1WVHA

Crystal structure of tensin1 ptb domain
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
133
structure length
132
Chain Sequence
AACNVLFINSVEMESLTGPQAISKAVAETLVADPTPTATIVHFKVSAQGITLTDNQRKLFFRRHYPLNTVTFCDLDPQERKWTKTDGSGPAKLFGFVARKGSTTDNVCHLFAELDPDQPAAAIVNFVSRVML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Cell adhesion
molecule keywords Tensin
publication title Structure of the PTB domain of tensin1 and a model for its recruitment to fibrillar adhesions.
pubmed doi rcsb
source organism Gallus gallus
total genus 25
structure length 132
sequence length 133
ec nomenclature
pdb deposition date 2004-12-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1wvhA00
2LG1A 2KCJA 1ZC4B 2AEHA 5J3TA 4DX8A 1X86A 1X1FA 2YS3A 3PP2A 2V76A 4Z2MB 2D9YA 2HE7A 3WA0A 4K17A 4Z2NA 1UNRA 1E5WA 4GMVA 1X1GA 3PVWA 4C0AA 3V5WA 1UEFA 2COFA 3T06A 1MKEA 1PMSA 2RVBB 4HB2B 2MDXA 3TVVA 4HDOA 1BWNA 5FI1A 2Y8GA 1XODA 3LJUX 1NU2A 1V5MA 2J0JA 1DROA 4HB4B 2L2IA 2D9XA 2X18A 1TXDA 2EC1A 2LOZA 1ZC3B 3GYPA 1J19A 2W2WA 2P0DA 2YS5A 3U8ZA 4KHAA 2J0MA 2E2XA 2YT1A 2ROZB 2D9VA 2DX1A 3AU5A 2LOXA 1GC7A 2ROVA 2DHIA 2DHKA 2EMSA 1Z87A 3DXCA 1GG3A 2COAA 3A8QA 1U5GA 3SV1A 2UZSA 3HW2B 4A6KA 4WJ7A 4MT7A 2DHJA 1WGUA 4GPTB 1EVHA 1X11A 2IFSA 1UNQA 5LOPB 1OQNA 5KQ4A 1NTYA 2W2XD 3UZTA 4K2OA 1FAOA 3KRXA 3SO6A 2RGNB 4CYEA 2RSGA 5JHHA 1QQGA 3MDBC 5DH9B 1PLSA 1WVHA 3VOQA 2D10A 2QKMA 3A8PA 3FEHA 1H10A 5JHGA 2RUKB 2DTCA 3AJ4A 3FM8C 4HHVA 4D0NB 1P5TA 5J3YA 1WGQA 4K2PA 2RNRB 2KGXB 2DYNA 2P0HA 2CY4A 1K5GB 1FB8A 4YL8A 5C5BB 2P8VA 3TW1A 2NZ8B 2W2XC 5C16A 2D9ZA 5D3VA 5DHFB 2DFKA 1ZSQA 1B55A 1W1HA 1M7EA 1UPQA 3G9WA 1DDWA 4EMOA 2D9WA 3U7DA 2GCJA 1J0WA 3NSUA 1DBHA 2J59M 4HDQA 5DHAB 5C6RA 3BINA 4XWXA 1BTNA 4HAVB 4CHJA 5DI9B 2YS1A 3RCPA 4A6FB 1LW3A 3SYXA 5HE0A 2DLWA 3GYOA 2K2UA 2ELAA 3OANA 2UVMA 4Y94A 4GZUA 2M38A 1H4RA 1X05A 4NSWA 2YT0A 2VKIA 1MK7B 2VSZA 1ZM0A 4EKUA 2CAYA 1DDMA 1LB1A 4ZRIA 2RLOA 3P7ZA 1IRSA 1MPHA 1SGHA 2FJLA 4K81A 2JP2A 1W1DA 3F5RA 1EAZA 3IVFA 5C5BA 1U5DA 2IYBA 5GOWB 2I5FA 2R0DA 2Z0QA 4A6HA 1UNPA 2I5CA 2N23A 2XQNM 3ULBA 1XCGA 5HE1A 2DN6A 2Y7BA 2ZPYA 1MAIA 1FOEA 3QBVB 4L6EA 2R09A 1FHXA 2G35A 3SUZA 1AQCA 1I7AA 1TJ6A 2OTXA 1RJ2A 3BJIA 2ADZA 3KRWA 3ZDTA 4BBKA 3PSCA 3D8EA 1XKEA 3PZDA 2VRWB 4KAXB 5DIFB 2Y8FA 4HAXB 3WYFB 1P6SA 4A5KA 2EMTA 5J3QA 2LKOA 1WJMA 4ZRJA 2NMBA 2Z0PA 3DXEA 4TKNA 1FHWA 2D2QA 4A6FA 3CXBB 3TCAA 4WSFA 2EJ8A 2H7DA 4DX90 1MIZB 2GJYA 