1WVHA

Crystal structure of tensin1 ptb domain
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
133
structure length
132
Chain Sequence
AACNVLFINSVEMESLTGPQAISKAVAETLVADPTPTATIVHFKVSAQGITLTDNQRKLFFRRHYPLNTVTFCDLDPQERKWTKTDGSGPAKLFGFVARKGSTTDNVCHLFAELDPDQPAAAIVNFVSRVML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tensin
publication title Structure of the PTB domain of tensin1 and a model for its recruitment to fibrillar adhesions.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Cell adhesion
total genus 25
structure length 132
sequence length 133
ec nomenclature
pdb deposition date 2004-12-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1wvhA00
1EF1A 2PZ1A 4F7GA 5KQ1A 2AEHA 5CLLB 2UZSA 2EMSA 3BINA 1ZM0A 2LYDA 3DXCA 1BAKA 5D3WA 2W2XC 1LB1A 2RLOA 4HAYB 4HATB 4IAPA 3ZVRA 1QQGA 2Y7BA 5EFXA 2HTHB 2W2WA 4BBKA 3BJIA 4HB3B 3AU4A 1PLSA 4IOYX 2DTCA 4HDOA 2RGNB 2BCJA 4K17A 1V61A 1P3RA 4B6HA 4IFSA 1IRSA 1V88A 2YS1A 1QC6A 3SNHA 1U2BA 5C16A 1M7EA 3PZDA 1GC6A 1XCGA 2L1CA 5D27A 4HAUB 1AWEA 4DX8A 5JP4A 4WVFB 2ROZB 2I5CA 2KUPA 4K2OA 1WGUA 5J3QA 3PVUA 5D3YA 1V89A 2EMTA 2DKQA 2YS5A 4ZRJA 5C5BB 5L81A 1WI1A 3CIKA 3CXBB 1MPHA 2FJLA 2P8VA 1FGZA 3MPXA 3D8EA 3FSSA 1WG7A 2D9XA 1FHWA 4Z2MB 2E2XA 2DKPA 3KY9A 3ODOA 4CHMA 2OTXA 2RSGA 1WGQA 3F5RA 5KQ4A 1U5DA 2EJ8A 2Q13A 1W1GA 2M14A 2XQNM 4HAZB 1UNQA 2M38A 2DX5A 3A8PA 1GC7A 2P0DA 2COAA 2L2IA 3VOQA 3P7ZA 5GOWB 3KZ1A 1V5PA 3PVLA 3TVVA 1DYNA 3TW1A 5DI9B 4Z2NA 2MKRA 4DX90 2D9WA 4HB0B 1DDWA 4A6HA 1NTVA 4C0AA 2LOXA 2KGXB 2ELBA 4WSFA 2Y8FA 3PVWA 1MIXA 1UEFA 1J19A 2DHIA 2N0YA 2ROVA 2AL6A 3TFMA 5FI1A 3HK0A 1GG3A 3QIJA 3A98B 1NI2A 1Z87A 4A6FB 2J59M 5C79A 1UNPA 5HE0A 3SUZA 3FM8C 1XD4A 2DLWA 2J0MA 1MK9B 1EAZA 1XR0B 2DHJA 4GMXB 2VSZA 3TCAA 2YS3A 3DXDA 3G9WA 5CLQB 4KAXB 3AU5A 3HW2B 1J0WA 3M1IB 4Y94A 3PEGA 4YL8A 5HE1A 5FI0A 1SGHA 2DFKA 2JP2A 4F7HA 2RUKB 2LKOA 4NSWA 5D3VA 1Q67A 1B55A 1I7AA 1X86A 2IFSA 4MY6A 3T06A 1EGXA 2YSZA 1TJ6A 1RJ2A 2EC1A 3LJUX 2LG1A 5DHAB 3U7DA 2NZ8B 1BWNA 2D9VA 3FEHA 1XX0A 1FOEA 1FGYA 5LONB 2N23A 5DH9B 1MIZB 1U27A 3QWMA 2DN6A 2GCLA 2YT1A 2J0KA 3D8FA 2QKLA 5LOPB 2H7DA 2GJYA 2COCA 3O96A 2KCJA 1DROA 3V5WA 4WJ7A 2R0DA 1V5MA 4PNKA 2P0HA 3DXEA 2K2JA 1M7RA 1ISNA 4ZRKA 4GMVA 2D10A 1X1FA 1OY2A 1XODA 1PFJA 2DX1A 2VRWB 3A8QA 1E5WA 1NU2A 1I2HA 1X11A 4EJNA 4EKUA 1WJMA 4L6EA 4K2PA 1N3HA 1FHOA 3PP2A 1U5GA 2UVMA 4A5KA 1Y19B 1UPQA 2P0FA 1UNRA 3IVFA 1WJ1A 3PSCA 4GXBA 2W2XD 2D11A 3TO1A 4GPTB 1MK7B 2MDXA 4HB4B 1XKEA 4GZUA 4H8SA 5HE3A 1KI1B 2YT0A 4TYZA 2I1KA 4HB2B 3SYXA 4PQ0A 3SV1A 4HHVA 2CODA 1W1HA 1U5EA 3U8ZA 2DHKA 4NY0A 3KRWA 3OANA 2MFQA 1Y5OA 2CRFA 2V76A 3ULCA 2Z0PA 3KSYA 1SHCA 1FB8A 2IYBA 1P5TA 4TKNA 3AJ4A 1ZSQA 1NTYA 1AQCA 1PMSA 1BTKA 2ZPYA 2YRYA 4EMOA 4YONA 3WYFB 5DHFB 2H7EA 1U5FA 1WVHA 2LULA 3RCPA 1UPRA 1KZGA 4CHJA 4KHBB 2D2QA 3HQCA 2HE7A 3KRXA 1FHXA 2I5FA 2QKMA 1BTNA 4K81A 5DIFB 3X23A 5JHHA 1FAOA 2DA0A 4P7IA 4KHOA 4ZRIA 