1WVHA

Crystal structure of tensin1 ptb domain
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
133
structure length
132
Chain Sequence
b'AACNVLFINSVEMESLTGPQAISKAVAETLVADPTPTATIVHFKVSAQGITLTDNQRKLFFRRHYPLNTVTFCDLDPQERKWTKTDGSGPAKLFGFVARKGSTTDNVCHLFAELDPDQPAAAIVNFVSRVML'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tensin
publication title Structure of the PTB domain of tensin1 and a model for its recruitment to fibrillar adhesions.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Cell adhesion
total genus 25
structure length 132
sequence length 133
ec nomenclature
pdb deposition date 2004-12-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1wvhA00
1K5DB 2W2XC 2IFSA 3ZDTA 3SYXA 1Y19B 5HE1A 5C5BB 2IYBA 4KAXB 2DYNA 1WVHA 4HAYB 2KGXB 5DHAB 5HE3A 4GN1A 1MK7B 4ZRJA 1ZM0A 3FEHA 4GZUA 1WJMA 4BBKA 1H4RA 2D2QA 5CLLB 5D3WA 1PMSA 3D8DA 2D9ZA 2LYDA 5HE0A 2BCJA 4TKNA 4MT7A 2W2WA 2DKQA 4Z2NA 2UZSA 5HE2A 4K2PA 4D0NB 2ELAA 3BJIA 1XX0A 1NI2A 1U5DA 3AU4A 3WA0A 4DBBA 2OQBA 5KQ1A 2VKIA 2Z0OA 2V76A 3SUZA 3NSUA 2YVCA 1DDWA 1V5MA 2EMSA 5JHHA 2E2XA 1ISNA 2PZ1A 3KSYA 2DN6A 2DHJA 4ZRIA 5DH9B 2L2IA 1ZC4B 4P7IA 4A6KA 1ZSQA 4KHBB 1UNPA 5J3TA 1RJ2A 3KY9A 4GXBA 3TO1A 4Y94A 3KRWA 3DXEA 2CAYA 4YL8A 4KHOA 1E5WA 4HDQA 1MAIA 2RSGA 3PVLA 2DFKA 1KI1B 1FGZA 1P5TA 4HAWB 3PZDA 2LG1A 3ULCA 2LOXA 3ODWA 3CXBB 1FHXA 3A98B 4EMOA 1X05A 5DHFB 4MK0A 5DIFB 1X86A 1ZVRA 1FHWA 2RNRB 2VSZA 2QKLA 2W2XD 3U7DA 2MDXA 3A8PA 1P3RA 2N0YA 1UPRA 3HW2B 2XQNM 1BTNA 1WI1A 1U5FA 2H7DA 1MPHA 2LKOA 4TYZA 3FM8C 2YSZA 3SNHA 4HAVB 4HB3B 4ZRKA 3ML4A 3ZVRA 2I5FA 3KRXA 2NMBA 2NZ8B 3TFMA 2ELBA 1U2BA 2P0DA 2FJLA 1KZ7A 3MDBC 3AJ4A 4YONA 1TQZA 1AQCA 4A6FB 1NU2A 1UEFA 2N23A 5C16A 2I5CA 1DDMA 1J0WA 1XODA 2K2UA 2J0KA 1PLSA 3U8ZA 1P6SA 1BAKA 1OMWA 1SGHA 1XD4A 2CY4A 1W1HA 1U29A 3SO6A 1W1GA 3ULBA 2KUPA 1MKEA 4CHMA 1MK9B 3P6AA 5J3YA 4HB0B 3A8QA 1XKEA 2ADZA 3D8EA 3GYPA 2UVMA 5LOPB 1EGXA 3TVVA 4H8SA 3FSSA 3P7ZA 4GMVA 1Z87A 2MFQA 1V5UA 4B6HA 2CY5A 3F5RA 2D9VA 1ZC3B 2UZRA 1RRPB 1IRSA 4HHVA 3OANA 1X1FA 4KHAA 5DI9B 4F7HA 3LJUX 2YT0A 1V61A 5L81A 4L6EA 2AL6A 2YRYA 1UNQA 2DA0A 2EMTA 4PNKA 2AEHA 1MIZB 5LONB 1FOEA 2K00A 1GC7A 2RGNB 4DX8A 3HK0A 3IVFA 3AU5A 2MWNB 2COAA 1M7RA 3GYOA 3ODXA 5KQ4A 4K2OA 1V5PA 1WGQA 1W1DA 5C5BA 1M7EA 2VRWB 4IAPA 2GJYA 2P8VA 2D4QA 2Y8GA 5EFXA 4HDOA 4C0AA 4KVGB 4GMXB 4WSFA 1AWEA 1FAOA 1SHCA 3PSCA 4XWXA 2KCJA 2EJ8A 2D11A 1XR0B 2RVBB 1NTVA 4HAZB 3QIJA 2LULA 2YF0A 4HAXB 4WVFB 2DKPA 2YT1A 1EAZA 2DYQA 2QKMA 2H7EA 3ODOA 1WG7A 2R09A 4A6FA 3V5WA 5JLJB 2YS1A 2P0FA 3G9WA 1FHOA 2HE7A 1XCGA 2JP2A 3DXDA 4Z2MB 1BTKA 3TW1A 2LOZA 5JP4A 2EC1A 1EF1A 2R0DA 4PQ0A 3QBVB 2DTCA 2COFA 5D3YA 1EVHA 4GPTB 4DXAB 2DHIA 2D9YA 4K81A 4CHJA 2I1KA 4MY6A 2D10A 4HATB 1B55A 1OQNA 2COCA 1Y5OA 1NTYA 2Q13A 1TXDA 3F0WA 4K17A 1V88A 2CODA 2ROVA 4HAUB 4A5KA 1H10A 4HB2B 3HQCA 2GCJA 1PFJA 2G35A 3RCPA 3PVUA 5FI0A 1KZGA 1WJ1A 4EKUA 5D27A 1BWNA 5KCVA 