2DKQA 2HTHB 5KCVA 1ISNA 2UZRA 2CY5A 1XX0A 4HB0B 1KI1B 1M7RA 3PVUA 5D27A 4MY6A 5D3YA 4GMXB 4KHOA 2BCJA 2CODA 4HB3B 1EGXA 3PG7A 3PVLA 4F7UP 3F0WA 4EJNA 1U5FA 5KQ1A 3ULCA 4YONA 5CLQB 3ODOA 1RRPB 2LULA 3KY9A 5FI0A 1FHOA 3DXDA 2YVCA 5LONB 4HAWB 2QKLA 3D8FA 2YF0A 1WI1A 4B6HA 3N7CA 1TQZA 3FSSA 2K00A 1XR0B 5D3XA 3VIAA 2COCA 3X23A 4HAYB 4PQ0A 1SHCA 3M1IB 2D4QA 3O96A 1N3HA 1U5EA 1WG7A 4HAZB 1WJ1A 4DBBA 1P3RA 3AU4A 5HE3A 5JP4A 1FGYA 4GXBA 1V89A 2PZ1A 4GN1A 3ODXA 3A98B 4IFSA 5CLLB 4PNKA 1KZGA 3ODWA 5JLJB 3P6AA 2KUPA 4IOYX 3SNHA 2MWNB 4DXAB 1FGZA 1PFJA 1NTVA 4TYZA 4F7GA 1U29A 2D11A 1V88A 2AL6A 2I1JA 2I1KA 4WVFB 2MFQA 1V5UA 2GS0A 1XD4A 4CHMA 3KZ1A 2GCLA 2DYQA 3KSYA 1Y19B 2M14A 1W1GA 4H8SA 1DYNA 1K5DB 4HATB 4NY0A 3HQCA 3QWMA 2J0KA 5D3WA 1Y5OA 2CRFA 2Q13A 3PEGA 5HE2A 1OY2A 1MIXA 3ZVRA 1BAKA 2MKRA 4KHBB 4ZRKA 1U2BA 2H7EA 2YRYA 2N0YA 1OMWA 4IAPA 1U27A 3QIJA 5EFXA 2LYDA 2L1CA 3MPXA 1I2HA 5L81A 1V61A 2P0FA 3CIKA 4MK0A 3D8DA 2DKPA 3TFMA 1V5PA 2Z0OA 1EF1A 1MK9B 1AWEA 1KZ7A 1BTKA 3TO1A 2DA0A 4F7HA 2ELBA 2K2JA 4HAUB 1GC6A 1DDVA 2YSZA 1QC6A 2OQBA 1NI2A 1UPRA 1Q67A 5C79A 2DX5A 3HK0A 4P7IA 4KVGB 3ML4A 1ZVRA
chains in the Genus database with same CATH superfamily
2LG1A 2KCJA 1ZC4B 2AEHA 5J3TA 4DX8A 1X86A 5I2SA 1X1FA 2YS3A 3PP2A 2V76A 4Z2MB 2D9YA 2HE7A 3WA0A 4K17A 4Z2NA 1UNRA 1E5WA 4GMVA 1X1GA 3PVWA 5LG4B 4C0AA 3V5WA 1UEFA 2COFA 3T06A 1MKEA 1PMSA 1T77A 2RVBB 4HB2B 2MDXA 3TVVA 4HDOA 1BWNA 5FI1A 2Y8GA 1XODA 3LJUX 1NU2A 1V5MA 2J0JA 1DROA 4HB4B 2L2IA 2D9XA 2X18A 1TXDA 2EC1A 2LOZA 1ZC3B 3GYPA 1J19A 2W2WA 2P0DA 2YS5A 3NWAA 3U8ZA 4KHAA 2J0MA 2E2XA 2YT1A 2ROZB 2D9VA 2DX1A 3AU5A 2LOXA 3NWDA 1GC7A 2ROVA 2DHIA 2DHKA 2EMSA 3FVCA 1Z87A 3DXCA 1GG3A 2COAA 3HIEA 3A8QA 1U5GA 3SV1A 2UZSA 3HW2B 4A6KA 3DCXA 4WJ7A 4MT7A 2DHJA 1WGUA 4GPTB 1EVHA 1X11A 2IFSA 1UNQA 5LOPB 1OQNA 5KQ4A 1NTYA 2W2XD 3UZTA 4K2OA 1FAOA 3KRXA 3SO6A 2RGNB 4CYEA 2RSGA 4D6WA 5JHHA 1QQGA 3MDBC 5DH9B 1PLSA 1WVHA 3VOQA 3NWFA 2D10A 2QKMA 3A8PA 3FEHA 1H10A 5JHGA 2RUKB 2DTCA 3AJ4A 3FM8C 4HHVA 4D0NB 1P5TA 3U12A 5J3YA 1WGQA 4K2PA 2RNRB 2KGXB 2DYNA 4QJ5B 2P0HA 2CY4A 1K5GB 1FB8A 4YL8A 5C5BB 2KIEA 2KUQA 4L1RA 2P8VA 3TW1A 2NZ8B 2W2XC 5C16A 2D9ZA 5D3VA 5DHFB 2DFKA 1ZSQA 1B55A 1W1HA 1M7EA 1UPQA 3G9WA 1DDWA 4EMOA 2D9WA 3U7DA 2GCJA 1J0WA 3NSUA 1DBHA 2J59M 1MI1A 4HDQA 5DHAB 5C6RA 3BINA 4XWXA 1BTNA 2K8EA 2NBVA 2FJUB 4HAVB 4CHJA 5DI9B 4QXAB 2YS1A 3RCPA 4A6FB 1LW3A 4OT1A 3SYXA 5HE0A 2DLWA 3GYOA 2K2UA 