1K5DB 4A6KA 2YVCA 3ULBA 5C5BA 3GYPA 4XWXA 1RRPB 1H10A 1DDMA 2RNRB 1KZ7A 2MWNB 2RVBB 5C6RA 2D9ZA 4DXAB 4HDQA 2GS0A 5JLJB 2CY4A 2UZRA 1H4RA 1MAIA 3GYOA 1X05A 3MDBC 1TQZA 2CY5A 5JHGA 4KVGB 1X1GA 5KCVA 3ML4A 3PG7A 2K2UA 1K5GB 2COFA 4CYEA 3D8DA 3F0WA 2Z0OA 5J3TA 2X18A 1EVHA 1TXDA 5HE2A 1ZC3B 2G35A 4F7UP 3QBVB 2CAYA 2I1JA 1DBHA 2DYNA 1OMWA 4HAVB 2OQBA 2D9YA 1W1DA 1OQNA 1DDVA 4D0NB 3SO6A 4DBBA 4HAWB 2D4QA 3UZTA 2Z0QA 1ZC4B 1V5UA 2ELAA 3ZDTA 3ODXA 2Y8GA 4HAXB 4MT7A 3VIAA 2NMBA 3NSUA 1MKEA 2ADZA 4MK0A 2GCJA 2YF0A 3ODWA 3WA0A 2J0JA 1P6SA 2R09A 3P6AA 1LW3A 4GN1A 1U29A 5J3YA 4KHAA 1ZVRA 2K00A 3N7CA 5D3XA 2VKIA 4A6FA 2LOZA 2DYQA
chains in the Genus database with same CATH superfamily
2GUMA 1EF1A 2PZ1A 4F7GA 5KQ1A 5I2MA 3NWAA 2AEHA 5LG4B 5CLLB 2UZSA 2EMSA 3BINA 3A58A 1ZM0A 2LYDA 3DXCA 1BAKA 5D3WA 2W2XC 1LB1A 2RLOA 4HAYB 4HATB 4IAPA 3ZVRA 3NWDA 1QQGA 2Y7BA 5EFXA 2HTHB 2W2WA 4BBKA 3BJIA 4HB3B 3AU4A 1PLSA 4QJ5B 4GOUA 4IOYX 2DTCA 4HDOA 2K49A 2RGNB 2BCJA 4K17A 1V61A 1P3RA 4B6HA 2Z4DA 4IFSA 1IRSA 1V88A 2YS1A 1QC6A 3SNHA 1U2BA 5C16A 1M7EA 3PZDA 1GC6A 1XCGA 2L1CA 3OHMB 5D27A 4HAUB 1AWEA 4DX8A 5JP4A 4WVFB 2ROZB 2I5CA 2KUPA 4K2OA 1WGUA 5J3QA 3PVUA 5D3YA 2KIEA 1V89A 2KUQA 2EMTA 2DKQA 2YS5A 4ZRJA 5C5BB 5L81A 1WI1A 3CIKA 3CXBB 1MPHA 2FJLA 2P8VA 1FGZA 3MPXA 3D8EA 3FSSA 1WG7A 2D9XA 1FHWA 4Z2MB 2E2XA 2DKPA 3KY9A 3ODOA 4CHMA 3DCXA 4L1RA 2OTXA 2RSGA 4CSQA 3FVCA 1WGQA 3F5RA 5KQ4A 1U5DA 2EJ8A 2Q13A 1W1GA 2M14A 2K8EA 2XQNM 4HAZB 1UNQA 2M38A 2DX5A 3A8PA 1GC7A 2P0DA 2COAA 2L2IA 2R2YA 3VOQA 3P7ZA 2ZKMX 5GOWB 3KZ1A 1V5PA 3PVLA 3TVVA 1DYNA 3TW1A 5DI9B 4Z2NA 2MKRA 4DX90 2D9WA 4OT1A 4HB0B 1DDWA 4A6HA 1NTVA 4C0AA 2LOXA 2KGXB 2ELBA 4WSFA 2Y8FA 3PVWA 1MIXA 1UEFA 1J19A 2DHIA 2N0YA 2ROVA 2AL6A 3TFMA 5FI1A 3HK0A 1GG3A 3QIJA 3A98B 1NI2A 1Z87A 4A6FB 2J59M 5C79A 1UNPA 5HE0A 3SUZA 3FM8C 1XD4A 4KHBA 2DLWA 2J0MA 1MK9B 1EAZA 1XR0B 2DHJA 4GMXB 2VSZA 3TCAA 2YS3A 3DXDA 3G9WA 5CLQB 4KAXB 3AU5A 3HW2B 1J0WA 3M1IB 4OSNA 3PEGA 4Y94A 4YL8A 5HE1A 5FI0A 1SGHA 2DFKA 2JP2A 4F7HA 2RUKB 2LKOA 4NSWA 5D3VA 1Q67A 1B55A 1I7AA 1X86A 2IFSA 4MY6A 3T06A 1EGXA 2YSZA 1TJ6A 1RJ2A 2EC1A 3HSAA 3LJUX 2LG1A 5DHAB 3U7DA 2NZ8B 1BWNA 2D9VA 3FEHA 1XX0A 1FOEA 3NWFA 1FGYA 5LONB 2N23A 2Z14A 2KR0A 5DH9B 1MIZB 1U27A 3QWMA 2DN6A 2GCLA 2YT1A 2J0KA 3D8FA 2QKLA 5LOPB 2H7DA 2GJYA 2COCA 5IRSA 3O96A 2KCJA 1DROA 3V5WA 4WJ7A 2R0DA 1V5MA 4PNKA 2P0HA 3DXEA 2K2JA 1M7RA 1ISNA 4ZRKA 4GMVA 2D10A 1X1FA 1OY2A 1XODA 1PFJA 2DX1A 2VRWB 3A8QA 1E5WA 1NU2A 2YT2A 4QXAB 1I2HA 1X11A 4EJNA 4EKUA 2Z59A 1WJMA 4L6EA 4K2PA 1N3HA 1FHOA 3PP2A 1U5GA 2UVMA 4GNKB 1Y19B 4A5KA 1UPQA 2P0FA 4QJ4B 4DIXA 3NW8A 1UNRA 3IVFA 1WJ1A 3PSCA 4GXBA 2W2XD 2D11A 3TO1A 4GPTB 1MK7B 2MDXA 4HB4B 1XKEA 4GZUA 4H8SA 5HE3A 1KI1B 2YT0A 4TYZA 2I1KA 4HB2B 3SYXA 4PQ0A 3SV1A 4HHVA 4QJ3B 2CODA 1W1HA 1U5EA 3U8ZA 2DHKA 4NY0A 3KRWA 3OANA 2MFQA 1Y5OA 2CRFA 2V76A 3ULCA 2Z0PA 3KSYA 1SHCA 1FB8A 2IYBA 1P5TA 4TKNA 