1QQGA 1OY2A 3MPXA 2K2JA 1WGUA 1X11A 3PP2A 3PVWA 1QC6A 2Y7BA 4A6HA 4WJ7A 1I2HA 3UZTA 3QWMA 1FB8A 1UPQA 2CRFA 5GOWB 2HTHB 1LB1A 3BINA 2M14A 4IFSA 1X1GA 4NSWA 2X18A 3PEGA 2Z0PA 2J0JA 2J59M 2DLWA 5CLQB 3VOQA 1DDVA 3CIKA 2M38A 5C79A 3VIAA 5J3QA 5C6RA 2YS5A 1TJ6A 1MIXA 3WYFB 4F7GA 5JHGA 2L1CA 5FI1A 1UNRA 2I1JA 3T06A 4F7UP 3X23A 4DX90 1DBHA 3PG7A 2RUKB 2MKRA 2ZPYA 1U5EA 2D9WA 2GCLA 4NY0A 5D3VA 2J0MA 3KZ1A 1I7AA 4IOYX 2DX1A 4EJNA 3N7CA 2P0HA 3D8FA 3O96A 3TCAA 2DHKA 2DX5A 1Q67A 2GS0A 1J19A 1FGYA 1V89A 2YS3A 4CYEA 3SV1A 2Z0QA 1GG3A 1DYNA 2Y8FA 5D3XA 2RLOA 1N3HA 4HB4B 2ROZB 2D9XA 1GC6A 1K5GB 2OTXA 1LW3A 3DXCA 3M1IB 1U5GA 1U27A 1DROA
chains in the Genus database with same CATH superfamily
1K5DB 2W2XC 2IFSA 3ZDTA 2Z13A 3SYXA 1Y19B 5HE1A 5C5BB 2IYBA 4KAXB 2DYNA 1WVHA 4HAYB 4D6WA 2KGXB 5DHAB 4QJ3B 5HE3A 4GN1A 1MK7B 4ZRJA 1ZM0A 3FEHA 4GZUA 4OT1A 1WJMA 4BBKA 1H4RA 2D2QA 5CLLB 2NBVA 5D3WA 2KIEA 1PMSA 3D8DA 2D9ZA 2RRFA 2LYDA 5HE0A 2BCJA 4TKNA 4MT7A 2W2WA 2DKQA 4Z2NA 2UZSA 5HE2A 4K2PA 4D0NB 3OHMB 2ELAA 3BJIA 1XX0A 1T77A 2Z14A 1NI2A 1U5DA 3AU4A 3WA0A 4DBBA 2OQBA 5KQ1A 2VKIA 2Z0OA 2V76A 3SUZA 3NSUA 2YVCA 3NWDA 1DDWA 1V5MA 2EMSA 5JHHA 2E2XA 1ISNA 2PZ1A 4GNKB 3KSYA 2DN6A 2DHJA 4ZRIA 5DH9B 2L2IA 1ZC4B 4P7IA 4QXAB 4A6KA 1ZSQA 3NWFA 4KHBB 1UNPA 5J3TA 1RJ2A 3KY9A 4GXBA 3TO1A 4Y94A 3KRWA 3DXEA 2CAYA 4YL8A 4KHOA 1E5WA 4HDQA 1MAIA 2RSGA 3PVLA 2DFKA 1KI1B 1FGZA 1P5TA 4HAWB 3PZDA 2LG1A 3ULCA 2LOXA 2KR0A 3ODWA 3CXBB 1FHXA 3A98B 4EMOA 1X05A 5DHFB 4MK0A 5DIFB 1X86A 1ZVRA 4GOUA 1FHWA 2K8EA 2W2XD 2RNRB 2Z4DA 2VSZA 2K49A 2QKLA 2MDXA 3U7DA 3A8PA 1P3RA 2N0YA 1UPRA 3HW2B 2XQNM 1BTNA 1WI1A 1U5FA 2H7DA 1MPHA 3HSAA 2LKOA 4TYZA 3FM8C 2YSZA 3SNHA 4HAVB 4HB3B 4ZRKA 3ML4A 3ZVRA 2I5FA 2GUMA 3KRXA 3FVCA 2NMBA 2NZ8B 3TFMA 2ELBA 1U2BA 2P0DA 2FJLA 1KZ7A 3MDBC 3AJ4A 4YONA 1TQZA 1AQCA 4A6FB 1NU2A 1UEFA 2N23A 5C16A 2I5CA 1DDMA 1J0WA 1XODA 2K2UA 2J0KA 1PLSA 3U8ZA 1P6SA 1BAKA 1OMWA 1SGHA 1XD4A 2CY4A 1W1HA 1U29A 3SO6A 1W1GA 3ULBA 2KUPA 1MKEA 4CHMA 5I2SA 1MK9B 4CSQA 4KHBA 3P6AA 5J3YA 4HB0B 3A8QA 1XKEA 2ADZA 3D8EA 3GYPA 2UVMA 5LOPB 1EGXA 3TVVA 4H8SA 3FSSA 3P7ZA 4GMVA 1Z87A 2MFQA 1V5UA 4B6HA 2CY5A 3F5RA 2R2YA 2D9VA 2ZKMX 1ZC3B 2UZRA 1RRPB 1IRSA 4HHVA 3OANA 1X1FA 4KHAA 5DI9B 4F7HA 3LJUX 2YT0A 1V61A 5L81A 4L6EA 2AL6A 5I2MA 2YRYA 5IRSA 1UNQA 2DA0A 3HIEA 2EMTA 4PNKA 2AEHA 1MIZB 5LONB 1FOEA 2K00A 2KUQA 1GC7A 2RGNB 4DX8A 3HK0A 2KIGA 3IVFA 3AU5A 2MWNB 2COAA 1M7RA 3GYOA 2YT2A 3ODXA 5KQ4A 4K2OA 1V5PA 4OSNA 1WGQA 1W1DA 5C5BA 1M7EA 2VRWB 4IAPA 2GJYA 2P8VA 2D4QA 2Y8GA 5EFXA 4HDOA 4C0AA 4KVGB 4GMXB 4WSFA 1AWEA 1FAOA 1SHCA 3PSCA 4XWXA 2KCJA 2EJ8A 2D11A 1XR0B 2RVBB 1NTVA 4HAZB 3QIJA 2LULA 2YF0A 4HAXB 4WVFB 2DKPA 2YT1A 1EAZA 2DYQA 2QKMA 2H7EA 3ODOA 1WG7A 2R09A 4A6FA 3V5WA 5M4YB 3A58A 5JLJB 2YS1A 2P0FA 3G9WA 1FHOA 2HE7A 1XCGA 2JP2A 3DXDA 4Z2MB 1BTKA 3TW1A 2LOZA 5JP4A 2EC1A 1EF1A 2R0DA 4PQ0A 3QBVB 2DTCA 2COFA 5D3YA 1EVHA 4GPTB 3NWAA 