2ELAA 3OANA 2UVMA 4Y94A 4GZUA 2M38A 1H4RA 1X05A 4NSWA 2YT0A 2VKIA 1MK7B 2VSZA 2Z4DA 1ZM0A 4EKUA 2CAYA 2R2YA 1DDMA 1LB1A 4ZRIA 2RLOA 3P7ZA 1IRSA 1MPHA 1SGHA 2FJLA 4K81A 2JP2A 1W1DA 3F5RA 1EAZA 3IVFA 5C5BA 4DIXA 1U5DA 2IYBA 5GOWB 2I5FA 2R0DA 2Z0QA 4A6HA 3OHMB 1UNPA 2I5CA 2N23A 2XQNM 3ULBA 1XCGA 5HE1A 2DN6A 2Y7BA 2ZPYA 1MAIA 1FOEA 3QBVB 4L6EA 2R09A 1FHXA 2G35A 3SUZA 1AQCA 1I7AA 1TJ6A 3NW8A 3A58A 2OTXA 1RJ2A 3BJIA 2ADZA 3KRWA 3ZDTA 4BBKA 3PSCA 3D8EA 1XKEA 3PZDA 2VRWB 4KAXB 5DIFB 2Y8FA 4HAXB 3WYFB 1P6SA 4A5KA 2EMTA 5J3QA 2LKOA 2K49A 1WJMA 4ZRJA 2NMBA 2Z0PA 3DXEA 4TKNA 1FHWA 2D2QA 4GOUA 4A6FA 3CXBB 3TCAA 4WSFA 2EJ8A 2H7DA 2KIGA 1MIZB 4DX90 2GJYA 2DKQA 2HTHB 5KCVA 1ISNA 2UZRA 2CY5A 1XX0A 4HB0B 1KI1B 1M7RA 3PVUA 5D27A 4MY6A 5D3YA 4GMXB 4KHOA 2BCJA 4CSQA 2ZKMX 4GNKB 2CODA 4HB3B 1EGXA 3PG7A 2KR0A 3PVLA 4F7UP 3F0WA 4EJNA 1U5FA 5KQ1A 3ULCA 2Z14A 4YONA 5CLQB 3ODOA 1RRPB 2LULA 3KY9A 5FI0A 1FHOA 3DXDA 2YVCA 5LONB 4HAWB 2QKLA 3D8FA 2YF0A 1WI1A 4B6HA 4OSNA 3N7CA 4QJ3B 1TQZA 3FSSA 2K00A 1XR0B 5IRSA 5D3XA 3VIAA 2COCA 3X23A 4HAYB 4PQ0A 1SHCA 3M1IB 2D4QA 3O96A 1N3HA 1U5EA 1WG7A 4HAZB 2GUMA 1WJ1A 4DBBA 1P3RA 3AU4A 5HE3A 5JP4A 1FGYA 4GXBA 5M4YB 1V89A 2PZ1A 4GN1A 3ODXA 3A98B 2YT2A 4IFSA 4KHBA 5CLLB 4PNKA 1KZGA 3ODWA 3HSAA 5JLJB 3P6AA 2KUPA 4IOYX 3SNHA 2MWNB 4DXAB 1FGZA 1PFJA 1NTVA 4TYZA 4F7GA 1U29A 2D11A 1V88A 2AL6A 2I1JA 2I1KA 4WVFB 2MFQA 1V5UA 2GS0A 1XD4A 4CHMA 3KZ1A 2GCLA 2DYQA 3KSYA 1Y19B 2M14A 1W1GA 4H8SA 1DYNA 1K5DB 4HATB 4NY0A 3HQCA 3QWMA 2J0KA 5D3WA 1Y5OA 2CRFA 2Q13A 3PEGA 4HSIA 2Z13A 5HE2A 1OY2A 1MIXA 3ZVRA 1BAKA 2MKRA 4KHBB 4ZRKA 1U2BA 2H7EA 2YRYA 2N0YA 1OMWA 4IAPA 1U27A 3QIJA 2RRFA 5EFXA 2Z59A 2LYDA 2L1CA 3MPXA 1I2HA 5L81A 1V61A 2P0FA 3CIKA 4MK0A 3D8DA 2DKPA 3TFMA 1V5PA 2Z0OA 1EF1A 1MK9B 1ZYIA 1AWEA 1KZ7A 3B77A 1BTKA 3TO1A 2DA0A 4F7HA 2ELBA 2K2JA 4HAUB 4QJ4B 1GC6A 1DDVA 5I2MA 2YSZA 1QC6A 2OQBA 1NI2A 1UPRA 1Q67A 5C79A 2DX5A 3HK0A 4P7IA 4KVGB 3ML4A 1ZVRA
chains in the Genus database with same CATH topology
2LG1A 2KCJA 1ZC4B 2AEHA 5J3TA 4DX8A 1X86A 1X1FA 2YS3A 3PP2A 2V76A 4Z2MB 2D9YA 2HE7A 3WA0A 4K17A 4Z2NA 1UNRA 1E5WA 4GMVA 1X1GA 3PVWA 4C0AA 3V5WA 1UEFA 2COFA 3T06A 1MKEA 1PMSA 2RVBB 4HB2B 2MDXA 3TVVA 4HDOA 1BWNA 5FI1A 2Y8GA 1XODA 3LJUX 1NU2A 1V5MA 2J0JA 1DROA 4HB4B 2L2IA 2D9XA 2X18A 1TXDA 2EC1A 2LOZA 1ZC3B 3GYPA 1J19A 2W2WA 2P0DA 2YS5A 3U8ZA 4KHAA 2J0MA 2E2XA 2YT1A 2ROZB 2D9VA 2DX1A 3AU5A 2LOXA 1GC7A 2ROVA 2DHIA 