3AJ4A 1ZSQA 2NBVA 1NTYA 1AQCA 1PMSA 1BTKA 2ZPYA 2YRYA 4EMOA 4YONA 3WYFB 5DHFB 2H7EA 1U5FA 1WVHA 2LULA 3RCPA 3HIEA 2Z13A 1UPRA 1KZGA 4CHJA 4KHBB 2D2QA 3HQCA 2HE7A 3KRXA 1FHXA 2FJUB 2I5FA 5I2SA 2QKMA 1BTNA 4K81A 5DIFB 3X23A 1T77A 5JHHA 1FAOA 2DA0A 4D6WA 4P7IA 4KHOA 4ZRIA 1K5DB 2RRFA 4A6KA 2YVCA 3ULBA 5C5BA 3GYPA 4XWXA 1RRPB 1H10A 1DDMA 2RNRB 1KZ7A 2MWNB 2RVBB 5C6RA 1MI1A 2D9ZA 4DXAB 4HDQA 2GS0A 5JLJB 2CY4A 2UZRA 1H4RA 1MAIA 3GYOA 1X05A 3MDBC 1TQZA 2CY5A 5JHGA 4KVGB 1X1GA 5KCVA 3ML4A 3PG7A 2K2UA 1K5GB 2COFA 4CYEA 3D8DA 3F0WA 2Z0OA 5J3TA 2X18A 1EVHA 1TXDA 2KIGA 5HE2A 1ZC3B 2G35A 4F7UP 3QBVB 2CAYA 2I1JA 4HSIA 1DBHA 2DYNA 1OMWA 4HAVB 2OQBA 2D9YA 1W1DA 1OQNA 1DDVA 4D0NB 3SO6A 4DBBA 4HAWB 2D4QA 3UZTA 2Z0QA 1ZC4B 1V5UA 2ELAA 3ZDTA 3ODXA 2Y8GA 4HAXB 4MT7A 3VIAA 2NMBA 1MKEA 2ADZA 3NSUA 4MK0A 3B77A 2GCJA 2YF0A 3U12A 3ODWA 3WA0A 2J0JA 1P6SA 2R09A 3P6AA 5M4YB 1LW3A 4GN1A 1U29A 5J3YA 4KHAA 1ZVRA 2K00A 3N7CA 5D3XA 2VKIA 4A6FA 2LOZA 1ZYIA 2DYQA
chains in the Genus database with same CATH topology
1EF1A 2PZ1A 4F7GA 5KQ1A 2AEHA 5CLLB 2UZSA 2EMSA 3BINA 1ZM0A 2LYDA 3DXCA 1BAKA 5D3WA 2W2XC 1LB1A 2RLOA 4HAYB 4HATB 4IAPA 3ZVRA 1QQGA 2Y7BA 5EFXA 2HTHB 2W2WA 4BBKA 3BJIA 4HB3B 3AU4A 1PLSA 4IOYX 2DTCA 4HDOA 2RGNB 2BCJA 4K17A 1V61A 1P3RA 4B6HA 4IFSA 1IRSA 1V88A 2YS1A 1QC6A 3SNHA 1U2BA 5C16A 1M7EA 3PZDA 1GC6A 1XCGA 2L1CA 5D27A 4HAUB 1AWEA 4DX8A 5JP4A 4WVFB 2ROZB 2I5CA 2KUPA 4K2OA 1WGUA 5J3QA 3PVUA 5D3YA 1V89A 2EMTA 2DKQA 2YS5A 4ZRJA 5C5BB 5L81A 1WI1A 3CIKA 3CXBB 1MPHA 2FJLA 2P8VA 1FGZA 3MPXA 3D8EA 3FSSA 1WG7A 2D9XA 1FHWA 4Z2MB 2E2XA 2DKPA 3KY9A 3ODOA 4CHMA 2OTXA 2RSGA 1WGQA 3F5RA 5KQ4A 1U5DA 2EJ8A 2Q13A 1W1GA 2M14A 2XQNM 4HAZB 1UNQA 2M38A 2DX5A 3A8PA 1GC7A 2P0DA 2COAA 2L2IA 3VOQA 3P7ZA 5GOWB 3KZ1A 1V5PA 3PVLA 3TVVA 1DYNA 3TW1A 5DI9B 4Z2NA 2MKRA 4DX90 2D9WA 4HB0B 1DDWA 4A6HA 1NTVA 4C0AA 2LOXA 2KGXB 2ELBA 4WSFA 2Y8FA 3PVWA 1MIXA 1UEFA 1J19A 2DHIA 2N0YA 2ROVA 2AL6A 3TFMA 5FI1A 3HK0A 1GG3A 3QIJA 3A98B 1NI2A 1Z87A 4A6FB 2J59M 5C79A 1UNPA 5HE0A 3SUZA 3FM8C 1XD4A 2DLWA 2J0MA 1MK9B 1EAZA 1XR0B 2DHJA 4GMXB 2VSZA 3TCAA 2YS3A 3DXDA 3G9WA 5CLQB 4KAXB 3AU5A 3HW2B 1J0WA 3M1IB 4Y94A 3PEGA 4YL8A 5HE1A 5FI0A 1SGHA 2DFKA 2JP2A 4F7HA 2RUKB 2LKOA 4NSWA 5D3VA 1Q67A 1B55A 1I7AA 1X86A 2IFSA 4MY6A 3T06A 1EGXA 2YSZA 1TJ6A 1RJ2A 2EC1A 3LJUX 2LG1A 5DHAB 3U7DA 2NZ8B 1BWNA 2D9VA 3FEHA 1XX0A 1FOEA 1FGYA 5LONB 2N23A 5DH9B 1MIZB 1U27A 3QWMA 2DN6A 2GCLA 2YT1A 2J0KA 3D8FA 2QKLA 5LOPB 2H7DA 2GJYA 2COCA 3O96A 2KCJA 1DROA 3V5WA 4WJ7A 2R0DA 1V5MA 4PNKA 2P0HA 3DXEA 2K2JA 1M7RA 1ISNA 4ZRKA 4GMVA 2D10A 1X1FA 1OY2A 1XODA 1PFJA 2DX1A 2VRWB 3A8QA 1E5WA 1NU2A 1I2HA 1X11A 4EJNA 4EKUA 1WJMA 4L6EA 4K2PA 1N3HA 1FHOA 3PP2A 1U5GA 2UVMA 4A5KA 1Y19B 1UPQA 2P0FA 1UNRA 3IVFA 1WJ1A 3PSCA 4GXBA 2W2XD 2D11A 3TO1A 4GPTB 1MK7B 2MDXA 4HB4B 1XKEA 4GZUA 4H8SA 5HE3A 1KI1B 2YT0A 4TYZA 2I1KA 4HB2B 3SYXA 4PQ0A 3SV1A 4HHVA 2CODA 1W1HA 1U5EA 3U8ZA 