3A8P A;  1ZYI A;  2DYN A;  2HTH B;  5C5B B;  3NW8 A;  5J3Q A;  5HE1 A;  1LB1 A;  1ISN A;  4MK0 A;  2YT0 A;  1ZSQ A;  4Z2M B;  2M14 A;  3WA0 A;  3BJI A;  1ZC4 B;  1KZ7 A;  2LKO A;  5JHG A;  1FHX A;  4HAY B;  1N3H A;  5IRS A;  2VSZ A;  3D8D A;  1AWE A;  4XWX A;  2DYQ A;  1Q67 A;  2RRF A;  3ML4 A;  4GXB A;  3U7D A;  1FHO A;  4K2P A;  2COC A;  4YL8 A;  1NTY A;  5DIF B;  5DI9 B;  2K49 A;  5C5B A;  1BAK A;  1W1D A;  1RRP B;  2D11 A;  2DHJ A;  2KCJ A;  4KVG B;  3IVF A;  1U5D A;  1WJ1 A;  4K17 A;  2MKR A;  2MDX A;  2D9Y A;  2I5F A;  2FJU B;  2ZKM X;  5GOW B;  4MT7 A;  2J0K A;  3ZDT A;  1E5W A;  3D8E A;  5LON B;  2VKI A;  2J59 M;  5D3V A;  5HE0 A;  1I7A A;  1XR0 B;  1FHW A;  2I5C A;  2NBV A;  3KRW A;  2P8V A;  1KI1 B;  2DX5 A;  4A5K A;  4A6F B;  5JP4 A;  3X23 A;  5DHF B;  1M7E A;  2P0F A;  4B6H A;  1ZM0 A;  2Z4D A;  3U12 A;  1FAO A;  1OQN A;  2IYB A;  3SO6 A;  4GMV A;  3GYO A;  2LG1 A;  2Z0Q A;  3FM8 C;  3QIJ A;  3LJU X;  3RCP A;  4MY6 A;  1SGH A;  2UZR A;  3NWA A;  1QQG A;  1X11 A;  2ZPY A;  1FOE A;  2RNR B;  2J0J A;  1M7R A;  2Y8G A;  2COF A;  2DTC A;  2KGX B;  1H4R A;  1U2B A;  3HIE A;  2Q13 A;  3AJ4 A;  4A6F A;  1GG3 A;  2RUK B;  4CSQ A;  4NY0 A;  2DLW A;  4GZU A;  5LOP B;  3FEH A;  3SYX A;  3U8Z A;  4ZRI A;  2D9V A;  1AQC A;  1DRO A;  2IFS A;  4CHM A; 
#chains in the Genus database with same CATH homology
 5HE3 A;  1Y19 B;  2M38 A;  3BIN A;  1DDW A;  2YS5 A;  5D3W A;  3PSC A;  1OMW A;  2COD A;  1I2H A;  2D9X A;  1WI1 A;  1V5U A;  3P7Z A;  1V88 A;  1U29 A;  2YS3 A;  2Y7B A;  5JLJ B;  1ZVR A;  4HAW B;  4F7H A;  2MFQ A;  3DXE A;  1UPR A;  3PVU A;  3A98 B;  3NSU A;  2DHI A;  1PLS A;  1DYN A;  1WGQ A;  1PMS A;  3PVL A;  4H8S A;  3F0W A;  1J19 A;  2EC1 A;  1MPH A;  2KUP A;  4PNK A;  2K00 A;  5FI1 A;  4Z2N A;  3ULC A;  1UNR A;  3O96 A;  4HDO A;  4K81 A;  2P0D A;  1XCG A;  4HB0 B;  2CAY A;  4WJ7 A;  1OY2 A;  2RGN B;  4GMX B;  1BTK A;  5KCV A;  1P3R A;  2MWN B;  2Z0O A;  4K2O A;  2R09 A;  4HAV B;  2CY5 A;  1EAZ A;  4ZRJ A;  1PFJ A;  1ZC3 B;  3KY9 A;  4CHJ A;  2W2X D;  2YF0 A;  1NTV A;  2RVB B;  3TCA A;  4YON A;  3FSS A;  1UNQ A;  2VRW B;  2DHK A;  5C6R A;  1MKE A;  3WYF B;  2ELB A;  1GC6 A;  4P7I A;  5CLQ B;  4DXA B;  2DA0 A;  3QBV B;  5DHA B;  1V5M A;  2QKL A;  4IOY X;  1W1G A;  1V89 A;  1XD4 A;  5J3Y A;  3HW2 B;  3M1I B;  2RLO A;  3KRX A;  4HB3 B;  4IFS A;  2GS0 A;  3P6A A;  4F7G A;  2PZ1 A;  4BBK A;  3HQC A;  5JHH A;  1MIZ B;  4D0N B;  2G35 A;  4HAZ B;  2K2J A;  2DFK A;  1XX0 A;  2HE7 A;  2LOX A;  1QC6 A;  1IRS A;  1FGZ A;  1MAI A;  2GCL A;  3OAN A;  2J0M A;  3D8F A;  3PEG A;  3CIK A;  4A6K A;  4C0A A;  1WGU A;  5CLL B;  5C16 A;  3UZT A;  1UEF A;  3DXC A;  1UNP A;  3G9W A;  3PZD A;  1TJ6 A;  3PG7 A;  4KAX B;  2UVM A;  2YVC A;  2E2X A;  1DDV A;  1X86 A;  4TKN A;  2D4Q A;  5KQ4 A;  2H7D A;  2D9W A;  1K5D B;  3N7C