2DHKA 2EMSA 1Z87A 3DXCA 1GG3A 2COAA 3A8QA 1U5GA 3SV1A 2UZSA 3HW2B 4A6KA 4WJ7A 4MT7A 2DHJA 1WGUA 4GPTB 1EVHA 1X11A 2IFSA 1UNQA 5LOPB 1OQNA 5KQ4A 1NTYA 2W2XD 3UZTA 4K2OA 1FAOA 3KRXA 3SO6A 2RGNB 4CYEA 2RSGA 5JHHA 1QQGA 3MDBC 5DH9B 1PLSA 1WVHA 3VOQA 2D10A 2QKMA 3A8PA 3FEHA 1H10A 5JHGA 2RUKB 2DTCA 3AJ4A 3FM8C 4HHVA 4D0NB 1P5TA 5J3YA 1WGQA 4K2PA 2RNRB 2KGXB 2DYNA 2P0HA 2CY4A 1K5GB 1FB8A 4YL8A 5C5BB 2P8VA 3TW1A 2NZ8B 2W2XC 5C16A 2D9ZA 5D3VA 5DHFB 2DFKA 1ZSQA 1B55A 1W1HA 1M7EA 1UPQA 3G9WA 1DDWA 4EMOA 2D9WA 3U7DA 2GCJA 1J0WA 3NSUA 1DBHA 2J59M 4HDQA 5DHAB 5C6RA 3BINA 4XWXA 1BTNA 4HAVB 4CHJA 5DI9B 2YS1A 3RCPA 4A6FB 1LW3A 3SYXA 5HE0A 2DLWA 3GYOA 2K2UA 2ELAA 3OANA 2UVMA 4Y94A 4GZUA 2M38A 1H4RA 1X05A 4NSWA 2YT0A 2VKIA 1MK7B 2VSZA 1ZM0A 4EKUA 2CAYA 1DDMA 1LB1A 4ZRIA 2RLOA 3P7ZA 1IRSA 1MPHA 1SGHA 2FJLA 4K81A 2JP2A 1W1DA 3F5RA 1EAZA 3IVFA 5C5BA 1U5DA 2IYBA 5GOWB 2I5FA 2R0DA 2Z0QA 4A6HA 1UNPA 2I5CA 2N23A 2XQNM 3ULBA 1XCGA 5HE1A 2DN6A 2Y7BA 2ZPYA 1MAIA 1FOEA 3QBVB 4L6EA 2R09A 1FHXA 2G35A 3SUZA 1AQCA 1I7AA 1TJ6A 2OTXA 1RJ2A 3BJIA 2ADZA 3KRWA 3ZDTA 4BBKA 3PSCA 3D8EA 1XKEA 3PZDA 2VRWB 4KAXB 5DIFB 2Y8FA 4HAXB 3WYFB 1P6SA 4A5KA 2EMTA 5J3QA 2LKOA 1WJMA 4ZRJA 2NMBA 2Z0PA 3DXEA 4TKNA 1FHWA 2D2QA 4A6FA 3CXBB 3TCAA 4WSFA 2EJ8A 2H7DA 4DX90 1MIZB 2GJYA 2DKQA 2HTHB 5KCVA 1ISNA 2UZRA 2CY5A 1XX0A 4HB0B 1KI1B 1M7RA 3PVUA 5D27A 4MY6A 5D3YA 4GMXB 4KHOA 2BCJA 2CODA 4HB3B 1EGXA 3PG7A 3PVLA 4F7UP 3F0WA 4EJNA 1U5FA 5KQ1A 3ULCA 4YONA 5CLQB 3ODOA 1RRPB 2LULA 3KY9A 5FI0A 1FHOA 3DXDA 2YVCA 5LONB 4HAWB 2QKLA 3D8FA 2YF0A 1WI1A 4B6HA 3N7CA 1TQZA 3FSSA 2K00A 1XR0B 5D3XA 3VIAA 2COCA 3X23A 4HAYB 4PQ0A 1SHCA 3M1IB 2D4QA 3O96A 1N3HA 1U5EA 1WG7A 4HAZB 1WJ1A 4DBBA 1P3RA 3AU4A 5HE3A 5JP4A 1FGYA 4GXBA 1V89A 2PZ1A 4GN1A 3ODXA 3A98B 4IFSA 5CLLB 4PNKA 1KZGA 3ODWA 5JLJB 3P6AA 2KUPA 4IOYX 3SNHA 2MWNB 4DXAB 1FGZA 1PFJA 1NTVA 4TYZA 4F7GA 1U29A 2D11A 1V88A 2AL6A 2I1JA 2I1KA 4WVFB 2MFQA 1V5UA 2GS0A 1XD4A 4CHMA 3KZ1A 2GCLA 2DYQA 3KSYA 1Y19B 2M14A 1W1GA 4H8SA 1DYNA 1K5DB 4HATB 4NY0A 3HQCA 3QWMA 2J0KA 5D3WA 1Y5OA 2CRFA 2Q13A 3PEGA 5HE2A 1OY2A 1MIXA 3ZVRA 1BAKA 2MKRA 4KHBB 4ZRKA 1U2BA 2H7EA 2YRYA 2N0YA 1OMWA 4IAPA 1U27A 3QIJA 5EFXA 2LYDA 2L1CA 3MPXA 1I2HA 5L81A 1V61A 2P0FA 3CIKA 4MK0A 3D8DA 2DKPA 3TFMA 1V5PA 2Z0OA 1EF1A 1MK9B 1AWEA 1KZ7A 1BTKA 3TO1A 2DA0A 4F7HA 2ELBA 2K2JA 4HAUB 1GC6A 1DDVA 2YSZA 1QC6A 2OQBA 1NI2A 1UPRA 1Q67A 5C79A 2DX5A 3HK0A 4P7IA 4KVGB 3ML4A 1ZVRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LG1 A;  2KCJ A;  1ZC4 B;  2AEH A;  5J3T A;  4DX8 A;  1X86 A;  1X1F A;  2YS3 A;  3PP2 A;  2V76 A;  4Z2M B;  2D9Y A;  2HE7 A;  3WA0 A;  4K17 A;  4Z2N A;  1UNR A;  1E5W A;  4GMV A;  1X1G A;  3PVW A;  4C0A A;  3V5W A;  1UEF A;  2COF A;  3T06 A;  1MKE A;  1PMS A;  2RVB B;  4HB2 B;  2MDX A;  3TVV A;  4HDO A;  1BWN A;  5FI1 A;  2Y8G A;  1XOD A;  3LJU X;  1NU2 A;  1V5M A;  2J0J A;  1DRO A;  4HB4 B;  2L2I A;  2D9X A;  2X18 A;  1TXD A;  2EC1 A;  2LOZ A;  1ZC3 B;  3GYP A;  1J19 A;  2W2W A;  2P0D A;  2YS5 A;  3U8Z A;  4KHA A;  2J0M A;  2E2X A;  2YT1 A;  2ROZ B;  2D9V A;  2DX1 A;  3AU5 A;  2LOX A;  1GC7 A;  2ROV A;  2DHI A;  2DHK A;  2EMS A;  1Z87 A;  3DXC A;  1GG3 A;  2COA A;  3A8Q A;  1U5G A;  3SV1 A;  2UZS A;  3HW2 B;  4A6K A;  4WJ7 A;  4MT7 A;  2DHJ A;  1WGU A;  4GPT B;  1EVH A;  1X11 A;  2IFS A;  1UNQ A;  5LOP B;  1OQN A;  5KQ4 A;  1NTY A;  2W2X D;  3UZT A;  4K2O A;  1FAO A;  3KRX A;  3SO6 A;  2RGN B;  4CYE A;  2RSG A;  5JHH A;  1QQG A;  3MDB C;  5DH9 B;  1PLS A;  1WVH A;  3VOQ A;  2D10 A;  2QKM A;  3A8P A;  3FEH A;  1H10 A;  5JHG A;  2RUK B;  2DTC A;  3AJ4 A;  3FM8 C;  4HHV A;  4D0N B;  1P5T A;  5J3Y A;  1WGQ A;  4K2P A;  2RNR B;  2KGX B;  2DYN A;  2P0H A;  2CY4 A;  1K5G B;  1FB8 A;  4YL8 A;  5C5B B;  2P8V A;  3TW1 A;  2NZ8 B;  2W2X C;  5C16 A;  2D9Z A;  5D3V A;  5DHF B;  2DFK A;  1ZSQ A;  1B55 A;  1W1H A;  1M7E A;  1UPQ A;  3G9W A;  1DDW A;  4EMO A;  2D9W A;  3U7D A;  2GCJ A;  1J0W A;  3NSU A;  1DBH A;  2J59 M;  4HDQ A;  5DHA B;  5C6R A;  3BIN A;  4XWX A;  1BTN A;  4HAV B;  4CHJ A;  5DI9 B;  2YS1 A;  3RCP A;  4A6F B;  1LW3 A;  3SYX A;  5HE0 A;  2DLW A;  3GYO A;  2K2U A;  2ELA A;  3OAN A;  2UVM A;  4Y94 A;  4GZU A;  2M38 A;  1H4R A;  1X05 A;  4NSW A;  2YT0 A;  2VKI A;  1MK7 B;  2VSZ A;  1ZM0 A;  4EKU A;  2CAY A;  1DDM A;  1LB1 A;  4ZRI A;  2RLO A;  3P7Z A;  1IRS A;  1MPH A;  1SGH A;  2FJL A;  4K81 A;  2JP2 A;  1W1D A;  3F5R A;  1EAZ A;  3IVF A;  5C5B A;  1U5D A;  2IYB A;  5GOW B;  2I5F A;  2R0D A;  2Z0Q A;  4A6H A;  1UNP A;  2I5C A;  2N23 A;  2XQN M;  3ULB A;  1XCG A;  5HE1 A;  2DN6 A;  2Y7B A;  2ZPY A;  1MAI A;  1FOE A;  3QBV B;  4L6E A;  2R09 A;  1FHX A;  2G35 A;  3SUZ A;  1AQC A;  1I7A A;  1TJ6 A;  2OTX A;  1RJ2 A;  3BJI A;  2ADZ A;  3KRW A;  3ZDT A;  4BBK A;  3PSC A;  3D8E A;  1XKE A;  3PZD A;  2VRW B;  4KAX B;  5DIF B;  2Y8F A;  4HAX B;  3WYF B;  1P6S