3F0WA

Human numb-like protein, phosphotyrosine interaction domain
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
155
structure length
153
Chain Sequence
DLGTENLYFQSMASRPHQWQADEDAVRKGTCSFPVRYLGHVEVEESRGMHVCEDAVKKLKAMGSVKSVLWVSADGLRVVDDKTKDLLVDQTIEKVSFCAPDRNLDKAFSYICRDGTTRRWICHCFLALKDSGERLSHAVGCAFAACLERKQRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Human NUMB-like protein, phosphotyrosine interaction domain
rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Numb-like protein
total genus 39
structure length 153
sequence length 155
ec nomenclature
pdb deposition date 2008-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00640 PID Phosphotyrosine interaction domain (PTB/PID)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3f0wA00
1FOEA 2D2QA 3BJIA 4HAUB 2J59M 2I1KA 3D8DA 3DXDA 2UZSA 1DDVA 3KY9A 2LOZA 3X23A 1J19A 2VKIA 1X1FA 5GOWB 2YS5A 5DH9B 2RUKB 1V5PA 4KHAA 3M1IB 3AJ4A 5D3VA 4B6HA 1OY2A 3MDBC 2J0JA 3TVVA 1BTKA 2VRWB 3TFMA 4GMVA 4WVFB 3O96A 4GMXB 3KZ1A 2HTHB 4CHMA 2COAA 1DDMA 2M14A 5DI9B 5C6RA 4A6FB 3FM8C 2J0MA 3PEGA 3PG7A 3F0WA 3HW2B 2D9WA 2ADZA 2YSZA 2VSZA 3CIKA 1QC6A 4WSFA 4K2PA 2Y7BA 1E5WA 2LG1A 2DYNA 4HDQA 2D9XA 4DX8A 1MK7B 1DBHA 4K17A 4CHJA 2MFQA 2EC1A 5L81A 1PLSA 1N3HA 5LOPB 2DLWA 2NZ8B 2UVMA 3DXEA 1V61A 2FJLA 3FSSA 4DBBA 1X05A 2YS1A 2OQBA 1NTVA 5J3YA 1DDWA 2I1JA 3IVFA 5HE0A 3U7DA 2MDXA 3KSYA 5D3WA 5CLQB 4KVGB 1X86A 1EAZA 3AU5A 3ULCA 3PSCA 2DHKA 2CRFA 1ZC4B 4EJNA 3PP2A 1XX0A 2COCA 2IFSA 5KQ1A 3PZDA 2JP2A 2NMBA 2Z0OA 3D8EA 2L1CA 3D8FA 5KQ4A 2CY4A 2Z0QA 1BTNA 3WA0A 4IOYX 1RRPB 2DKPA 2KGXB 3HK0A 1U2BA 3UZTA 4KHBB 1MAIA 1KI1B 2EMSA 4GPTB 2H7DA 3KRXA 2COFA 3FEHA 1H10A 1RJ2A 3TO1A 3PVLA 4HB2B 3ODWA 1LB1A 2AL6A 1ZSQA 5D3YA 1SGHA 3ML4A 3A8PA 2CODA 3T06A 4HHVA 4MT7A 3PVWA 2R0DA 3SO6A 4NSWA 2GCLA 1BWNA 2D4QA 3TCAA 2E2XA 3AU4A 1MIXA 1NTYA 2KUPA 5HE2A 4MK0A 1EF1A 2IYBA 3OANA 3V5WA 1U5EA 3ODOA 3P6AA 1M7EA 1FAOA 1Y19B 2H7EA 1J0WA 1SHCA 4HAVB 2DHJA 1NI2A 1M7RA 2P0HA 1H4RA 2DTCA 1W1DA 3GYOA 1AWEA 3CXBB 5JHHA 4HAYB 3ZDTA 1XCGA 4H8SA 1UNPA 5DHFB 1KZ7A 2DA0A 2BCJA 1MK9B 5C16A 2EMTA 1UPRA 2CY5A 3LJUX 1PFJA 2GS0A 2QKLA 4HB0B 2RVBB 1UNRA 3ULBA 3SNHA 2RNRB 4GN1A 4BBKA 2UZRA 2ROVA 3QBVB 4IAPA 5D3XA 1EGXA 5C5BB 3ZVRA 3VOQA 2QKMA 2RGNB 4TKNA 1ZM0A 2D9ZA 2HE7A 3WYFB 2W2XD 2GJYA 1ISNA 2Y8FA 4YL8A 1FHWA 1Q67A 1LW3A 5DIFB 5FI1A 4MY6A 2YVCA 2ROZB 2DHIA 2W2WA 4YONA 1UNQA 2PZ1A 1U5GA 2P8VA 2CAYA 2N0YA 4HAWB 2DX5A 1MKEA 1BAKA 4Y94A 1UPQA 1WG7A 2D10A 3SUZA 5EFXA 4GZUA 3QWMA 3SV1A 3U8ZA 1WI1A 4A5KA 3RCPA 2AEHA 2RSGA 1P5TA 3MPXA 1KZGA 1WGQA 3ODXA 1V5MA 5J3QA 4Z2NA 2YF0A 4HB4B 4F7GA 1WVHA 4KAXB 5JLJB 1V89A 3BINA 5HE3A 4Z2MB 1XD4A 2KCJA 1ZVRA 2MKRA 3PVUA 2G35A 2RLOA 4A6KA 1V5UA 2D9VA 1IRSA 2DYQA 5JP4A 2ELAA 1OMWA 1WJ1A 1DROA 2Y8GA 1TJ6A 1FGYA 1FHXA 4TYZA 2P0FA 4PQ0A 1EVHA 1XR0B 4DXAB 3KRWA 5KCVA 5LONB 4KHOA 5JHGA 2K00A 3GYPA 2R09A 4IFSA 2LULA 2LYDA 2K2UA 1DYNA 2M38A 3A98B 