2DHKA 4NY0A 3KRWA 3OANA 2MFQA 1Y5OA 2CRFA 2V76A 3ULCA 2Z0PA 3KSYA 1SHCA 1FB8A 2IYBA 1P5TA 4TKNA 3AJ4A 1ZSQA 1NTYA 1AQCA 1PMSA 1BTKA 2ZPYA 2YRYA 4EMOA 4YONA 3WYFB 5DHFB 2H7EA 1U5FA 1WVHA 2LULA 3RCPA 1UPRA 1KZGA 4CHJA 4KHBB 2D2QA 3HQCA 2HE7A 3KRXA 1FHXA 2I5FA 2QKMA 1BTNA 4K81A 5DIFB 3X23A 5JHHA 1FAOA 2DA0A 4P7IA 4KHOA 4ZRIA 1K5DB 4A6KA 2YVCA 3ULBA 5C5BA 3GYPA 4XWXA 1RRPB 1H10A 1DDMA 2RNRB 1KZ7A 2MWNB 2RVBB 5C6RA 2D9ZA 4DXAB 4HDQA 2GS0A 5JLJB 2CY4A 2UZRA 1H4RA 1MAIA 3GYOA 1X05A 3MDBC 1TQZA 2CY5A 5JHGA 4KVGB 1X1GA 5KCVA 3ML4A 3PG7A 2K2UA 1K5GB 2COFA 4CYEA 3D8DA 3F0WA 2Z0OA 5J3TA 2X18A 1EVHA 1TXDA 5HE2A 1ZC3B 2G35A 4F7UP 3QBVB 2CAYA 2I1JA 1DBHA 2DYNA 1OMWA 4HAVB 2OQBA 2D9YA 1W1DA 1OQNA 1DDVA 4D0NB 3SO6A 4DBBA 4HAWB 2D4QA 3UZTA 2Z0QA 1ZC4B 1V5UA 2ELAA 3ZDTA 3ODXA 2Y8GA 4HAXB 4MT7A 3VIAA 2NMBA 3NSUA 1MKEA 2ADZA 4MK0A 2GCJA 2YF0A 3ODWA 3WA0A 2J0JA 1P6SA 2R09A 3P6AA 1LW3A 4GN1A 1U29A 5J3YA 4KHAA 1ZVRA 2K00A 3N7CA 5D3XA 2VKIA 4A6FA 2LOZA 2DYQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EF1 A;  2PZ1 A;  4F7G A;  5KQ1 A;  2AEH A;  5CLL B;  2UZS A;  2EMS A;  3BIN A;  1ZM0 A;  2LYD A;  3DXC A;  1BAK A;  5D3W A;  2W2X C;  1LB1 A;  2RLO A;  4HAY B;  4HAT B;  4IAP A;  3ZVR A;  1QQG A;  2Y7B A;  5EFX A;  2HTH B;  2W2W A;  4BBK A;  3BJI A;  4HB3 B;  3AU4 A;  1PLS A;  4IOY X;  2DTC A;  4HDO A;  2RGN B;  2BCJ A;  4K17 A;  1V61 A;  1P3R A;  4B6H A;  4IFS A;  1IRS A;  1V88 A;  2YS1 A;  1QC6 A;  3SNH A;  1U2B A;  5C16 A;  1M7E A;  3PZD A;  1GC6 A;  1XCG A;  2L1C A;  5D27 A;  4HAU B;  1AWE A;  4DX8 A;  5JP4 A;  4WVF B;  2ROZ B;  2I5C A;  2KUP A;  4K2O A;  1WGU A;  5J3Q A;  3PVU A;  5D3Y A;  1V89 A;  2EMT A;  2DKQ A;  2YS5 A;  4ZRJ A;  5C5B B;  5L81 A;  1WI1 A;  3CIK A;  3CXB B;  1MPH A;  2FJL A;  2P8V A;  1FGZ A;  3MPX A;  3D8E A;  3FSS A;  1WG7 A;  2D9X A;  1FHW A;  4Z2M B;  2E2X A;  2DKP A;  3KY9 A;  3ODO A;  4CHM A;  2OTX A;  2RSG A;  1WGQ A;  3F5R A;  5KQ4 A;  1U5D A;  2EJ8 A;  2Q13 A;  1W1G A;  2M14 A;  2XQN M;  4HAZ B;  1UNQ A;  2M38 A;  2DX5 A;  3A8P A;  1GC7 A;  2P0D A;  2COA A;  2L2I A;  3VOQ A;  3P7Z A;  5GOW B;  3KZ1 A;  1V5P A;  3PVL A;  3TVV A;  1DYN A;  3TW1 A;  5DI9 B;  4Z2N A;  2MKR A;  4DX9 0;  2D9W A;  4HB0 B;  1DDW A;  4A6H A;  1NTV A;  4C0A A;  2LOX A;  2KGX B;  2ELB A;  4WSF A;  2Y8F A;  3PVW A;  1MIX A;  1UEF A;  1J19 A;  2DHI A;  2N0Y A;  2ROV A;  2AL6 A;  3TFM A;  5FI1 A;  3HK0 A;  1GG3 A;  3QIJ A;  3A98 B;  1NI2 A;  1Z87 A;  4A6F B;  2J59 M;  5C79 A;  1UNP A;  5HE0 A;  3SUZ A;  3FM8 C;  1XD4 A;  2DLW A;  2J0M A;  1MK9 B;  1EAZ A;  1XR0 B;  2DHJ A;  4GMX B;  2VSZ A;  3TCA A;  2YS3 A;  3DXD A;  3G9W A;  5CLQ B;  4KAX B;  3AU5 A;  3HW2 B;  1J0W A;  3M1I B;  4Y94 A;  3PEG A;  4YL8 A;  5HE1 A;  5FI0 A;  1SGH A;  2DFK A;  2JP2 A;  4F7H A;  2RUK B;  2LKO A;  4NSW A;  5D3V A;  1Q67 A;  1B55 A;  1I7A A;  1X86 A;  2IFS A;  4MY6 A;  3T06 A;  1EGX A;  2YSZ A;  1TJ6 A;  1RJ2 A;  2EC1 A;  3LJU X;  2LG1 A;  5DHA B;  3U7D A;  2NZ8 B;  1BWN A;  2D9V A;  3FEH A;  1XX0 A;  1FOE A;  1FGY A;  5LON B;  2N23 A;  5DH9 B;  1MIZ B;  1U27 A;  3QWM A;  2DN6 A;  2GCL A;  2YT1 A;  2J0K A;  3D8F A;  2QKL A;  5LOP B;  2H7D A;  2GJY A;  2COC A;  3O96 A;  2KCJ A;  1DRO A;  3V5W A;  4WJ7 A;  2R0D A;  1V5M A;  4PNK A;  2P0H A;  3DXE A;  2K2J A;  1M7R A;  1ISN A;  4ZRK A;  4GMV A;  2D10 A;  1X1F A;  1OY2 A;  1XOD A;  1PFJ A;  2DX1 A;  2VRW B;  3A8Q A;  1E5W A;  1NU2 A;  1I2H A;  1X11 A;  4EJN A;  4EKU A;  1WJM A;  4L6E A;  4K2P A;  1N3H A;  1FHO A;  3PP2 A;  1U5G A;  2UVM A;  4A5K A;  1Y19 B;  1UPQ A;  2P0F A;  1UNR A;  3IVF A;  1WJ1 A;  3PSC A;  4GXB A;  2W2X D;  2D11 A;  3TO1 A;  4GPT B;  1MK7 B;  2MDX A;  4HB4 B;  1XKE A;  4GZU A;  4H8S A;  5HE3 A;  1KI1 B;  2YT0 A;  4TYZ A;  2I1K A;  4HB2 B;  3SYX A;  4PQ0 A;  3SV1 A;  4HHV A;  2COD A;  1W1H A;  1U5E A;  3U8Z A;  2DHK A;  4NY0 A;  3KRW A;  3OAN A;  2MFQ A;  1Y5O A;  2CRF A;  2V76 A;  3ULC A;  2Z0P A;  3KSY A;  1SHC A;  1FB8 A;  2IYB A;  1P5T A;  4TKN A;  3AJ4 A;  1ZSQ A;  1NTY A;  1AQC A;  1PMS A;  1BTK A;  2ZPY A;  2YRY A;  4EMO A;  4YON A;  3WYF B;  5DHF B;  2H7E A;  1U5F A;  1WVH A;  2LUL A;  3RCP A;  1UPR A;  1KZG A;  4CHJ A;  4KHB B;  2D2Q A;  3HQC A;  2HE7 A;  3KRX A;  1FHX A;  2I5F A;  2QKM A;  1BTN A;  4K81 A;  5DIF B;  3X23 A;  5JHH A;  1FAO A;  2DA0 A;  4P7I A;  4KHO A;  4ZRI A;  1K5D B;  4A6K A;  2YVC A;  3ULB A;  5C5B A;  3GYP A;  4XWX A;  1RRP B;  1H10 A;  1DDM A;  2RNR B;  1KZ7 A;  2MWN B;  2RVB B;  5C6R A;  2D9Z A;  4DXA B;  4HDQ A;  2GS0 A;  5JLJ B;  2CY4 A;  2UZR A;  1H4R A;  1MAI A;  3GYO A;  1X05 A;  3MDB C;  1TQZ A;  2CY5 A;  5JHG A;  4KVG B;  1X1G A;  5KCV A;  3ML4 A;  3PG7 A;  2K2U A;  1K5G B;  2COF A;  4CYE A;  3D8D A;  3F0W A;  2Z0O A;  5J3T A;  2X18 A;  1EVH A;  1TXD A;  5HE2 A;  1ZC3 B;  2G35 A;  4F7U P;  3QBV B;  2CAY A;  2I1J A;  1DBH A;  2DYN A;  1OMW A;  4HAV B;  2OQB A;  2D9Y A;  1W1D A;  1OQN A;  1DDV A;  4D0N B;  3SO6 A;  4DBB A;  4HAW B;  2D4Q A;  3UZT A;  2Z0Q A;  1ZC4 B;  1V5U A;  2ELA A;  3ZDT A;  3ODX A;  2Y8G A;  4HAX B;  4MT7 A;  3VIA A;  2NMB A;  3NSU A;  1MKE A;  2ADZ A;  4MK0 A;  2GCJ A;  2YF0 A;  3ODW A;  3WA0 A;  2J0J A;  1P6S A;  2R09 A;  3P6A A;  1LW3 A;  4GN1 A;  1U29 A;  5J3Y A;  4KHA A;  1ZVR A;  2K00 A;  3N7C A;  5D3X A;  2VKI A;  4A6F A;  2LOZ A;  2DYQ A; 
#chains in the Genus database with same CATH topology
 2GUM A;  1EF1 A;  2PZ1 A;  4F7G A;  5KQ1 A;  5I2M A;  3NWA A;  2AEH A;  5LG4 B;  5CLL B;  2UZS A;  2EMS A;  3BIN A;  3A58 A;  1ZM0 A;  2LYD A;  3DXC A;  1BAK A;  5D3W A;  2W2X C;  1LB1 A;  2RLO A;  4HAY B;  4HAT B;  4IAP A;  3ZVR A;  3NWD A;  1QQG A;  2Y7B A;  5EFX A;  2HTH B;  2W2W A;  4BBK A;  3BJI A;  4HB3 B;  3AU4 A;  1PLS A;  4QJ5 B;  4GOU A;  4IOY X;  2DTC A;  4HDO A;  2K49 A;  2RGN B;  2BCJ A;  4K17 A;  1V61 A;  