4DXAB 2DHIA 2D9YA 4K81A 4CHJA 2I1KA 4MY6A 2D10A 4HATB 1B55A 1OQNA 4HSIA 2COCA 1Y5OA 1NTYA 2Q13A 1TXDA 3F0WA 4K17A 1V88A 2CODA 2ROVA 4HAUB 4A5KA 2Z59A 1H10A 4HB2B 3HQCA 2GCJA 1PFJA 2G35A 3RCPA 3PVUA 5FI0A 1KZGA 1WJ1A 4EKUA 5D27A 1BWNA 5KCVA 1QQGA 1OY2A 3MPXA 2K2JA 1WGUA 1X11A 3PP2A 4QJ5B 3PVWA 1QC6A 2Y7BA 4A6HA 4WJ7A 1ZYIA 1I2HA 4DIXA 3UZTA 3QWMA 1FB8A 1UPQA 2CRFA 5GOWB 2HTHB 1LB1A 3BINA 4L1RA 2M14A 4IFSA 5LG4B 1X1GA 4NSWA 2X18A 3PEGA 2Z0PA 2J0JA 2J59M 2DLWA 5CLQB 3VOQA 1DDVA 3NW8A 3CIKA 2M38A 5C79A 3VIAA 5J3QA 5C6RA 2YS5A 1TJ6A 1MIXA 3WYFB 4F7GA 5JHGA 2L1CA 5FI1A 1UNRA 2I1JA 3T06A 3U12A 4F7UP 3X23A 4DX90 1DBHA 3PG7A 2RUKB 2MKRA 2ZPYA 1U5EA 2D9WA 2GCLA 4NY0A 5D3VA 2J0MA 3KZ1A 1I7AA 4IOYX 2DX1A 4EJNA 4QJ4B 3N7CA 2P0HA 3D8FA 1MI1A 3O96A 3TCAA 2DHKA 2DX5A 1Q67A 3B77A 2GS0A 1J19A 1FGYA 1V89A 2YS3A 4CYEA 2FJUB 3SV1A 2Z0QA 1GG3A 1DYNA 2Y8FA 5D3XA 2RLOA 1N3HA 3DCXA 4HB4B 2ROZB 2D9XA 1GC6A 1K5GB 2OTXA 1LW3A 3DXCA 3M1IB 1U5GA 1U27A 1DROA
chains in the Genus database with same CATH topology
1K5DB 2W2XC 2IFSA 3ZDTA 3SYXA 1Y19B 5HE1A 5C5BB 2IYBA 4KAXB 2DYNA 1WVHA 4HAYB 2KGXB 5DHAB 5HE3A 4GN1A 1MK7B 4ZRJA 1ZM0A 3FEHA 4GZUA 1WJMA 4BBKA 1H4RA 2D2QA 5CLLB 5D3WA 1PMSA 3D8DA 2D9ZA 2LYDA 5HE0A 2BCJA 4TKNA 4MT7A 2W2WA 2DKQA 4Z2NA 2UZSA 5HE2A 4K2PA 4D0NB 2ELAA 3BJIA 1XX0A 1NI2A 1U5DA 3AU4A 3WA0A 4DBBA 2OQBA 5KQ1A 2VKIA 2Z0OA 2V76A 3SUZA 3NSUA 2YVCA 1DDWA 1V5MA 2EMSA 5JHHA 2E2XA 1ISNA 2PZ1A 3KSYA 2DN6A 2DHJA 4ZRIA 5DH9B 2L2IA 1ZC4B 4P7IA 4A6KA 1ZSQA 4KHBB 1UNPA 5J3TA 1RJ2A 3KY9A 4GXBA 3TO1A 4Y94A 3KRWA 3DXEA 2CAYA 4YL8A 4KHOA 1E5WA 4HDQA 1MAIA 2RSGA 3PVLA 2DFKA 1KI1B 1FGZA 1P5TA 4HAWB 3PZDA 2LG1A 3ULCA 2LOXA 3ODWA 3CXBB 1FHXA 3A98B 4EMOA 1X05A 5DHFB 4MK0A 5DIFB 1X86A 1ZVRA 1FHWA 2RNRB 2VSZA 2QKLA 2W2XD 3U7DA 2MDXA 3A8PA 1P3RA 2N0YA 1UPRA 3HW2B 2XQNM 1BTNA 1WI1A 1U5FA 2H7DA 1MPHA 2LKOA 4TYZA 3FM8C 2YSZA 3SNHA 4HAVB 4HB3B 4ZRKA 3ML4A 3ZVRA 2I5FA 3KRXA 2NMBA 2NZ8B 3TFMA 2ELBA 1U2BA 2P0DA 2FJLA 1KZ7A 3MDBC 3AJ4A 4YONA 1TQZA 1AQCA 4A6FB 1NU2A 1UEFA 2N23A 5C16A 2I5CA 1DDMA 1J0WA 1XODA 2K2UA 2J0KA 1PLSA 3U8ZA 1P6SA 1BAKA 1OMWA 1SGHA 1XD4A 2CY4A 1W1HA 1U29A 3SO6A 1W1GA 3ULBA 2KUPA 1MKEA 4CHMA 1MK9B 3P6AA 5J3YA 4HB0B 3A8QA 1XKEA 2ADZA 3D8EA 3GYPA 2UVMA 5LOPB 1EGXA 3TVVA 4H8SA 3FSSA 3P7ZA 4GMVA 1Z87A 2MFQA 1V5UA 4B6HA 2CY5A 3F5RA 2D9VA 1ZC3B 2UZRA 1RRPB 1IRSA 4HHVA 3OANA 1X1FA 4KHAA 5DI9B 4F7HA 3LJUX 2YT0A 1V61A 5L81A 4L6EA 2AL6A 2YRYA 1UNQA 2DA0A 2EMTA 4PNKA 2AEHA 1MIZB 5LONB 1FOEA 2K00A 1GC7A 2RGNB 4DX8A 3HK0A 3IVFA 3AU5A 2MWNB 2COAA 1M7RA 3GYOA 3ODXA 5KQ4A 4K2OA 1V5PA 1WGQA 1W1DA 5C5BA 1M7EA 2VRWB 4IAPA 2GJYA 2P8VA 2D4QA 2Y8GA 5EFXA 4HDOA 4C0AA 4KVGB 4GMXB 4WSFA 1AWEA 1FAOA 1SHCA 3PSCA 4XWXA 2KCJA 2EJ8A 2D11A 1XR0B 2RVBB 1NTVA 4HAZB 3QIJA 2LULA 2YF0A 4HAXB 4WVFB 2DKPA 2YT1A 1EAZA 2DYQA 2QKMA 2H7EA 3ODOA 1WG7A 2R09A 4A6FA 3V5WA 5JLJB 2YS1A 2P0FA 3G9WA 1FHOA 2HE7A 1XCGA 2JP2A 3DXDA 