4EMOA 2LKOA 2XQNM 4XWXA 1FGZA 3A8QA 1I2HA 1K5DB 1TQZA 5HE1A 4A6HA 2YS3A 4EKUA 1FHOA 1MPHA 4HATB 1NU2A 1W1GA 1Y5OA 2YT0A 3VIAA 1GC6A 3P7ZA 3HQCA 2EJ8A 3N7CA 2D11A 3F5RA 2J0KA 2DFKA 4K2OA 1XKEA 4ZRKA 4HDOA 1WGUA 1ZC3B 2ZPYA 2LOXA 1X11A 4K81A 2K2JA 1I7AA 1P3RA 1W1HA 4D0NB 1P6SA 1U27A 1PMSA 2W2XC 1UEFA 4ZRJA 1Z87A 2OTXA 1QQGA 2V76A 4WJ7A 4L6EA 1FB8A 5FI0A 1U29A 2DX1A 2YRYA 1XODA 4GXBA 2D9YA 1OQNA 4DX90 4HAXB 2I5CA 3DXCA 4F7HA 4A6FA 4NY0A 2Q13A 2MWNB 4P7IA 5C5BA 1MIZB 1WJMA 1K5GB 5CLLB 2DN6A 1GC7A 5DHAB 2Z0PA 5D27A 4C0AA 4ZRIA 1X1GA 1TXDA 3G9WA 4HB3B 4HAZB 2L2IA 2ELBA 3QIJA 2GCJA 5C79A 2I5FA 2YT1A 4F7UP 1U5DA 1V88A 5J3TA 1AQCA 2N23A 1U5FA 3TW1A 1B55A 1GG3A 4CYEA 2P0DA 2X18A 2DKQA 3SYXA 4PNKA 3NSUA
chains in the Genus database with same CATH superfamily
1FOEA 2D2QA 3BJIA 3DCXA 4HAUB 2J59M 2I1KA 3D8DA 4DIXA 3DXDA 2UZSA 1DDVA 3KY9A 2LOZA 4QJ5B 2Z4DA 3X23A 1J19A 2VKIA 1X1FA 5GOWB 2YS5A 5DH9B 2RUKB 1V5PA 4KHAA 3NW8A 3M1IB 3AJ4A 5D3VA 4B6HA 1OY2A 3MDBC 2J0JA 3TVVA 1BTKA 4L1RA 2Z13A 2VRWB 3TFMA 4GMVA 4WVFB 3O96A 4GMXB 3KZ1A 2HTHB 4CHMA 2COAA 1DDMA 4QXAB 2M14A 5DI9B 5C6RA 4A6FB 3FM8C 2J0MA 3B77A 3PEGA 3PG7A 3F0WA 5I2SA 3HW2B 2D9WA 2ADZA 4OSNA 2YSZA 2VSZA 3CIKA 1QC6A 2Z14A 4WSFA 4K2PA 2Y7BA 1E5WA 2YT2A 5I2MA 2LG1A 2DYNA 2K8EA 4HDQA 2D9XA 4DX8A 1MK7B 1DBHA 4K17A 4CHJA 3U12A 2MFQA 2EC1A 5L81A 1PLSA 1N3HA 5LOPB 2DLWA 2NZ8B 2UVMA 3DXEA 1V61A 2FJLA 3FSSA 5IRSA 4DBBA 1X05A 2YS1A 2OQBA 1NTVA 5J3YA 1DDWA 2I1JA 3IVFA 5HE0A 4QJ4B 3U7DA 2MDXA 3KSYA 5D3WA 5CLQB 4KVGB 1X86A 1EAZA 3AU5A 3ULCA 3PSCA 2DHKA 2CRFA 5LG4B 1ZC4B 4EJNA 3PP2A 1XX0A 2COCA 2IFSA 5KQ1A 3PZDA 2JP2A 2NMBA 2Z0OA 3D8EA 2L1CA 3D8FA 5KQ4A 2CY4A 2Z0QA 1BTNA 3WA0A 4IOYX 1RRPB 2DKPA 2KGXB 2KUQA 3HK0A 1U2BA 3UZTA 4KHBB 1MAIA 3HIEA 1KI1B 2EMSA 4GPTB 2H7DA 3KRXA 2KR0A 2COFA 3FEHA 1H10A 1RJ2A 3TO1A 3PVLA 4HB2B 2NBVA 3ODWA 2ZKMX 1LB1A 2AL6A 3NWAA 1ZSQA 5D3YA 1SGHA 3ML4A 3A8PA 2CODA 2Z59A 3T06A 4HHVA 4MT7A 3PVWA 2R0DA 3SO6A 2K49A 4NSWA 2GCLA 1BWNA 2D4QA 3TCAA 2FJUB 2E2XA 3AU4A 1MIXA 1NTYA 2KUPA 5HE2A 4MK0A 1EF1A 2IYBA 3OANA 3V5WA 1U5EA 3ODOA 3P6AA 1M7EA 1FAOA 1Y19B 2H7EA 1J0WA 1MI1A 1SHCA 4HAVB 2DHJA 1NI2A 1M7RA 2P0HA 1H4RA 2DTCA 1W1DA 3GYOA 1AWEA 3CXBB 5JHHA 4HAYB 3ZDTA 1XCGA 4H8SA 1UNPA 5DHFB 1KZ7A 2DA0A 2BCJA 4GOUA 1MK9B 5C16A 2EMTA 1UPRA 2CY5A 3LJUX 1PFJA 2GS0A 2QKLA 4HB0B 2RVBB 1UNRA 3ULBA 3SNHA 2RNRB 4GN1A 4BBKA 2UZRA 2ROVA 3QBVB 4IAPA 5D3XA 4KHBA 3NWFA 5C5BB 1EGXA 3ZVRA 3VOQA 2QKMA 2RGNB 4TKNA 1ZM0A 2D9ZA 2HE7A 3WYFB 2W2XD 2GJYA 1ISNA 2Y8FA 4YL8A 1FHWA 1Q67A 1LW3A 5DIFB 5FI1A 4MY6A 2YVCA 2ROZB 2DHIA 2W2WA 4YONA 1UNQA 2PZ1A 1U5GA 2P8VA 2CAYA 2N0YA 3A58A 4HAWB 2DX5A 1MKEA 1BAKA 4Y94A 1UPQA 1WG7A 3NWDA 2D10A 3SUZA 5EFXA 4GZUA 3QWMA 3SV1A 3U8ZA 1WI1A 4A5KA 3RCPA 1T77A 2AEHA 4OT1A 2RSGA 1P5TA 3MPXA 1KZGA 1WGQA 3ODXA 1V5MA 5J3QA 4Z2NA 2YF0A 4HB4B 4F7GA 1WVHA 4KAXB 5JLJB 1V89A 3BINA 5HE3A 4Z2MB 1XD4A 2KCJA 1ZVRA 2MKRA 3PVUA 2G35A 