1P3R A;  4B6H A;  2Z4D A;  4IFS A;  1IRS A;  1V88 A;  2YS1 A;  1QC6 A;  3SNH A;  1U2B A;  5C16 A;  1M7E A;  3PZD A;  1GC6 A;  1XCG A;  2L1C A;  3OHM B;  5D27 A;  4HAU B;  1AWE A;  4DX8 A;  5JP4 A;  4WVF B;  2ROZ B;  2I5C A;  2KUP A;  4K2O A;  1WGU A;  5J3Q A;  3PVU A;  5D3Y A;  2KIE A;  1V89 A;  2KUQ A;  2EMT A;  2DKQ A;  2YS5 A;  4ZRJ A;  5C5B B;  5L81 A;  1WI1 A;  3CIK A;  3CXB B;  1MPH A;  2FJL A;  2P8V A;  1FGZ A;  3MPX A;  3D8E A;  3FSS A;  1WG7 A;  2D9X A;  1FHW A;  4Z2M B;  2E2X A;  2DKP A;  3KY9 A;  3ODO A;  4CHM A;  3DCX A;  4L1R A;  2OTX A;  2RSG A;  4CSQ A;  3FVC A;  1WGQ A;  3F5R A;  5KQ4 A;  1U5D A;  2EJ8 A;  2Q13 A;  1W1G A;  2M14 A;  2K8E A;  2XQN M;  4HAZ B;  1UNQ A;  2M38 A;  2DX5 A;  3A8P A;  1GC7 A;  2P0D A;  2COA A;  2L2I A;  2R2Y A;  3VOQ A;  3P7Z A;  2ZKM X;  5GOW B;  3KZ1 A;  1V5P A;  3PVL A;  3TVV A;  1DYN A;  3TW1 A;  5DI9 B;  4Z2N A;  2MKR A;  4DX9 0;  2D9W A;  4OT1 A;  4HB0 B;  1DDW A;  4A6H A;  1NTV A;  4C0A A;  2LOX A;  2KGX B;  2ELB A;  4WSF A;  2Y8F A;  3PVW A;  1MIX A;  1UEF A;  1J19 A;  2DHI A;  2N0Y A;  2ROV A;  2AL6 A;  3TFM A;  5FI1 A;  3HK0 A;  1GG3 A;  3QIJ A;  3A98 B;  1NI2 A;  1Z87 A;  4A6F B;  2J59 M;  5C79 A;  1UNP A;  5HE0 A;  3SUZ A;  3FM8 C;  1XD4 A;  4KHB A;  2DLW A;  2J0M A;  1MK9 B;  1EAZ A;  1XR0 B;  2DHJ A;  4GMX B;  2VSZ A;  3TCA A;  2YS3 A;  3DXD A;  3G9W A;  5CLQ B;  4KAX B;  3AU5 A;  3HW2 B;  1J0W A;  3M1I B;  4OSN A;  3PEG A;  4Y94 A;  4YL8 A;  5HE1 A;  5FI0 A;  1SGH A;  2DFK A;  2JP2 A;  4F7H A;  2RUK B;  2LKO A;  4NSW A;  5D3V A;  1Q67 A;  1B55 A;  1I7A A;  1X86 A;  2IFS A;  4MY6 A;  3T06 A;  1EGX A;  2YSZ A;  1TJ6 A;  1RJ2 A;  2EC1 A;  3HSA A;  3LJU X;  2LG1 A;  5DHA B;  3U7D A;  2NZ8 B;  1BWN A;  2D9V A;  3FEH A;  1XX0 A;  1FOE A;  3NWF A;  1FGY A;  5LON B;  2N23 A;  2Z14 A;  2KR0 A;  5DH9 B;  1MIZ B;  1U27 A;  3QWM A;  2DN6 A;  2GCL A;  2YT1 A;  2J0K A;  3D8F A;  2QKL A;  5LOP B;  2H7D A;  2GJY A;  2COC A;  5IRS A;  3O96 A;  2KCJ A;  1DRO A;  3V5W A;  4WJ7 A;  2R0D A;  1V5M A;  4PNK A;  2P0H A;  3DXE A;  2K2J A;  1M7R A;  1ISN A;  4ZRK A;  4GMV A;  2D10 A;  1X1F A;  1OY2 A;  1XOD A;  1PFJ A;  2DX1 A;  2VRW B;  3A8Q A;  1E5W A;  1NU2 A;  2YT2 A;  4QXA B;  1I2H A;  1X11 A;  4EJN A;  4EKU A;  2Z59 A;  1WJM A;  4L6E A;  4K2P A;  1N3H A;  1FHO A;  3PP2 A;  1U5G A;  2UVM A;  4GNK B;  1Y19 B;  4A5K A;  1UPQ A;  2P0F A;  4QJ4 B;  4DIX A;  3NW8 A;  1UNR A;  3IVF A;  1WJ1 A;  3PSC A;  4GXB A;  2W2X D;  2D11 A;  3TO1 A;  4GPT B;  1MK7 B;  2MDX A;  4HB4 B;  1XKE A;  4GZU A;  4H8S A;  5HE3 A;  1KI1 B;  2YT0 A;  4TYZ A;  2I1K A;  4HB2 B;  3SYX A;  4PQ0 A;  3SV1 A;  4HHV A;  4QJ3 B;  2COD A;  1W1H A;  1U5E A;  3U8Z A;  2DHK A;  4NY0 A;  3KRW A;  3OAN A;  2MFQ A;  1Y5O A;  2CRF A;  2V76 A;  3ULC A;  2Z0P A;  3KSY A;  1SHC A;  1FB8 A;  2IYB A;  1P5T A;  4TKN A;  3AJ4 A;  1ZSQ A;  2NBV A;  1NTY A;  1AQC A;  