A;  4A5K A;  2EMT A;  5J3Q A;  2LKO A;  1WJM A;  4ZRJ A;  2NMB A;  2Z0P A;  3DXE A;  4TKN A;  1FHW A;  2D2Q A;  4A6F A;  3CXB B;  3TCA A;  4WSF A;  2EJ8 A;  2H7D A;  4DX9 0;  1MIZ B;  2GJY A;  2DKQ A;  2HTH B;  5KCV A;  1ISN A;  2UZR A;  2CY5 A;  1XX0 A;  4HB0 B;  1KI1 B;  1M7R A;  3PVU A;  5D27 A;  4MY6 A;  5D3Y A;  4GMX B;  4KHO A;  2BCJ A;  2COD A;  4HB3 B;  1EGX A;  3PG7 A;  3PVL A;  4F7U P;  3F0W A;  4EJN A;  1U5F A;  5KQ1 A;  3ULC A;  4YON A;  5CLQ B;  3ODO A;  1RRP B;  2LUL A;  3KY9 A;  5FI0 A;  1FHO A;  3DXD A;  2YVC A;  5LON B;  4HAW B;  2QKL A;  3D8F A;  2YF0 A;  1WI1 A;  4B6H A;  3N7C A;  1TQZ A;  3FSS A;  2K00 A;  1XR0 B;  5D3X A;  3VIA A;  2COC A;  3X23 A;  4HAY B;  4PQ0 A;  1SHC A;  3M1I B;  2D4Q A;  3O96 A;  1N3H A;  1U5E A;  1WG7 A;  4HAZ B;  1WJ1 A;  4DBB A;  1P3R A;  3AU4 A;  5HE3 A;  5JP4 A;  1FGY A;  4GXB A;  1V89 A;  2PZ1 A;  4GN1 A;  3ODX A;  3A98 B;  4IFS A;  5CLL B;  4PNK A;  1KZG A;  3ODW A;  5JLJ B;  3P6A A;  2KUP A;  4IOY X;  3SNH A;  2MWN B;  4DXA B;  1FGZ A;  1PFJ A;  1NTV A;  4TYZ A;  4F7G A;  1U29 A;  2D11 A;  1V88 A;  2AL6 A;  2I1J A;  2I1K A;  4WVF B;  2MFQ A;  1V5U A;  2GS0 A;  1XD4 A;  4CHM A;  3KZ1 A;  2GCL A;  2DYQ A;  3KSY A;  1Y19 B;  2M14 A;  1W1G A;  4H8S A;  1DYN A;  1K5D B;  4HAT B;  4NY0 A;  3HQC A;  3QWM A;  2J0K A;  5D3W A;  1Y5O A;  2CRF A;  2Q13 A;  3PEG A;  5HE2 A;  1OY2 A;  1MIX A;  3ZVR A;  1BAK A;  2MKR A;  4KHB B;  4ZRK A;  1U2B A;  2H7E A;  2YRY A;  2N0Y A;  1OMW A;  4IAP A;  1U27 A;  3QIJ A;  5EFX A;  2LYD A;  2L1C A;  3MPX A;  1I2H A;  5L81 A;  1V61 A;  2P0F A;  3CIK A;  4MK0 A;  3D8D A;  2DKP A;  3TFM A;  1V5P A;  2Z0O A;  1EF1 A;  1MK9 B;  1AWE A;  1KZ7 A;  1BTK A;  3TO1 A;  2DA0 A;  4F7H A;  2ELB A;  2K2J A;  4HAU B;  1GC6 A;  1DDV A;  2YSZ A;  1QC6 A;  2OQB A;  1NI2 A;  1UPR A;  1Q67 A;  5C79 A;  2DX5 A;  3HK0 A;  4P7I A;  4KVG B;  3ML4 A;  1ZVR A; 
#chains in the Genus database with same CATH topology
 2LG1 A;  2KCJ A;  1ZC4 B;  2AEH A;  5J3T A;  4DX8 A;  1X86 A;  5I2S A;  1X1F A;  2YS3 A;  3PP2 A;  2V76 A;  4Z2M B;  2D9Y A;  2HE7 A;  3WA0 A;  4K17 A;  4Z2N A;  1UNR A;  1E5W A;  4GMV A;  1X1G A;  3PVW A;  5LG4 B;  4C0A A;  3V5W A;  1UEF A;  2COF A;  3T06 A;  1MKE A;  1PMS A;  1T77 A;  2RVB B;  4HB2 B;  2MDX A;  3TVV A;  4HDO A;  1BWN A;  5FI1 A;  2Y8G A;  1XOD A;  3LJU X;  1NU2 A;  1V5M A;  2J0J A;  1DRO A;  4HB4 B;  2L2I A;  2D9X A;  2X18 