2RLOA 4A6KA 1V5UA 2D9VA 1IRSA 2DYQA 5JP4A 2GUMA 2ELAA 1OMWA 1WJ1A 1DROA 2Y8GA 1TJ6A 1FGYA 1FHXA 4TYZA 2P0FA 4PQ0A 1EVHA 1XR0B 4DXAB 3KRWA 5KCVA 5LONB 4KHOA 5JHGA 2K00A 2R2YA 3GYPA 2R09A 4IFSA 2LULA 2LYDA 2K2UA 1DYNA 2M38A 3A98B 4EMOA 2LKOA 2XQNM 4XWXA 1FGZA 3A8QA 1I2HA 1K5DB 1TQZA 5HE1A 4A6HA 2YS3A 4EKUA 1FHOA 1MPHA 4HATB 1NU2A 1W1GA 1Y5OA 2YT0A 3VIAA 1GC6A 2RRFA 3P7ZA 3HQCA 2EJ8A 3N7CA 2D11A 3F5RA 2J0KA 2DFKA 4K2OA 1XKEA 1ZYIA 4ZRKA 4HDOA 1WGUA 1ZC3B 2ZPYA 2LOXA 1X11A 4K81A 2KIEA 2K2JA 1I7AA 1P3RA 1W1HA 4D0NB 1P6SA 1U27A 1PMSA 2W2XC 1UEFA 4D6WA 5M4YB 4ZRJA 3FVCA 1Z87A 2KIGA 2OTXA 1QQGA 2V76A 4WJ7A 4L6EA 1FB8A 4CSQA 5FI0A 1U29A 2DX1A 2YRYA 1XODA 4GXBA 2D9YA 1OQNA 4DX90 4HAXB 2I5CA 3DXCA 4F7HA 4A6FA 4NY0A 2Q13A 2MWNB 4P7IA 5C5BA 3OHMB 1MIZB 1WJMA 4HSIA 1K5GB 5CLLB 2DN6A 1GC7A 5DHAB 2Z0PA 5D27A 4GNKB 4C0AA 4ZRIA 1X1GA 3HSAA 1TXDA 3G9WA 4HB3B 4HAZB 2L2IA 2ELBA 3QIJA 2GCJA 4QJ3B 5C79A 2I5FA 2YT1A 4F7UP 1U5DA 1V88A 5J3TA 1AQCA 2N23A 1U5FA 3TW1A 1B55A 1GG3A 4CYEA 2P0DA 2X18A 2DKQA 3SYXA 4PNKA 3NSUA
chains in the Genus database with same CATH topology
1FOEA 2D2QA 3BJIA 4HAUB 2J59M 2I1KA 3D8DA 3DXDA 2UZSA 1DDVA 3KY9A 2LOZA 3X23A 1J19A 2VKIA 1X1FA 5GOWB 2YS5A 5DH9B 2RUKB 1V5PA 4KHAA 3M1IB 3AJ4A 5D3VA 4B6HA 1OY2A 3MDBC 2J0JA 3TVVA 1BTKA 2VRWB 3TFMA 4GMVA 4WVFB 3O96A 4GMXB 3KZ1A 2HTHB 4CHMA 2COAA 1DDMA 2M14A 5DI9B 5C6RA 4A6FB 3FM8C 2J0MA 3PEGA 3PG7A 3F0WA 3HW2B 2D9WA 2ADZA 2YSZA 2VSZA 3CIKA 1QC6A 4WSFA 4K2PA 2Y7BA 1E5WA 2LG1A 2DYNA 4HDQA 2D9XA 4DX8A 1MK7B 1DBHA 4K17A 4CHJA 2MFQA 2EC1A 5L81A 1PLSA 1N3HA 5LOPB 2DLWA 2NZ8B 2UVMA 3DXEA 1V61A 2FJLA 3FSSA 4DBBA 1X05A 2YS1A 2OQBA 1NTVA 5J3YA 1DDWA 2I1JA 3IVFA 5HE0A 3U7DA 2MDXA 3KSYA 5D3WA 5CLQB 4KVGB 1X86A 1EAZA 3AU5A 3ULCA 3PSCA 2DHKA 2CRFA 1ZC4B 4EJNA 3PP2A 1XX0A 2COCA 2IFSA 5KQ1A 3PZDA 2JP2A 2NMBA 2Z0OA 3D8EA 2L1CA 3D8FA 5KQ4A 2CY4A 2Z0QA 1BTNA 3WA0A 4IOYX 1RRPB 2DKPA 2KGXB 3HK0A 1U2BA 3UZTA 4KHBB 1MAIA 1KI1B 2EMSA 4GPTB 2H7DA 3KRXA 2COFA 3FEHA 1H10A 1RJ2A 3TO1A 3PVLA 4HB2B 3ODWA 1LB1A 2AL6A 1ZSQA 5D3YA 1SGHA 3ML4A 3A8PA 2CODA 3T06A 4HHVA 4MT7A 3PVWA 2R0DA 3SO6A 4NSWA 2GCLA 1BWNA 2D4QA 3TCAA 2E2XA 3AU4A 1MIXA 1NTYA 2KUPA 5HE2A 4MK0A 1EF1A 2IYBA 3OANA 3V5WA 1U5EA 3ODOA 3P6AA 1M7EA 1FAOA 1Y19B 2H7EA 1J0WA 1SHCA 4HAVB 2DHJA 1NI2A 1M7RA 2P0HA 1H4RA 2DTCA 1W1DA 3GYOA 1AWEA 3CXBB 5JHHA 4HAYB 3ZDTA 1XCGA 4H8SA 1UNPA 5DHFB 1KZ7A 2DA0A 2BCJA 1MK9B 5C16A 2EMTA 1UPRA 2CY5A 3LJUX 1PFJA 2GS0A 2QKLA 4HB0B 2RVBB 1UNRA 3ULBA 3SNHA 2RNRB 4GN1A 4BBKA 2UZRA 2ROVA 3QBVB 4IAPA 5D3XA 1EGXA 5C5BB 3ZVRA 3VOQA 2QKMA 2RGNB 4TKNA 1ZM0A 2D9ZA 2HE7A 3WYFB 2W2XD 2GJYA 1ISNA 2Y8FA 4YL8A 1FHWA 1Q67A 1LW3A 5DIFB 5FI1A 4MY6A 2YVCA 2ROZB 2DHIA 2W2WA 4YONA 1UNQA 2PZ1A 1U5GA 2P8VA 2CAYA 2N0YA 4HAWB 2DX5A 1MKEA 1BAKA 4Y94A 1UPQA 1WG7A 2D10A 3SUZA 5EFXA 4GZUA 3QWMA 3SV1A 3U8ZA 1WI1A 4A5KA 3RCPA 2AEHA 2RSGA 1P5TA 3MPXA 1KZGA 1WGQA 3ODXA 1V5MA 5J3QA 4Z2NA 2YF0A 4HB4B 