1PMS A;  1BTK A;  2ZPY A;  2YRY A;  4EMO A;  4YON A;  3WYF B;  5DHF B;  2H7E A;  1U5F A;  1WVH A;  2LUL A;  3RCP A;  3HIE A;  2Z13 A;  1UPR A;  1KZG A;  4CHJ A;  4KHB B;  2D2Q A;  3HQC A;  2HE7 A;  3KRX A;  1FHX A;  2FJU B;  2I5F A;  5I2S A;  2QKM A;  1BTN A;  4K81 A;  5DIF B;  3X23 A;  1T77 A;  5JHH A;  1FAO A;  2DA0 A;  4D6W A;  4P7I A;  4KHO A;  4ZRI A;  1K5D B;  2RRF A;  4A6K A;  2YVC A;  3ULB A;  5C5B A;  3GYP A;  4XWX A;  1RRP B;  1H10 A;  1DDM A;  2RNR B;  1KZ7 A;  2MWN B;  2RVB B;  5C6R A;  1MI1 A;  2D9Z A;  4DXA B;  4HDQ A;  2GS0 A;  5JLJ B;  2CY4 A;  2UZR A;  1H4R A;  1MAI A;  3GYO A;  1X05 A;  3MDB C;  1TQZ A;  2CY5 A;  5JHG A;  4KVG B;  1X1G A;  5KCV A;  3ML4 A;  3PG7 A;  2K2U A;  1K5G B;  2COF A;  4CYE A;  3D8D A;  3F0W A;  2Z0O A;  5J3T A;  2X18 A;  1EVH A;  1TXD A;  2KIG A;  5HE2 A;  1ZC3 B;  2G35 A;  4F7U P;  3QBV B;  2CAY A;  2I1J A;  4HSI A;  1DBH A;  2DYN A;  1OMW A;  4HAV B;  2OQB A;  2D9Y A;  1W1D A;  1OQN A;  1DDV A;  4D0N B;  3SO6 A;  4DBB A;  4HAW B;  2D4Q A;  3UZT A;  2Z0Q A;  1ZC4 B;  1V5U A;  2ELA A;  3ZDT A;  3ODX A;  2Y8G A;  4HAX B;  4MT7 A;  3VIA A;  2NMB A;  1MKE A;  2ADZ A;  3NSU A;  4MK0 A;  3B77 A;  2GCJ A;  2YF0 A;  3U12 A;  3ODW A;  3WA0 A;  2J0J A;  1P6S A;  2R09 A;  3P6A A;  5M4Y B;  1LW3 A;  4GN1 A;  1U29 A;  5J3Y A;  4KHA A;  1ZVR A;  2K00 A;  3N7C A;  5D3X A;  2VKI A;  4A6F A;  2LOZ A;  1ZYI A;  2DYQ A; 
#chains in the Genus database with same CATH homology
 1EF1 A;  2PZ1 A;  4F7G A;  5KQ1 A;  2AEH A;  5CLL B;  2UZS A;  2EMS A;  3BIN A;  1ZM0 A;  2LYD A;  3DXC A;  1BAK A;  5D3W A;  2W2X C;  1LB1 A;  2RLO A;  4HAY B;  4HAT B;  4IAP A;  3ZVR A;  1QQG A;  2Y7B A;  5EFX A;  2HTH B;  2W2W A;  4BBK A;  3BJI A;  4HB3 B;  3AU4 A;  1PLS A;  4IOY X;  2DTC A;  4HDO A;  2RGN B;  2BCJ A;  4K17 A;  1V61 A;  1P3R A;  4B6H A;  4IFS A;  1IRS A;  1V88 A;  2YS1 A;  1QC6 A;  3SNH A;  1U2B A;  5C16 A;  1M7E A;  3PZD A;  1GC6 A;  1XCG A;  2L1C A;  5D27 A;  4HAU B;  1AWE A;  4DX8 A;  5JP4 A;  4WVF B;  2ROZ B;  2I5C A;  2KUP A;  4K2O A;  1WGU A;  5J3Q A;  3PVU A;  5D3Y A;  1V89 A;  2EMT A;  2DKQ A;  2YS5 A;  4ZRJ A;  5C5B B;  5L81 A;  1WI1 A;  3CIK A;  3CXB B;  1MPH A;  2FJL A;  2P8V A;  1FGZ A;  3MPX A;  3D8E A;  3FSS A;  1WG7 A;  2D9X A;  1FHW A;  4Z2M B;  2E2X A;  2DKP A;  3KY9 A;  3ODO A;  4CHM A;  2OTX A;  2RSG A;  1WGQ A;  3F5R A;  5KQ4 A;  1U5D A;  2EJ8 A;  2Q13 A;  1W1G A;  2M14 A;  2XQN M;  4HAZ B;  1UNQ A;  2M38 A;  2DX5 A;  3A8P A;  1GC7 A;  2P0D A;  2COA A;  2L2I A;  3VOQ A;  3P7Z A;  5GOW B;  3KZ1 A;  1V5P A;  3PVL A;  3TVV A;  1DYN A;  3TW1 A;  5DI9 B;  4Z2N A;  2MKR A;  4DX9 0;  2D9W A;  4HB0 B;  1DDW A;  4A6H A;  1NTV A;  4C0A A;  2LOX A;  2KGX B;  2ELB A;  4WSF A;  2Y8F A;  3PVW A;  1MIX A;  1UEF A;  1J19 A;  2DHI A;  2N0Y A;  2ROV A;  2AL6 A;  3TFM A;  5FI1 A;  3HK0 A;  1GG3 A;  3QIJ A;  3A98 B;  1NI2 A;  1Z87 A;  4A6F