4Z2MB 1BTKA 3TW1A 2LOZA 5JP4A 2EC1A 1EF1A 2R0DA 4PQ0A 3QBVB 2DTCA 2COFA 5D3YA 1EVHA 4GPTB 4DXAB 2DHIA 2D9YA 4K81A 4CHJA 2I1KA 4MY6A 2D10A 4HATB 1B55A 1OQNA 2COCA 1Y5OA 1NTYA 2Q13A 1TXDA 3F0WA 4K17A 1V88A 2CODA 2ROVA 4HAUB 4A5KA 1H10A 4HB2B 3HQCA 2GCJA 1PFJA 2G35A 3RCPA 3PVUA 5FI0A 1KZGA 1WJ1A 4EKUA 5D27A 1BWNA 5KCVA 1QQGA 1OY2A 3MPXA 2K2JA 1WGUA 1X11A 3PP2A 3PVWA 1QC6A 2Y7BA 4A6HA 4WJ7A 1I2HA 3UZTA 3QWMA 1FB8A 1UPQA 2CRFA 5GOWB 2HTHB 1LB1A 3BINA 2M14A 4IFSA 1X1GA 4NSWA 2X18A 3PEGA 2Z0PA 2J0JA 2J59M 2DLWA 5CLQB 3VOQA 1DDVA 3CIKA 2M38A 5C79A 3VIAA 5J3QA 5C6RA 2YS5A 1TJ6A 1MIXA 3WYFB 4F7GA 5JHGA 2L1CA 5FI1A 1UNRA 2I1JA 3T06A 4F7UP 3X23A 4DX90 1DBHA 3PG7A 2RUKB 2MKRA 2ZPYA 1U5EA 2D9WA 2GCLA 4NY0A 5D3VA 2J0MA 3KZ1A 1I7AA 4IOYX 2DX1A 4EJNA 3N7CA 2P0HA 3D8FA 3O96A 3TCAA 2DHKA 2DX5A 1Q67A 2GS0A 1J19A 1FGYA 1V89A 2YS3A 4CYEA 3SV1A 2Z0QA 1GG3A 1DYNA 2Y8FA 5D3XA 2RLOA 1N3HA 4HB4B 2ROZB 2D9XA 1GC6A 1K5GB 2OTXA 1LW3A 3DXCA 3M1IB 1U5GA 1U27A 1DROA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K5D B;  2W2X C;  2IFS A;  3ZDT A;  3SYX A;  1Y19 B;  5HE1 A;  5C5B B;  2IYB A;  4KAX B;  2DYN A;  1WVH A;  4HAY B;  2KGX B;  5DHA B;  5HE3 A;  4GN1 A;  1MK7 B;  4ZRJ A;  1ZM0 A;  3FEH A;  4GZU A;  1WJM A;  4BBK A;  1H4R A;  2D2Q A;  5CLL B;  5D3W A;  1PMS A;  3D8D A;  2D9Z A;  2LYD A;  5HE0 A;  2BCJ A;  4TKN A;  4MT7 A;  2W2W A;  2DKQ A;  4Z2N A;  2UZS A;  5HE2 A;  4K2P A;  4D0N B;  2ELA A;  3BJI A;  1XX0 A;  1NI2 A;  1U5D A;  3AU4 A;  3WA0 A;  4DBB A;  2OQB A;  5KQ1 A;  2VKI A;  2Z0O A;  2V76 A;  3SUZ A;  3NSU A;  2YVC A;  1DDW A;  1V5M A;  2EMS A;  5JHH A;  2E2X A;  1ISN A;  2PZ1 A;  3KSY A;  2DN6 A;  2DHJ A;  4ZRI A;  5DH9 B;  2L2I A;  1ZC4 B;  4P7I A;  4A6K A;  1ZSQ A;  4KHB B;  1UNP A;  5J3T A;  1RJ2 A;  3KY9 A;  4GXB A;  3TO1 A;  4Y94 A;  3KRW A;  3DXE A;  2CAY A;  4YL8 A;  4KHO A;  1E5W A;  4HDQ A;  1MAI A;  2RSG A;  3PVL A;  2DFK A;  1KI1 B;  1FGZ A;  1P5T A;  4HAW B;  3PZD A;  2LG1 A;  3ULC A;  2LOX A;  3ODW A;  3CXB B;  1FHX A;  3A98 B;  4EMO A;  1X05 A;  5DHF B;  4MK0 A;  5DIF B;  1X86 A;  1ZVR A;  1FHW A;  2RNR B;  2VSZ A;  2QKL A;  2W2X D;  3U7D A;  2MDX A;  3A8P A;  1P3R A;  2N0Y A;  1UPR A;  3HW2 B;  2XQN M;  1BTN A;  1WI1 A;  1U5F A;  2H7D A;  1MPH A;  2LKO A;  4TYZ A;  3FM8 C;  2YSZ A;  3SNH A;  4HAV B;  4HB3 B;  4ZRK A;  3ML4 A;  3ZVR A;  2I5F A;  3KRX A;  2NMB A;  2NZ8 B;  3TFM A;  2ELB A;  1U2B A;  2P0D A;  2FJL A;  1KZ7 A;  3MDB C;  3AJ4 A;  4YON A;  1TQZ A;  1AQC A;  4A6F B;  1NU2 A;  1UEF A;  2N23 A;  5C16 A;  2I5C A;  1DDM A;  1J0W A;  1XOD A;  2K2U A;  2J0K A;  1PLS A;  3U8Z A;  1P6S A;  1BAK A;  1OMW A;  1SGH A;  1XD4 A;  2CY4 A;  1W1H A;  1U29 A;  3SO6 A;  1W1G A;  3ULB A;  2KUP A;  1MKE A;  4CHM A;  1MK9 B;  3P6A A;  5J3Y A;  4HB0 B;  3A8Q A;  1XKE A;  2ADZ A;  3D8E A;  3GYP A;  2UVM A;  5LOP B;  1EGX A;  3TVV A;  4H8S A;  3FSS A;  3P7Z A;  4GMV A;  1Z87 A;  2MFQ A;  1V5U A;  4B6H A;  2CY5 A;  3F5R A;  2D9V A;  1ZC3 B;  2UZR A;  1RRP B;  1IRS A;  4HHV A;  3OAN A;  1X1F A;  4KHA A;  5DI9 B;  4F7H A;  3LJU X;  2YT0 A;  1V61 A;  5L81 A;  4L6E A;  2AL6 A;  2YRY A;  1UNQ A;  2DA0 A;  2EMT A;  4PNK A;  2AEH A;  1MIZ B;  5LON B;  1FOE A;  2K00 A;  1GC7 A;  2RGN B;  4DX8 A;  3HK0 A;  3IVF A;  3AU5 A;  2MWN B;  2COA A;  1M7R A;  3GYO A;  3ODX A;  5KQ4 A;  4K2O A;  1V5P A;  1WGQ A;  1W1D A;  5C5B A;  1M7E A;  2VRW B;  4IAP A;  2GJY A;  2P8V A;  2D4Q A;  2Y8G A;  5EFX A;  4HDO A;  4C0A A;  4KVG B;  4GMX B;  4WSF A;  1AWE A;  1FAO A;  1SHC A;  3PSC A;  4XWX A;  2KCJ A;  2EJ8 A;  2D11 A;  1XR0 B;  2RVB B;  1NTV A;  4HAZ B;  3QIJ A;  2LUL A;  2YF0 A;  4HAX B;  4WVF B;  2DKP A;  2YT1 A;  1EAZ A;  2DYQ A;  2QKM A;  2H7E A;  3ODO A;  1WG7 A;  2R09 A;  4A6F A;  3V5W A;  5JLJ B;  2YS1 A;  2P0F A;  3G9W A;  1FHO A;  2HE7 A;  1XCG A;  2JP2 A;  3DXD A;  4Z2M B;  1BTK A;  3TW1 A;  2LOZ A;  5JP4 A;  2EC1 A;  1EF1 A;  2R0D A;  4PQ0 A;  3QBV B;  2DTC A;  2COF A;  5D3Y A;  1EVH A;  4GPT B;  4DXA B;  2DHI A;  2D9Y A;  4K81 A;  4CHJ A;  2I1K A;  4MY6 A;  2D10 A;  4HAT B;  1B55 A;  1OQN A;  2COC A;  1Y5O A;  1NTY A;  2Q13 A;  1TXD A;  3F0W A;  4K17 A;  1V88 A;  2COD A;  2ROV A;  4HAU B;  4A5K A;  1H10 A;  4HB2 B;  3HQC A;  2GCJ A;  1PFJ A;  2G35 A;  3RCP A;  3PVU A;  5FI0 A;  1KZG A;  1WJ1 A;  4EKU A;  5D27 A;  1BWN A;  5KCV A;  1QQG A;  1OY2 A;  3MPX A;  2K2J A;  1WGU A;  1X11 A;  3PP2 A;  3PVW A;  1QC6 A;  2Y7B A;  4A6H A;  4WJ7 A;  1I2H A;  3UZT A;  3QWM A;  1FB8 A;  1UPQ A;  2CRF A;  5GOW B;  2HTH B;  1LB1 A;  3BIN A;  2M14 A;  4IFS A;  1X1G A;  4NSW A;  2X18 A;  3PEG A;  2Z0P A;  2J0J A;  2J59 M;  2DLW A;  5CLQ B;  3VOQ A;  1DDV A;  3CIK A;  2M38 A;  5C79 A;  3VIA A;  5J3Q A;  5C6R A;  2YS5 A;  1TJ6 A;  1MIX A;  3WYF B;  4F7G A;  5JHG A;  2L1C A;  5FI1 A;  1UNR A;  2I1J A;  3T06 A;  4F7U P;  3X23 A;  4DX9 0;  1DBH A;  3PG7 A;  2RUK B;  2MKR A;  2ZPY A;  1U5E A;  2D9W A;  2GCL A;  4NY0 A;  5D3V A;  2J0M A;  3KZ1 A;  1I7A A;  4IOY X;  2DX1 A;  4EJN A;  3N7C A;  2P0H A;  3D8F A;  3O96 A;  3TCA A;  2DHK A;  2DX5 A;  1Q67 A;  2GS0 A;  1J19 A;  1FGY A;  1V89 A;  2YS3 A;  4CYE A;  3SV1 A;  2Z0Q A;  1GG3 A;  1DYN A;  2Y8F A;  5D3X A;  2RLO A;  1N3H A;  4HB4 B;  2ROZ B;  2D9X A;  1GC6 A;  1K5G B;  2OTX A;  1LW3 A;  3DXC A;  3M1I B;  1U5G A;  1U27 A;  1DRO A; 
#chains in the Genus database with same CATH topology
 1K5D B;  2W2X C;  2IFS A;  3ZDT A;  2Z13 A;  3SYX A;  1Y19 B;  5HE1 A;  5C5B B;  2IYB A;  4KAX B;  2DYN A;  1WVH A;  4HAY B;  4D6W A;  2KGX B;  5DHA B;  4QJ3 B;  5HE3 A;  4GN1 A;  1MK7 B;  4ZRJ A;  1ZM0 A;  3FEH A;  4GZU A;  4OT1 A;  1WJM A;  4BBK A;  1H4R A;  2D2Q A;  5CLL B;  2NBV A;  5D3W A;  2KIE A;  1PMS A;  3D8D A;  2D9Z A;  2RRF A;  2LYD A;  5HE0 A;  2BCJ A;  4TKN A;  4MT7 A;  2W2W A;  2DKQ A;  4Z2N A;  2UZS