4F7GA 1WVHA 4KAXB 5JLJB 1V89A 3BINA 5HE3A 4Z2MB 1XD4A 2KCJA 1ZVRA 2MKRA 3PVUA 2G35A 2RLOA 4A6KA 1V5UA 2D9VA 1IRSA 2DYQA 5JP4A 2ELAA 1OMWA 1WJ1A 1DROA 2Y8GA 1TJ6A 1FGYA 1FHXA 4TYZA 2P0FA 4PQ0A 1EVHA 1XR0B 4DXAB 3KRWA 5KCVA 5LONB 4KHOA 5JHGA 2K00A 3GYPA 2R09A 4IFSA 2LULA 2LYDA 2K2UA 1DYNA 2M38A 3A98B 4EMOA 2LKOA 2XQNM 4XWXA 1FGZA 3A8QA 1I2HA 1K5DB 1TQZA 5HE1A 4A6HA 2YS3A 4EKUA 1FHOA 1MPHA 4HATB 1NU2A 1W1GA 1Y5OA 2YT0A 3VIAA 1GC6A 3P7ZA 3HQCA 2EJ8A 3N7CA 2D11A 3F5RA 2J0KA 2DFKA 4K2OA 1XKEA 4ZRKA 4HDOA 1WGUA 1ZC3B 2ZPYA 2LOXA 1X11A 4K81A 2K2JA 1I7AA 1P3RA 1W1HA 4D0NB 1P6SA 1U27A 1PMSA 2W2XC 1UEFA 4ZRJA 1Z87A 2OTXA 1QQGA 2V76A 4WJ7A 4L6EA 1FB8A 5FI0A 1U29A 2DX1A 2YRYA 1XODA 4GXBA 2D9YA 1OQNA 4DX90 4HAXB 2I5CA 3DXCA 4F7HA 4A6FA 4NY0A 2Q13A 2MWNB 4P7IA 5C5BA 1MIZB 1WJMA 1K5GB 5CLLB 2DN6A 1GC7A 5DHAB 2Z0PA 5D27A 4C0AA 4ZRIA 1X1GA 1TXDA 3G9WA 4HB3B 4HAZB 2L2IA 2ELBA 3QIJA 2GCJA 5C79A 2I5FA 2YT1A 4F7UP 1U5DA 1V88A 5J3TA 1AQCA 2N23A 1U5FA 3TW1A 1B55A 1GG3A 4CYEA 2P0DA 2X18A 2DKQA 3SYXA 4PNKA 3NSUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FOE A;  2D2Q A;  3BJI A;  4HAU B;  2J59 M;  2I1K A;  3D8D A;  3DXD A;  2UZS A;  1DDV A;  3KY9 A;  2LOZ A;  3X23 A;  1J19 A;  2VKI A;  1X1F A;  5GOW B;  2YS5 A;  5DH9 B;  2RUK B;  1V5P A;  4KHA A;  3M1I B;  3AJ4 A;  5D3V A;  4B6H A;  1OY2 A;  3MDB C;  2J0J A;  3TVV A;  1BTK A;  2VRW B;  3TFM A;  4GMV A;  4WVF B;  3O96 A;  4GMX B;  3KZ1 A;  2HTH B;  4CHM A;  2COA A;  1DDM A;  2M14 A;  5DI9 B;  5C6R A;  4A6F B;  3FM8 C;  2J0M A;  3PEG A;  3PG7 A;  3F0W A;  3HW2 B;  2D9W A;  2ADZ A;  2YSZ A;  2VSZ A;  3CIK A;  1QC6 A;  4WSF A;  4K2P A;  2Y7B A;  1E5W A;  2LG1 A;  2DYN A;  4HDQ A;  2D9X A;  4DX8 A;  1MK7 B;  1DBH A;  4K17 A;  4CHJ A;  2MFQ A;  2EC1 A;  5L81 A;  1PLS A;  1N3H A;  5LOP B;  2DLW A;  2NZ8 B;  2UVM A;  3DXE A;  1V61 A;  2FJL A;  3FSS A;  4DBB A;  1X05 A;  2YS1 A;  2OQB A;  1NTV A;  5J3Y A;  1DDW A;  2I1J A;  3IVF A;  5HE0 A;  3U7D A;  2MDX A;  3KSY A;  5D3W A;  5CLQ B;  4KVG B;  1X86 A;  1EAZ A;  3AU5 A;  3ULC A;  3PSC A;  2DHK A;  2CRF A;  1ZC4 B;  4EJN A;  3PP2 A;  1XX0 A;  2COC A;  2IFS A;  5KQ1 A;  3PZD A;  2JP2 A;  2NMB A;  2Z0O A;  3D8E A;  2L1C A;  3D8F A;  5KQ4 A;  2CY4 A;  2Z0Q A;  1BTN A;  3WA0 A;  4IOY X;  1RRP B;  2DKP A;  2KGX B;  3HK0 A;  1U2B A;  3UZT A;  4KHB B;  1MAI A;  1KI1 B;  2EMS A;  4GPT B;  2H7D A;  3KRX A;  2COF A;  3FEH A;  1H10 A;  1RJ2 A;  3TO1 A;  3PVL A;  4HB2 B;  3ODW A;  1LB1 A;  2AL6 A;  1ZSQ A;  5D3Y A;  1SGH A;  3ML4 A;  3A8P A;  2COD A;  3T06 A;  4HHV A;  4MT7 A;  3PVW A;  2R0D A;  3SO6 A;  4NSW A;  2GCL A;  1BWN A;  2D4Q A;  3TCA A;  2E2X A;  3AU4 A;  1MIX A;  1NTY A;  2KUP A;  5HE2 A;  4MK0 A;  1EF1 A;  2IYB A;  3OAN A;  3V5W A;  1U5E A;  3ODO A;  3P6A A;  1M7E A;  1FAO A;  1Y19 B;  2H7E A;  1J0W A;  1SHC A;  4HAV B;  2DHJ A;  1NI2 A;  1M7R A;  2P0H A;  1H4R A;  2DTC A;  1W1D A;  3GYO