B;  2J59 M;  5C79 A;  1UNP A;  5HE0 A;  3SUZ A;  3FM8 C;  1XD4 A;  2DLW A;  2J0M A;  1MK9 B;  1EAZ A;  1XR0 B;  2DHJ A;  4GMX B;  2VSZ A;  3TCA A;  2YS3 A;  3DXD A;  3G9W A;  5CLQ B;  4KAX B;  3AU5 A;  3HW2 B;  1J0W A;  3M1I B;  4Y94 A;  3PEG A;  4YL8 A;  5HE1 A;  5FI0 A;  1SGH A;  2DFK A;  2JP2 A;  4F7H A;  2RUK B;  2LKO A;  4NSW A;  5D3V A;  1Q67 A;  1B55 A;  1I7A A;  1X86 A;  2IFS A;  4MY6 A;  3T06 A;  1EGX A;  2YSZ A;  1TJ6 A;  1RJ2 A;  2EC1 A;  3LJU X;  2LG1 A;  5DHA B;  3U7D A;  2NZ8 B;  1BWN A;  2D9V A;  3FEH A;  1XX0 A;  1FOE A;  1FGY A;  5LON B;  2N23 A;  5DH9 B;  1MIZ B;  1U27 A;  3QWM A;  2DN6 A;  2GCL A;  2YT1 A;  2J0K A;  3D8F A;  2QKL A;  5LOP B;  2H7D A;  2GJY A;  2COC A;  3O96 A;  2KCJ A;  1DRO A;  3V5W A;  4WJ7 A;  2R0D A;  1V5M A;  4PNK A;  2P0H A;  3DXE A;  2K2J A;  1M7R A;  1ISN A;  4ZRK A;  4GMV A;  2D10 A;  1X1F A;  1OY2 A;  1XOD A;  1PFJ A;  2DX1 A;  2VRW B;  3A8Q A;  1E5W A;  1NU2 A;  1I2H A;  1X11 A;  4EJN A;  4EKU A;  1WJM A;  4L6E A;  4K2P A;  1N3H A;  1FHO A;  3PP2 A;  1U5G A;  2UVM A;  4A5K A;  1Y19 B;  1UPQ A;  2P0F A;  1UNR A;  3IVF A;  1WJ1 A;  3PSC A;  4GXB A;  2W2X D;  2D11 A;  3TO1 A;  4GPT B;  1MK7 B;  2MDX A;  4HB4 B;  1XKE A;  4GZU A;  4H8S A;  5HE3 A;  1KI1 B;  2YT0 A;  4TYZ A;  2I1K A;  4HB2 B;  3SYX A;  4PQ0 A;  3SV1 A;  4HHV A;  2COD A;  1W1H A;  1U5E A;  3U8Z A;  2DHK A;  4NY0 A;  3KRW A;  3OAN A;  2MFQ A;  1Y5O A;  2CRF A;  2V76 A;  3ULC A;  2Z0P A;  3KSY A;  1SHC A;  1FB8 A;  2IYB A;  1P5T A;  4TKN A;  3AJ4 A;  1ZSQ A;  1NTY A;  1AQC A;  1PMS A;  1BTK A;  2ZPY A;  2YRY A;  4EMO A;  4YON A;  3WYF B;  5DHF B;  2H7E A;  1U5F A;  1WVH A;  2LUL A;  3RCP A;  1UPR A;  1KZG A;  4CHJ A;  4KHB B;  2D2Q A;  3HQC A;  2HE7 A;  3KRX A;  1FHX A;  2I5F A;  2QKM A;  1BTN A;  4K81 A;  5DIF B;  3X23 A;  5JHH A;  1FAO A;  2DA0 A;  4P7I A;  4KHO A;  4ZRI A;  1K5D B;  4A6K A;  2YVC A;  3ULB A;  5C5B A;  3GYP A;  4XWX A;  1RRP B;  1H10 A;  1DDM A;  2RNR B;  1KZ7 A;  2MWN B;  2RVB B;  5C6R A;  2D9Z A;  4DXA B;  4HDQ A;  2GS0 A;  5JLJ B;  2CY4 A;  2UZR A;  1H4R A;  1MAI A;  3GYO A;  1X05 A;  3MDB C;  1TQZ A;  2CY5 A;  5JHG A;  4KVG B;  1X1G A;  5KCV A;  3ML4 A;  3PG7 A;  2K2U A;  1K5G B;  2COF A;  4CYE A;  3D8D A;  3F0W A;  2Z0O A;  5J3T A;  2X18 A;  1EVH A;  1TXD A;  5HE2 A;  1ZC3 B;  2G35 A;  4F7U P;  3QBV B;  2CAY A;  2I1J A;  1DBH A;  2DYN A;  1OMW A;  4HAV B;  2OQB A;  2D9Y A;  1W1D A;  1OQN A;  1DDV A;  4D0N B;  3SO6 A;  4DBB A;  4HAW B;  2D4Q A;  3UZT A;  2Z0Q A;  1ZC4 B;  1V5U A;  2ELA A;  3ZDT A;  3ODX A;  2Y8G A;  4HAX B;  4MT7 A;  3VIA A;  2NMB A;  3NSU A;  1MKE A;  2ADZ A;  4MK0 A;  2GCJ A;  2YF0 A;  3ODW A;  3WA0 A;  2J0J A;  1P6S A;  2R09 A;  3P6A A;  1LW3 A;  4GN1 A;  1U29 A;  5J3Y A;  4KHA A;  1ZVR A;  2K00 A;  3N7C A;  5D3X A;  2VKI A;  4A6F A;  2LOZ A;  2DYQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...