A;  5HE2 A;  4K2P A;  4D0N B;  3OHM B;  2ELA A;  3BJI A;  1XX0 A;  1T77 A;  2Z14 A;  1NI2 A;  1U5D A;  3AU4 A;  3WA0 A;  4DBB A;  2OQB A;  5KQ1 A;  2VKI A;  2Z0O A;  2V76 A;  3SUZ A;  3NSU A;  2YVC A;  3NWD A;  1DDW A;  1V5M A;  2EMS A;  5JHH A;  2E2X A;  1ISN A;  2PZ1 A;  4GNK B;  3KSY A;  2DN6 A;  2DHJ A;  4ZRI A;  5DH9 B;  2L2I A;  1ZC4 B;  4P7I A;  4QXA B;  4A6K A;  1ZSQ A;  3NWF A;  4KHB B;  1UNP A;  5J3T A;  1RJ2 A;  3KY9 A;  4GXB A;  3TO1 A;  4Y94 A;  3KRW A;  3DXE A;  2CAY A;  4YL8 A;  4KHO A;  1E5W A;  4HDQ A;  1MAI A;  2RSG A;  3PVL A;  2DFK A;  1KI1 B;  1FGZ A;  1P5T A;  4HAW B;  3PZD A;  2LG1 A;  3ULC A;  2LOX A;  2KR0 A;  3ODW A;  3CXB B;  1FHX A;  3A98 B;  4EMO A;  1X05 A;  5DHF B;  4MK0 A;  5DIF B;  1X86 A;  1ZVR A;  4GOU A;  1FHW A;  2K8E A;  2W2X D;  2RNR B;  2Z4D A;  2VSZ A;  2K49 A;  2QKL A;  2MDX A;  3U7D A;  3A8P A;  1P3R A;  2N0Y A;  1UPR A;  3HW2 B;  2XQN M;  1BTN A;  1WI1 A;  1U5F A;  2H7D A;  1MPH A;  3HSA A;  2LKO A;  4TYZ A;  3FM8 C;  2YSZ A;  3SNH A;  4HAV B;  4HB3 B;  4ZRK A;  3ML4 A;  3ZVR A;  2I5F A;  2GUM A;  3KRX A;  3FVC A;  2NMB A;  2NZ8 B;  3TFM A;  2ELB A;  1U2B A;  2P0D A;  2FJL A;  1KZ7 A;  3MDB C;  3AJ4 A;  4YON A;  1TQZ A;  1AQC A;  4A6F B;  1NU2 A;  1UEF A;  2N23 A;  5C16 A;  2I5C A;  1DDM A;  1J0W A;  1XOD A;  2K2U A;  2J0K A;  1PLS A;  3U8Z A;  1P6S A;  1BAK A;  1OMW A;  1SGH A;  1XD4 A;  2CY4 A;  1W1H A;  1U29 A;  3SO6 A;  1W1G A;  3ULB A;  2KUP A;  1MKE A;  4CHM A;  5I2S A;  1MK9 B;  4CSQ A;  4KHB A;  3P6A A;  5J3Y A;  4HB0 B;  3A8Q A;  1XKE A;  2ADZ A;  3D8E A;  3GYP A;  2UVM A;  5LOP B;  1EGX A;  3TVV A;  4H8S A;  3FSS A;  3P7Z A;  4GMV A;  1Z87 A;  2MFQ A;  1V5U A;  4B6H A;  2CY5 A;  3F5R A;  2R2Y A;  2D9V A;  2ZKM X;  1ZC3 B;  2UZR A;  1RRP B;  1IRS A;  4HHV A;  3OAN A;  1X1F A;  4KHA A;  5DI9 B;  4F7H A;  3LJU X;  2YT0 A;  1V61 A;  5L81 A;  4L6E A;  2AL6 A;  5I2M A;  2YRY A;  5IRS A;  1UNQ A;  2DA0 A;  3HIE A;  2EMT A;  4PNK A;  2AEH A;  1MIZ B;  5LON B;  1FOE A;  2K00 A;  2KUQ A;  1GC7 A;  2RGN B;  4DX8 A;  3HK0 A;  2KIG A;  3IVF A;  3AU5 A;  2MWN B;  2COA A;  1M7R A;  3GYO A;  2YT2 A;  3ODX A;  5KQ4 A;  4K2O A;  1V5P A;  4OSN A;  1WGQ A;  1W1D A;  5C5B A;  1M7E A;  2VRW B;  4IAP A;  2GJY A;  2P8V A;  2D4Q A;  2Y8G A;  5EFX A;  4HDO A;  4C0A A;  4KVG B;  4GMX B;  4WSF A;  1AWE A;  1FAO A;  1SHC A;  3PSC A;  4XWX A;  2KCJ A;  2EJ8 A;  2D11 A;  1XR0 B;  2RVB B;  1NTV A;  4HAZ B;  3QIJ A;  2LUL A;  2YF0 A;  4HAX B;  4WVF B;  2DKP A;  2YT1 A;  1EAZ A;  2DYQ A;  2QKM A;  2H7E A;  3ODO A;  1WG7 A;  2R09 A;  4A6F A;  3V5W A;  5M4Y B;  3A58 A;  5JLJ B;  2YS1 A;  2P0F A;  3G9W A;  1FHO A;  2HE7 A;  1XCG A;  2JP2 A;  3DXD A;  4Z2M B;  1BTK A;  3TW1 A;  2LOZ A;  5JP4 A;  2EC1 A;  1EF1 A;  2R0D A;  4PQ0 A;  3QBV B;  2DTC A;  2COF A;  5D3Y A;  1EVH A;  4GPT B;  3NWA A;  4DXA B;  2DHI A;  2D9Y A;  4K81 A;  4CHJ A;  