A;  1AWE A;  3CXB B;  5JHH A;  4HAY B;  3ZDT A;  1XCG A;  4H8S A;  1UNP A;  5DHF B;  1KZ7 A;  2DA0 A;  2BCJ A;  1MK9 B;  5C16 A;  2EMT A;  1UPR A;  2CY5 A;  3LJU X;  1PFJ A;  2GS0 A;  2QKL A;  4HB0 B;  2RVB B;  1UNR A;  3ULB A;  3SNH A;  2RNR B;  4GN1 A;  4BBK A;  2UZR A;  2ROV A;  3QBV B;  4IAP A;  5D3X A;  1EGX A;  5C5B B;  3ZVR A;  3VOQ A;  2QKM A;  2RGN B;  4TKN A;  1ZM0 A;  2D9Z A;  2HE7 A;  3WYF B;  2W2X D;  2GJY A;  1ISN A;  2Y8F A;  4YL8 A;  1FHW A;  1Q67 A;  1LW3 A;  5DIF B;  5FI1 A;  4MY6 A;  2YVC A;  2ROZ B;  2DHI A;  2W2W A;  4YON A;  1UNQ A;  2PZ1 A;  1U5G A;  2P8V A;  2CAY A;  2N0Y A;  4HAW B;  2DX5 A;  1MKE A;  1BAK A;  4Y94 A;  1UPQ A;  1WG7 A;  2D10 A;  3SUZ A;  5EFX A;  4GZU A;  3QWM A;  3SV1 A;  3U8Z A;  1WI1 A;  4A5K A;  3RCP A;  2AEH A;  2RSG A;  1P5T A;  3MPX A;  1KZG A;  1WGQ A;  3ODX A;  1V5M A;  5J3Q A;  4Z2N A;  2YF0 A;  4HB4 B;  4F7G A;  1WVH A;  4KAX B;  5JLJ B;  1V89 A;  3BIN A;  5HE3 A;  4Z2M B;  1XD4 A;  2KCJ A;  1ZVR A;  2MKR A;  3PVU A;  2G35 A;  2RLO A;  4A6K A;  1V5U A;  2D9V A;  1IRS A;  2DYQ A;  5JP4 A;  2ELA A;  1OMW A;  1WJ1 A;  1DRO A;  2Y8G A;  1TJ6 A;  1FGY A;  1FHX A;  4TYZ A;  2P0F A;  4PQ0 A;  1EVH A;  1XR0 B;  4DXA B;  3KRW A;  5KCV A;  5LON B;  4KHO A;  5JHG A;  2K00 A;  3GYP A;  2R09 A;  4IFS A;  2LUL A;  2LYD A;  2K2U A;  1DYN A;  2M38 A;  3A98 B;  4EMO A;  2LKO A;  2XQN M;  4XWX A;  1FGZ A;  3A8Q A;  1I2H A;  1K5D B;  1TQZ A;  5HE1 A;  4A6H A;  2YS3 A;  4EKU A;  1FHO A;  1MPH A;  4HAT B;  1NU2 A;  1W1G A;  1Y5O A;  2YT0 A;  3VIA A;  1GC6 A;  3P7Z A;  3HQC A;  2EJ8 A;  3N7C A;  2D11 A;  3F5R A;  2J0K A;  2DFK A;  4K2O A;  1XKE A;  4ZRK A;  4HDO A;  1WGU A;  1ZC3 B;  2ZPY A;  2LOX A;  1X11 A;  4K81 A;  2K2J A;  1I7A A;  1P3R A;  1W1H A;  4D0N B;  1P6S A;  1U27 A;  1PMS A;  2W2X C;  1UEF A;  4ZRJ A;  1Z87 A;  2OTX A;  1QQG A;  2V76 A;  4WJ7 A;  4L6E A;  1FB8 A;  5FI0 A;  1U29 A;  2DX1 A;  2YRY A;  1XOD A;  4GXB A;  2D9Y A;  1OQN A;  4DX9 0;  4HAX B;  2I5C A;  3DXC A;  4F7H A;  4A6F A;  4NY0 A;  2Q13 A;  2MWN B;  4P7I A;  5C5B A;  1MIZ B;  1WJM A;  1K5G B;  5CLL B;  2DN6 A;  1GC7 A;  5DHA B;  2Z0P A;  5D27 A;  4C0A A;  4ZRI A;  1X1G A;  1TXD A;  3G9W A;  4HB3 B;  4HAZ B;  2L2I A;  2ELB A;  3QIJ A;  2GCJ A;  5C79 A;  2I5F A;  2YT1 A;  4F7U P;  1U5D A;  1V88 A;  5J3T A;  1AQC A;  2N23 A;  1U5F A;  3TW1 A;  1B55 A;  1GG3 A;  4CYE A;  2P0D A;  2X18 A;  2DKQ A;  3SYX A;  4PNK A;  3NSU A; 
#chains in the Genus database with same CATH topology