A;  1TXD A;  2EC1 A;  2LOZ A;  1ZC3 B;  3GYP A;  1J19 A;  2W2W A;  2P0D A;  2YS5 A;  3NWA A;  3U8Z A;  4KHA A;  2J0M A;  2E2X A;  2YT1 A;  2ROZ B;  2D9V A;  2DX1 A;  3AU5 A;  2LOX A;  3NWD A;  1GC7 A;  2ROV A;  2DHI A;  2DHK A;  2EMS A;  3FVC A;  1Z87 A;  3DXC A;  1GG3 A;  2COA A;  3HIE A;  3A8Q A;  1U5G A;  3SV1 A;  2UZS A;  3HW2 B;  4A6K A;  3DCX A;  4WJ7 A;  4MT7 A;  2DHJ A;  1WGU A;  4GPT B;  1EVH A;  1X11 A;  2IFS A;  1UNQ A;  5LOP B;  1OQN A;  5KQ4 A;  1NTY A;  2W2X D;  3UZT A;  4K2O A;  1FAO A;  3KRX A;  3SO6 A;  2RGN B;  4CYE A;  2RSG A;  4D6W A;  5JHH A;  1QQG A;  3MDB C;  5DH9 B;  1PLS A;  1WVH A;  3VOQ A;  3NWF A;  2D10 A;  2QKM A;  3A8P A;  3FEH A;  1H10 A;  5JHG A;  2RUK B;  2DTC A;  3AJ4 A;  3FM8 C;  4HHV A;  4D0N B;  1P5T A;  3U12 A;  5J3Y A;  1WGQ A;  4K2P A;  2RNR B;  2KGX B;  2DYN A;  4QJ5 B;  2P0H A;  2CY4 A;  1K5G B;  1FB8 A;  4YL8 A;  5C5B B;  2KIE A;  2KUQ A;  4L1R A;  2P8V A;  3TW1 A;  2NZ8 B;  2W2X C;  5C16 A;  2D9Z A;  5D3V A;  5DHF B;  2DFK A;  1ZSQ A;  1B55 A;  1W1H A;  1M7E A;  1UPQ A;  3G9W A;  1DDW A;  4EMO A;  2D9W A;  3U7D A;  2GCJ A;  1J0W A;  3NSU A;  1DBH A;  2J59 M;  1MI1 A;  4HDQ A;  5DHA B;  5C6R A;  3BIN A;  4XWX A;  1BTN A;  2K8E A;  2NBV A;  2FJU B;  4HAV B;  4CHJ A;  5DI9 B;  4QXA B;  2YS1 A;  3RCP A;  4A6F B;  1LW3 A;  4OT1 A;  3SYX A;  5HE0 A;  2DLW A;  3GYO A;  2K2U A;  2ELA A;  3OAN A;  2UVM A;  4Y94 A;  4GZU A;  2M38 A;  1H4R A;  1X05 A;  4NSW A;  2YT0 A;  2VKI A;  1MK7 B;  2VSZ A;  2Z4D A;  1ZM0 A;  4EKU A;  2CAY A;  2R2Y A;  1DDM A;  1LB1 A;  4ZRI A;  2RLO A;  3P7Z A;  1IRS A;  1MPH A;  1SGH A;  2FJL A;  4K81 A;  2JP2 A;  1W1D A;  3F5R A;  1EAZ A;  3IVF A;  5C5B A;  4DIX A;  1U5D A;  2IYB A;  5GOW B;  2I5F A;  2R0D A;  2Z0Q A;  4A6H A;  3OHM B;  1UNP A;  2I5C A;  2N23 A;  2XQN M;  3ULB A;  1XCG A;  5HE1 A;  2DN6 A;  2Y7B A;  2ZPY A;  1MAI A;  1FOE A;  3QBV B;  4L6E A;  2R09 A;  1FHX A;  2G35 A;  3SUZ A;  1AQC A;  1I7A A;  1TJ6 A;  3NW8 A;  3A58 A;  2OTX A;  1RJ2 A;  3BJI A;  2ADZ A;  3KRW A;  3ZDT A;  4BBK A;  3PSC A;  3D8E A;  1XKE A;  3PZD A;  2VRW B;  4KAX B;  5DIF B;  2Y8F A;  4HAX B;  3WYF B;  1P6S A;  4A5K A;  2EMT A;  5J3Q A;  2LKO A;  2K49 A;  1WJM A;  4ZRJ A;  2NMB A;  2Z0P A;  3DXE A;  4TKN A;  1FHW A;  2D2Q A;  4GOU A;  4A6F A;  3CXB B;  3TCA A;  4WSF A;  2EJ8 A;  2H7D A;  2KIG A;  1MIZ B;  4DX9 0;  2GJY A;  2DKQ A;  2HTH B;  5KCV A;  1ISN