2I1K A;  4MY6 A;  2D10 A;  4HAT B;  1B55 A;  1OQN A;  4HSI A;  2COC A;  1Y5O A;  1NTY A;  2Q13 A;  1TXD A;  3F0W A;  4K17 A;  1V88 A;  2COD A;  2ROV A;  4HAU B;  4A5K A;  2Z59 A;  1H10 A;  4HB2 B;  3HQC A;  2GCJ A;  1PFJ A;  2G35 A;  3RCP A;  3PVU A;  5FI0 A;  1KZG A;  1WJ1 A;  4EKU A;  5D27 A;  1BWN A;  5KCV A;  1QQG A;  1OY2 A;  3MPX A;  2K2J A;  1WGU A;  1X11 A;  3PP2 A;  4QJ5 B;  3PVW A;  1QC6 A;  2Y7B A;  4A6H A;  4WJ7 A;  1ZYI A;  1I2H A;  4DIX A;  3UZT A;  3QWM A;  1FB8 A;  1UPQ A;  2CRF A;  5GOW B;  2HTH B;  1LB1 A;  3BIN A;  4L1R A;  2M14 A;  4IFS A;  5LG4 B;  1X1G A;  4NSW A;  2X18 A;  3PEG A;  2Z0P A;  2J0J A;  2J59 M;  2DLW A;  5CLQ B;  3VOQ A;  1DDV A;  3NW8 A;  3CIK A;  2M38 A;  5C79 A;  3VIA A;  5J3Q A;  5C6R A;  2YS5 A;  1TJ6 A;  1MIX A;  3WYF B;  4F7G A;  5JHG A;  2L1C A;  5FI1 A;  1UNR A;  2I1J A;  3T06 A;  3U12 A;  4F7U P;  3X23 A;  4DX9 0;  1DBH A;  3PG7 A;  2RUK B;  2MKR A;  2ZPY A;  1U5E A;  2D9W A;  2GCL A;  4NY0 A;  5D3V A;  2J0M A;  3KZ1 A;  1I7A A;  4IOY X;  2DX1 A;  4EJN A;  4QJ4 B;  3N7C A;  2P0H A;  3D8F A;  1MI1 A;  3O96 A;  3TCA A;  2DHK A;  2DX5 A;  1Q67 A;  3B77 A;  2GS0 A;  1J19 A;  1FGY A;  1V89 A;  2YS3 A;  4CYE A;  2FJU B;  3SV1 A;  2Z0Q A;  1GG3 A;  1DYN A;  2Y8F A;  5D3X A;  2RLO A;  1N3H A;  3DCX A;  4HB4 B;  2ROZ B;  2D9X A;  1GC6 A;  1K5G B;  2OTX A;  1LW3 A;  3DXC A;  3M1I B;  1U5G A;  1U27 A;  1DRO A; 
#chains in the Genus database with same CATH homology
 1K5D B;  2W2X C;  2IFS A;  3ZDT A;  3SYX A;  1Y19 B;  5HE1 A;  5C5B B;  2IYB A;  4KAX B;  2DYN A;  1WVH A;  4HAY B;  2KGX B;  5DHA B;  5HE3 A;  4GN1 A;  1MK7 B;  4ZRJ A;  1ZM0 A;  3FEH A;  4GZU A;  1WJM A;  4BBK A;  1H4R A;  2D2Q A;  5CLL B;  5D3W A;  1PMS A;  3D8D A;  2D9Z A;  2LYD A;  5HE0 A;  2BCJ A;  4TKN A;  4MT7 A;  2W2W A;  2DKQ A;  4Z2N A;  2UZS A;  5HE2 A;  4K2P A;  4D0N B;  2ELA A;  3BJI A;  1XX0 A;  1NI2 A;  1U5D A;  3AU4 A;  3WA0 A;  4DBB A;  2OQB A;  5KQ1 A;  2VKI A;  2Z0O A;  2V76 A;  3SUZ A;  3NSU A;  2YVC A;  1DDW A;  1V5M A;  2EMS A;  5JHH A;  2E2X A;  1ISN A;  2PZ1 A;  3KSY A;  2DN6 A;  2DHJ A;  4ZRI A;  5DH9 B;  2L2I A;  1ZC4 B;  4P7I A;  4A6K A;  1ZSQ A;  4KHB B;  1UNP A;  5J3T A;  1RJ2 A;  3KY9 A;  4GXB A;  3TO1 A;  4Y94 A;  3KRW A;  3DXE A;  2CAY A;  4YL8 A;  4KHO A;  1E5W A;  4HDQ A;  1MAI A;  2RSG A;  3PVL A;  2DFK A;  1KI1 B;  1FGZ A;  1P5T A;  4HAW B;  3PZD A;  2LG1 A;  3ULC A;  2LOX A;  3ODW A;  3CXB B;  1FHX A;  3A98 B;  4EMO A;  1X05 A;  5DHF B;  4MK0 A;  5DIF B;  1X86 A;  1ZVR A;  1FHW A;  2RNR B;  2VSZ A;  2QKL A;  2W2X D;  3U7D A;  2MDX A;  3A8P A;  1P3R A;  2N0Y A;  1UPR A;  3HW2 B;  2XQN M;  1BTN A;  1WI1 A;  1U5F A;  2H7D A;  1MPH A;  2LKO A;  4TYZ A;  3FM8 C;  2YSZ A;  3SNH A;  4HAV B;  4HB3 B;  4ZRK A;  3ML4 A;  3ZVR A;  2I5F A;  3KRX A;  2NMB A;  2NZ8 B;  3TFM A;  2ELB A;  1U2B A;  2P0D A;  2FJL A;  1KZ7 A;  3MDB C;  3AJ4 