 1FOE A;  2D2Q A;  3BJI A;  3DCX A;  4HAU B;  2J59 M;  2I1K A;  3D8D A;  4DIX A;  3DXD A;  2UZS A;  1DDV A;  3KY9 A;  2LOZ A;  4QJ5 B;  2Z4D A;  3X23 A;  1J19 A;  2VKI A;  1X1F A;  5GOW B;  2YS5 A;  5DH9 B;  2RUK B;  1V5P A;  4KHA A;  3NW8 A;  3M1I B;  3AJ4 A;  5D3V A;  4B6H A;  1OY2 A;  3MDB C;  2J0J A;  3TVV A;  1BTK A;  4L1R A;  2Z13 A;  2VRW B;  3TFM A;  4GMV A;  4WVF B;  3O96 A;  4GMX B;  3KZ1 A;  2HTH B;  4CHM A;  2COA A;  1DDM A;  4QXA B;  2M14 A;  5DI9 B;  5C6R A;  4A6F B;  3FM8 C;  2J0M A;  3B77 A;  3PEG A;  3PG7 A;  3F0W A;  5I2S A;  3HW2 B;  2D9W A;  2ADZ A;  4OSN A;  2YSZ A;  2VSZ A;  3CIK A;  1QC6 A;  2Z14 A;  4WSF A;  4K2P A;  2Y7B A;  1E5W A;  2YT2 A;  5I2M A;  2LG1 A;  2DYN A;  2K8E A;  4HDQ A;  2D9X A;  4DX8 A;  1MK7 B;  1DBH A;  4K17 A;  4CHJ A;  3U12 A;  2MFQ A;  2EC1 A;  5L81 A;  1PLS A;  1N3H A;  5LOP B;  2DLW A;  2NZ8 B;  2UVM A;  3DXE A;  1V61 A;  2FJL A;  3FSS A;  5IRS A;  4DBB A;  1X05 A;  2YS1 A;  2OQB A;  1NTV A;  5J3Y A;  1DDW A;  2I1J A;  3IVF A;  5HE0 A;  4QJ4 B;  3U7D A;  2MDX A;  3KSY A;  5D3W A;  5CLQ B;  4KVG B;  1X86 A;  1EAZ A;  3AU5 A;  3ULC A;  3PSC A;  2DHK A;  2CRF A;  5LG4 B;  1ZC4 B;  4EJN A;  3PP2 A;  1XX0 A;  2COC A;  2IFS A;  5KQ1 A;  3PZD A;  2JP2 A;  2NMB A;  2Z0O A;  3D8E A;  2L1C A;  3D8F A;  5KQ4 A;  2CY4 A;  2Z0Q A;  1BTN A;  3WA0 A;  4IOY X;  1RRP B;  2DKP A;  2KGX B;  2KUQ A;  3HK0 A;  1U2B A;  3UZT A;  4KHB B;  1MAI A;  3HIE A;  1KI1 B;  2EMS A;  4GPT B;  2H7D A;  3KRX A;  2KR0 A;  2COF A;  3FEH A;  1H10 A;  1RJ2 A;  3TO1 A;  3PVL A;  4HB2 B;  2NBV A;  3ODW A;  2ZKM X;  1LB1 A;  2AL6 A;  3NWA A;  1ZSQ A;  5D3Y A;  1SGH A;  3ML4 A;  3A8P A;  2COD A;  2Z59 A;  3T06 A;  4HHV A;  4MT7 A;  3PVW A;  2R0D A;  3SO6 A;  2K49 A;  4NSW A;  2GCL A;  1BWN A;  2D4Q A;  3TCA A;  2FJU B;  2E2X A;  3AU4 A;  1MIX A;  1NTY A;  2KUP A;  5HE2 A;  4MK0 A;  1EF1 A;  2IYB A;  3OAN A;  3V5W A;  1U5E A;  3ODO A;  3P6A A;  1M7E A;  1FAO A;  1Y19 B;  2H7E A;  1J0W A;  1MI1 A;  1SHC A;  4HAV B;  2DHJ A;  1NI2 A;  1M7R A;  2P0H A;  1H4R A;  2DTC A;  1W1D A;  3GYO A;  1AWE A;  3CXB B;  5JHH A;  4HAY B;  3ZDT A;  1XCG A;  4H8S A;  1UNP A;  5DHF B;  1KZ7 A;  2DA0 A;  2BCJ A;  4GOU A;  1MK9 B;  5C16 A;  2EMT A;  1UPR A;  2CY5 A;  3LJU X;  1PFJ A;  2GS0 A;  2QKL A;  4HB0 B;  2RVB B;  1UNR A;  3ULB A;  3SNH A;  2RNR B;  4GN1 A;  4BBK A;  2UZR A;  2ROV A;  3QBV B;  4IAP A;  5D3X A;  4KHB A;  3NWF A;  5C5B B;  1EGX A;  3ZVR A;  3VOQ A;  2QKM A;  2RGN B;  4TKN A;  1ZM0 A;  2D9Z A;  2HE7 A;  3WYF B;  2W2X D;  2GJY A;  1ISN A;  2Y8F A;  4YL8 A;  1FHW A;  1Q67 A;  1LW3 A;  5DIF B;  5FI1 A;  4MY6 A;  2YVC A;  2ROZ B;  2DHI A;  2W2W A;  4YON A;  1UNQ A;  2PZ1 A;  1U5G A;  2P8V A;  2CAY A;  2N0Y A;  3A58 A;  4HAW B;  2DX5 A;  1MKE A;  1BAK A;  4Y94 A;  1UPQ A;  1WG7 A;  3NWD A;  2D10 A;  3SUZ A;  5EFX A;  4GZU A;  3QWM A;  3SV1 A;  3U8Z A;  1WI1 A;  4A5K A;  3RCP A;  1T77 A;  2AEH A;  4OT1 A;  2RSG A;  1P5T A;  3MPX A;  1KZG A;  1WGQ A;  3ODX A;  1V5M A;  5J3Q A;  4Z2N A;  2YF0 A;  4HB4 B;  4F7G A;  1WVH A;  4KAX B;  5JLJ B;  1V89 A;  3BIN A;  5HE3 A;  4Z2M B;  1XD4 A;  2KCJ A;  1ZVR A;  2MKR A;  3PVU A;  2G35 A;  2RLO A;  4A6K A;  1V5U A;  2D9V A;  1IRS A;  2DYQ A;  5JP4 A;  2GUM A;  2ELA A;  1OMW A;  1WJ1 A;  1DRO A;  2Y8G A;  1TJ6 