A;  3AU5 A;  2UZS A;  1B55 A;  4HAX B;  3A8Q A;  2LYD A;  5J3T A;  4DX9 0;  3V5W A;  2R0D A;  1FB8 A;  1V5P A;  2DKP A;  3QWM A;  1Y5O A;  1NU2 A;  3DXD A;  1MK7 B;  2ELA A;  1U5F A;  2AEH A;  3TO1 A;  2D10 A;  5FI0 A;  2CRF A;  1XKE A;  1EF1 A;  2YRY A;  2OTX A;  2W2X C;  2DKQ A;  1NI2 A;  1X05 A;  3MDB C;  4ZRK A;  2COA A;  4WVF B;  1EVH A;  4F7U P;  2GJY A;  3TW1 A;  1EGX A;  1WG7 A;  3SV1 A;  2V76 A;  2N23 A;  2BCJ A;  3PP2 A;  1BWN A;  2CY4 A;  2EMS A;  1P5T A;  4DBB A;  4HB2 B;  2GCJ A;  3SNH A;  5HE2 A;  1XOD A;  1WVH A;  1SHC A;  2YT1 A;  2RSG A;  3SUZ A;  3VOQ A;  2FJL A;  2D9Z A;  2I1J A;  1BTN A;  4EJN A;  3AU4 A;  4CYE A;  1U5G A;  4EMO A;  4GPT B;  2Y8F A;  2AL6 A;  1TQZ A;  3MPX A;  2L1C A;  5L81 A;  4A6H A;  3ODW A;  1X1F A;  2OQB A;  3PVW A;  1TXD A;  4HAU B;  2EJ8 A;  2Z0P A;  2ADZ A;  3KZ1 A;  1LW3 A;  2ROV A;  1X1G A;  2P0H A;  2D2Q A;  3ODX A;  4EKU A;  1DBH A;  2JP2 A;  2I1K A;  1RJ2 A;  1GC7 A;  3CXB B;  4DX8 A;  5D3X A;  2YS1 A;  2DN6 A;  1FGY A;  1P6S A;  1MIX A;  4NSW A;  1DDM A;  2LOZ A;  4KHA A;  4HAT B;  3VIA A;  2H7E A;  2K2U A;  5D27 A;  1H10 A;  1Z87 A;  5DH9 B;  3ULB A;  1J0W A;  1UPQ A;  4L6E A;  4HDQ A;  4IAP A;  1MK9 B;  5C79 A;  2LUL A;  2XQN M;  5D3Y A;  1KZG A;  3GYP A;  2ROZ B;  1V61 A;  4GN1 A;  4TYZ A;  1U5E A;  2YSZ A;  3HK0 A;  4WSF A;  1U27 A;  2NMB A;  4Y94 A;  3KSY A;  3TVV A;  5KQ1 A;  2QKM A;  4PQ0 A;  4KHB B;  3TFM A;  2NZ8 B;  1K5G B;  2N0Y A;  2X18 A;  5EFX A;  2L2I A;  3T06 A;  2EMT A;  1WJM A;  4HHV A;  3ODO A;  2DX1 A;  4HB4 B;  4KHO A;  3ZVR A;  1W1H A;  3F5R A;  2W2W A;  3A8P A;  2DYN A;  2HTH B;  5C5B B;  5J3Q A;  5HE1 A;  1LB1 A;  1ISN A;  4MK0 A;  2YT0 A;  1ZSQ A;  4Z2M B;  2M14 A;  3WA0 A;  3BJI A;  1ZC4 B;  1KZ7 A;  2LKO A;  5JHG A;  1FHX A;  4HAY B;  1N3H A;  2VSZ A;  3D8D A;  1AWE A;  4XWX A;  2DYQ A;  1Q67 A;  3ML4 A;  4GXB A;  3U7D A;  1FHO A;  4K2P A;  2COC A;  4YL8 A;  1NTY A;  5DIF B;  5DI9 B;  5C5B A;  1BAK A;  1W1D A;  1RRP B;  2D11 A;  2DHJ A;  2KCJ A;  4KVG B;  3IVF A;  1U5D A;  1WJ1 A;  4K17 A;  2MKR A;  2MDX A;  2D9Y A;  2I5F A;  5GOW B;  4MT7 A;  2J0K A;  3ZDT A;  1E5W A;  3D8E A;  5LON B;  2VKI A;  2J59 M;  5D3V A;  5HE0 A;  1I7A A;  1XR0 B;  1FHW A;  2I5C A;  3KRW A;  2P8V A;  1KI1 B;  2DX5 A;  4A5K A;  4A6F B;  5JP4 A;  3X23 A;  5DHF B;  1M7E A;  2P0F A;  4B6H A;  1ZM0 A;  1FAO A;  1OQN A;  2IYB A;  3SO6 A;  4GMV A;  3GYO A;  2LG1 A;  2Z0Q A;  3FM8 C;  3QIJ A;  3LJU X;  3RCP A;  4MY6 A;  1SGH A;  2UZR A;  1QQG A;  1X11 A;  2ZPY A;  1FOE A;  2RNR B;  2J0J A;  1M7R A;  2Y8G A;  2COF A;  2DTC A;  2KGX B;  1H4R A;  1U2B A;  2Q13 A;  3AJ4 A;  4A6F A;  1GG3 A;  2RUK B;  4NY0 A;  2DLW A;  4GZU A;  5LOP B;  3FEH A;  3SYX A;  3U8Z A;  4ZRI A;  2D9V A;  1AQC A;  1DRO A;  2IFS A;  4CHM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...