A;  4YON A;  1TQZ A;  1AQC A;  4A6F B;  1NU2 A;  1UEF A;  2N23 A;  5C16 A;  2I5C A;  1DDM A;  1J0W A;  1XOD A;  2K2U A;  2J0K A;  1PLS A;  3U8Z A;  1P6S A;  1BAK A;  1OMW A;  1SGH A;  1XD4 A;  2CY4 A;  1W1H A;  1U29 A;  3SO6 A;  1W1G A;  3ULB A;  2KUP A;  1MKE A;  4CHM A;  1MK9 B;  3P6A A;  5J3Y A;  4HB0 B;  3A8Q A;  1XKE A;  2ADZ A;  3D8E A;  3GYP A;  2UVM A;  5LOP B;  1EGX A;  3TVV A;  4H8S A;  3FSS A;  3P7Z A;  4GMV A;  1Z87 A;  2MFQ A;  1V5U A;  4B6H A;  2CY5 A;  3F5R A;  2D9V A;  1ZC3 B;  2UZR A;  1RRP B;  1IRS A;  4HHV A;  3OAN A;  1X1F A;  4KHA A;  5DI9 B;  4F7H A;  3LJU X;  2YT0 A;  1V61 A;  5L81 A;  4L6E A;  2AL6 A;  2YRY A;  1UNQ A;  2DA0 A;  2EMT A;  4PNK A;  2AEH A;  1MIZ B;  5LON B;  1FOE A;  2K00 A;  1GC7 A;  2RGN B;  4DX8 A;  3HK0 A;  3IVF A;  3AU5 A;  2MWN B;  2COA A;  1M7R A;  3GYO A;  3ODX A;  5KQ4 A;  4K2O A;  1V5P A;  1WGQ A;  1W1D A;  5C5B A;  1M7E A;  2VRW B;  4IAP A;  2GJY A;  2P8V A;  2D4Q A;  2Y8G A;  5EFX A;  4HDO A;  4C0A A;  4KVG B;  4GMX B;  4WSF A;  1AWE A;  1FAO A;  1SHC A;  3PSC A;  4XWX A;  2KCJ A;  2EJ8 A;  2D11 A;  1XR0 B;  2RVB B;  1NTV A;  4HAZ B;  3QIJ A;  2LUL A;  2YF0 A;  4HAX B;  4WVF B;  2DKP A;  2YT1 A;  1EAZ A;  2DYQ A;  2QKM A;  2H7E A;  3ODO A;  1WG7 A;  2R09 A;  4A6F A;  3V5W A;  5JLJ B;  2YS1 A;  2P0F A;  3G9W A;  1FHO A;  2HE7 A;  1XCG A;  2JP2 A;  3DXD A;  4Z2M B;  1BTK A;  3TW1 A;  2LOZ A;  5JP4 A;  2EC1 A;  1EF1 A;  2R0D A;  4PQ0 A;  3QBV B;  2DTC A;  2COF A;  5D3Y A;  1EVH A;  4GPT B;  4DXA B;  2DHI A;  2D9Y A;  4K81 A;  4CHJ A;  2I1K A;  4MY6 A;  2D10 A;  4HAT B;  1B55 A;  1OQN A;  2COC A;  1Y5O A;  1NTY A;  2Q13 A;  1TXD A;  3F0W A;  4K17 A;  1V88 A;  2COD A;  2ROV A;  4HAU B;  4A5K A;  1H10 A;  4HB2 B;  3HQC A;  2GCJ A;  1PFJ A;  2G35 A;  3RCP A;  3PVU A;  5FI0 A;  1KZG A;  1WJ1 A;  4EKU A;  5D27 A;  1BWN A;  5KCV A;  1QQG A;  1OY2 A;  3MPX A;  2K2J A;  1WGU A;  1X11 A;  3PP2 A;  3PVW A;  1QC6 A;  2Y7B A;  4A6H A;  4WJ7 A;  1I2H A;  3UZT A;  3QWM A;  1FB8 A;  1UPQ A;  2CRF A;  5GOW B;  2HTH B;  1LB1 A;  3BIN A;  2M14 A;  4IFS A;  1X1G A;  4NSW A;  2X18 A;  3PEG A;  2Z0P A;  2J0J A;  2J59 M;  2DLW A;  5CLQ B;  3VOQ A;  1DDV A;  3CIK A;  2M38 A;  5C79 A;  3VIA A;  5J3Q A;  5C6R A;  2YS5 A;  1TJ6 A;  1MIX A;  3WYF B;  4F7G A;  5JHG A;  2L1C A;  5FI1 A;  1UNR A;  2I1J A;  3T06 A;  4F7U P;  3X23 A;  4DX9 0;  1DBH A;  3PG7 A;  2RUK B;  2MKR A;  2ZPY A;  1U5E A;  2D9W A;  2GCL A;  4NY0 A;  5D3V A;  2J0M A;  3KZ1 A;  1I7A A;  4IOY X;  2DX1 A;  4EJN A;  3N7C A;  2P0H A;  3D8F A;  3O96 A;  3TCA A;  2DHK A;  2DX5 A;  1Q67 A;  2GS0 A;  1J19 A;  1FGY A;  1V89 A;  2YS3 A;  4CYE A;  3SV1 A;  2Z0Q A;  1GG3 A;  1DYN A;  2Y8F A;  5D3X A;  2RLO A;  1N3H A;  4HB4 B;  2ROZ B;  2D9X A;  1GC6 A;  1K5G B;  2OTX A;  1LW3 A;  3DXC A;  3M1I B;  1U5G A;  1U27 A;  1DRO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...