A;  1FGY A;  1FHX A;  4TYZ A;  2P0F A;  4PQ0 A;  1EVH A;  1XR0 B;  4DXA B;  3KRW A;  5KCV A;  5LON B;  4KHO A;  5JHG A;  2K00 A;  2R2Y A;  3GYP A;  2R09 A;  4IFS A;  2LUL A;  2LYD A;  2K2U A;  1DYN A;  2M38 A;  3A98 B;  4EMO A;  2LKO A;  2XQN M;  4XWX A;  1FGZ A;  3A8Q A;  1I2H A;  1K5D B;  1TQZ A;  5HE1 A;  4A6H A;  2YS3 A;  4EKU A;  1FHO A;  1MPH A;  4HAT B;  1NU2 A;  1W1G A;  1Y5O A;  2YT0 A;  3VIA A;  1GC6 A;  2RRF A;  3P7Z A;  3HQC A;  2EJ8 A;  3N7C A;  2D11 A;  3F5R A;  2J0K A;  2DFK A;  4K2O A;  1XKE A;  1ZYI A;  4ZRK A;  4HDO A;  1WGU A;  1ZC3 B;  2ZPY A;  2LOX A;  1X11 A;  4K81 A;  2KIE A;  2K2J A;  1I7A A;  1P3R A;  1W1H A;  4D0N B;  1P6S A;  1U27 A;  1PMS A;  2W2X C;  1UEF A;  4D6W A;  5M4Y B;  4ZRJ A;  3FVC A;  1Z87 A;  2KIG A;  2OTX A;  1QQG A;  2V76 A;  4WJ7 A;  4L6E A;  1FB8 A;  4CSQ A;  5FI0 A;  1U29 A;  2DX1 A;  2YRY A;  1XOD A;  4GXB A;  2D9Y A;  1OQN A;  4DX9 0;  4HAX B;  2I5C A;  3DXC A;  4F7H A;  4A6F A;  4NY0 A;  2Q13 A;  2MWN B;  4P7I A;  5C5B A;  3OHM B;  1MIZ B;  1WJM A;  4HSI A;  1K5G B;  5CLL B;  2DN6 A;  1GC7 A;  5DHA B;  2Z0P A;  5D27 A;  4GNK B;  4C0A A;  4ZRI A;  1X1G A;  3HSA A;  1TXD A;  3G9W A;  4HB3 B;  4HAZ B;  2L2I A;  2ELB A;  3QIJ A;  2GCJ A;  4QJ3 B;  5C79 A;  2I5F A;  2YT1 A;  4F7U P;  1U5D A;  1V88 A;  5J3T A;  1AQC A;  2N23 A;  1U5F A;  3TW1 A;  1B55 A;  1GG3 A;  4CYE A;  2P0D A;  2X18 A;  2DKQ A;  3SYX A;  4PNK A;  3NSU A; 
#chains in the Genus database with same CATH homology
 1FOE A;  2D2Q A;  3BJI A;  4HAU B;  2J59 M;  2I1K A;  3D8D A;  3DXD A;  2UZS A;  1DDV A;  3KY9 A;  2LOZ A;  3X23 A;  1J19 A;  2VKI A;  1X1F A;  5GOW B;  2YS5 A;  5DH9 B;  2RUK B;  1V5P A;  4KHA A;  3M1I B;  3AJ4 A;  5D3V A;  4B6H A;  1OY2 A;  3MDB C;  2J0J A;  3TVV A;  1BTK A;  2VRW B;  3TFM A;  4GMV A;  4WVF B;  3O96 A;  4GMX B;  3KZ1 A;  2HTH B;  4CHM A;  2COA A;  1DDM A;  2M14 A;  5DI9 B;  5C6R A;  4A6F B;  3FM8 C;  2J0M A;  3PEG A;  3PG7 A;  3F0W A;  3HW2 B;  2D9W A;  2ADZ A;  2YSZ A;  2VSZ A;  3CIK A;  1QC6 A;  4WSF A;  4K2P A;  2Y7B A;  1E5W A;  2LG1 A;  2DYN A;  4HDQ A;  2D9X A;  4DX8 A;  1MK7 B;  1DBH A;  4K17 A;  4CHJ A;  2MFQ A;  2EC1 A;  5L81 A;  1PLS A;  1N3H A;  5LOP B;  2DLW A;  2NZ8 B;  2UVM A;  3DXE A;  1V61 A;  2FJL A;  3FSS A;  4DBB A;  1X05 A;  2YS1 A;  2OQB A;  1NTV A;  5J3Y A;  1DDW A;  2I1J A;  3IVF A;  5HE0 A;  3U7D A;  2MDX A;  3KSY A;  5D3W A;  5CLQ B;  4KVG B;  1X86 A;  1EAZ A;  3AU5 A;  3ULC A;  3PSC A;  2DHK A;  2CRF A;  1ZC4 B;  4EJN A;  3PP2 A;  1XX0 A;  2COC A;  2IFS A;  5KQ1 A;  3PZD A;  2JP2 A;  2NMB A;  2Z0O A;  3D8E A;  2L1C A;  3D8F A;  5KQ4 A;  2CY4 A;  2Z0Q A;  1BTN A;  3WA0 A;  4IOY X;  1RRP B;  2DKP A;  2KGX B;  3HK0 A;  1U2B A;  3UZT A;  4KHB B;  1MAI A;  1KI1 B;  2EMS A;  4GPT B;  2H7D A;  3KRX A;  2COF A;  3FEH A;  1H10 A;  1RJ2 A;  3TO1 A;  3PVL A;  4HB2 B;  3ODW A;  1LB1 A;  2AL6 A;  1ZSQ A;  5D3Y A;  1SGH A;  3ML4 A;  3A8P A;  2COD A;  3T06 A;  4HHV A;  4MT7 A;  3PVW A;  2R0D A;  3SO6 A;  4NSW A;  2GCL A;  1BWN A;  2D4Q A;  3TCA A;  2E2X A;  3AU4 A;  1MIX A;  1NTY A;  2KUP A;  5HE2 A;  4MK0 A;  1EF1 A;  2IYB A;  3OAN A;  3V5W A;  1U5E A;  3ODO A;  3P6A A;  1M7E A;  1FAO A;  1Y19 B;  2H7E A;  1J0W A;  1SHC A;  4HAV B;  2DHJ A;  1NI2 A;  1M7R A;  2P0H A;  1H4R A;  2DTC A;  1W1D A;  3GYO A;  1AWE A;  3CXB B;  5JHH A;  4HAY B;  3ZDT A;  1XCG A;  4H8S A;  1UNP A;  5DHF B;  1KZ7 A;  2DA0 A;  2BCJ A;  1MK9 B;  5C16 A;  2EMT A;  1UPR A;  2CY5 A;  3LJU X;  1PFJ A;  2GS0 A;  2QKL A;  4HB0 B;  2RVB B;  1UNR A;  3ULB A;  3SNH A;  2RNR B;  4GN1 A;  4BBK A;  2UZR A;  2ROV A;  3QBV B;  4IAP A;  5D3X A;  1EGX A;  5C5B B;  3ZVR A;  3VOQ A;  2QKM A;  2RGN B;  4TKN A;  1ZM0 A;  2D9Z A;  2HE7 A;  3WYF B;  2W2X D;  2GJY A;  1ISN A;  2Y8F A;  4YL8 A;  1FHW A;  1Q67 A;  1LW3 A;  5DIF B;  5FI1 A;  4MY6 A;  2YVC A;  2ROZ B;  2DHI A;  2W2W A;  4YON A;  1UNQ A;  2PZ1 A;  1U5G A;  2P8V A;  2CAY A;  2N0Y A;  4HAW B;  2DX5 A;  1MKE A;  1BAK A;  4Y94 A;  1UPQ A;  1WG7 A;  2D10 A;  3SUZ A;  5EFX A;  4GZU A;  3QWM A;  3SV1 A;  3U8Z A;  1WI1 A;  4A5K A;  3RCP A;  2AEH A;  2RSG A;  1P5T A;  3MPX A;  1KZG A;  1WGQ A;  3ODX A;  1V5M A;  5J3Q A;  4Z2N A;  2YF0 A;  4HB4 B;  4F7G A;  1WVH A;  4KAX B;  5JLJ B;  1V89 A;  3BIN A;  5HE3 A;  4Z2M B;  1XD4 A;  2KCJ A;  1ZVR A;  2MKR A;  3PVU A;  2G35 A;  2RLO A;  4A6K A;  1V5U A;  2D9V A;  1IRS A;  2DYQ A;  5JP4 A;  2ELA A;  1OMW A;  1WJ1 A;  1DRO A;  2Y8G A;  1TJ6 A;  1FGY A;  1FHX A;  4TYZ A;  2P0F A;  4PQ0 A;  1EVH A;  1XR0 B;  4DXA B;  3KRW A;  5KCV A;  5LON B;  4KHO A;  5JHG A;  2K00 A;  3GYP A;  2R09 A;  4IFS A;  2LUL A;  2LYD A;  2K2U A;  1DYN A;  2M38 A;  3A98 B;  4EMO A;  2LKO A;  2XQN M;  4XWX A;  1FGZ A;  3A8Q A;  1I2H A;  1K5D B;  1TQZ A;  5HE1 A;  4A6H A;  2YS3 A;  4EKU A;  1FHO A;  1MPH A;  4HAT B;  1NU2 A;  1W1G A;  1Y5O A;  2YT0 A;  3VIA A;  1GC6 A;  3P7Z A;  3HQC A;  2EJ8 A;  3N7C A;  2D11 A;  3F5R A;  2J0K A;  2DFK A;  4K2O A;  1XKE A;  4ZRK A;  4HDO A;  1WGU A;  1ZC3 B;  2ZPY A;  2LOX A;  1X11 A;  4K81 A;  2K2J A;  1I7A A;  1P3R A;  1W1H A;  4D0N B;  1P6S A;  1U27 A;  1PMS A;  2W2X C;  1UEF A;  4ZRJ A;  1Z87 A;  2OTX A;  1QQG A;  2V76 A;  4WJ7 A;  4L6E A;  1FB8 A;  5FI0 A;  1U29 A;  2DX1 A;  2YRY A;  1XOD A;  4GXB A;  2D9Y A;  1OQN A;  4DX9 0;  4HAX B;  2I5C A;  3DXC A;  4F7H A;  4A6F A;  4NY0 A;  2Q13 A;  2MWN B;  4P7I A;  5C5B A;  1MIZ B;  1WJM A;  1K5G B;  5CLL B;  2DN6 A;  1GC7 A;  5DHA B;  2Z0P A;  5D27 A;  4C0A A;  4ZRI A;  1X1G A;  1TXD A;  3G9W A;  4HB3 B;  4HAZ B;  2L2I A;  2ELB A;  3QIJ A;  2GCJ A;  5C79 A;  2I5F A;  2YT1 A;  4F7U P;  1U5D A;  1V88 A;  5J3T A;  1AQC A;  2N23 A;  1U5F A;  3TW1 A;  1B55 A;  1GG3 A;  4CYE A;  2P0D A;  2X18 A;  2DKQ A;  3SYX A;  4PNK A;  3NSU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...