A;  2UZR A;  2CY5 A;  1XX0 A;  4HB0 B;  1KI1 B;  1M7R A;  3PVU A;  5D27 A;  4MY6 A;  5D3Y A;  4GMX B;  4KHO A;  2BCJ A;  4CSQ A;  2ZKM X;  4GNK B;  2COD A;  4HB3 B;  1EGX A;  3PG7 A;  2KR0 A;  3PVL A;  4F7U P;  3F0W A;  4EJN A;  1U5F A;  5KQ1 A;  3ULC A;  2Z14 A;  4YON A;  5CLQ B;  3ODO A;  1RRP B;  2LUL A;  3KY9 A;  5FI0 A;  1FHO A;  3DXD A;  2YVC A;  5LON B;  4HAW B;  2QKL A;  3D8F A;  2YF0 A;  1WI1 A;  4B6H A;  4OSN A;  3N7C A;  4QJ3 B;  1TQZ A;  3FSS A;  2K00 A;  1XR0 B;  5IRS A;  5D3X A;  3VIA A;  2COC A;  3X23 A;  4HAY B;  4PQ0 A;  1SHC A;  3M1I B;  2D4Q A;  3O96 A;  1N3H A;  1U5E A;  1WG7 A;  4HAZ B;  2GUM A;  1WJ1 A;  4DBB A;  1P3R A;  3AU4 A;  5HE3 A;  5JP4 A;  1FGY A;  4GXB A;  5M4Y B;  1V89 A;  2PZ1 A;  4GN1 A;  3ODX A;  3A98 B;  2YT2 A;  4IFS A;  4KHB A;  5CLL B;  4PNK A;  1KZG A;  3ODW A;  3HSA A;  5JLJ B;  3P6A A;  2KUP A;  4IOY X;  3SNH A;  2MWN B;  4DXA B;  1FGZ A;  1PFJ A;  1NTV A;  4TYZ A;  4F7G A;  1U29 A;  2D11 A;  1V88 A;  2AL6 A;  2I1J A;  2I1K A;  4WVF B;  2MFQ A;  1V5U A;  2GS0 A;  1XD4 A;  4CHM A;  3KZ1 A;  2GCL A;  2DYQ A;  3KSY A;  1Y19 B;  2M14 A;  1W1G A;  4H8S A;  1DYN A;  1K5D B;  4HAT B;  4NY0 A;  3HQC A;  3QWM A;  2J0K A;  5D3W A;  1Y5O A;  2CRF A;  2Q13 A;  3PEG A;  4HSI A;  2Z13 A;  5HE2 A;  1OY2 A;  1MIX A;  3ZVR A;  1BAK A;  2MKR A;  4KHB B;  4ZRK A;  1U2B A;  2H7E A;  2YRY A;  2N0Y A;  1OMW A;  4IAP A;  1U27 A;  3QIJ A;  2RRF A;  5EFX A;  2Z59 A;  2LYD A;  2L1C A;  3MPX A;  1I2H A;  5L81 A;  1V61 A;  2P0F A;  3CIK A;  4MK0 A;  3D8D A;  2DKP A;  3TFM A;  1V5P A;  2Z0O A;  1EF1 A;  1MK9 B;  1ZYI A;  1AWE A;  1KZ7 A;  3B77 A;  1BTK A;  3TO1 A;  2DA0 A;  4F7H A;  2ELB A;  2K2J A;  4HAU B;  4QJ4 B;  1GC6 A;  1DDV A;  5I2M A;  2YSZ A;  1QC6 A;  2OQB A;  1NI2 A;  1UPR A;  1Q67 A;  5C79 A;  2DX5 A;  3HK0 A;  4P7I A;  4KVG B;  3ML4 A;  1ZVR A; 
#chains in the Genus database with same CATH homology
 2LG1 A;  2KCJ A;  1ZC4 B;  2AEH A;  5J3T A;  4DX8 A;  1X86 A;  1X1F A;  2YS3 A;  3PP2 A;  2V76 A;  4Z2M B;  2D9Y A;  2HE7 A;  3WA0 A;  4K17 A;  4Z2N A;  1UNR A;  1E5W A;  4GMV A;  1X1G A;  3PVW A;  4C0A A;  3V5W A;  1UEF A;  2COF A;  3T06 A;  1MKE A;  1PMS A;  2RVB B;  4HB2 B;  2MDX A;  3TVV A;  4HDO A;  1BWN A;  5FI1 A;  2Y8G A;  1XOD A;  3LJU X;  1NU2 A;  1V5M A;  2J0J A;  1DRO A;  4HB4 B;  2L2I A;  2D9X A;  2X18 A;  1TXD A;  2EC1 A;  2LOZ A;  1ZC3 B;  3GYP A;  1J19 A;  2W2W A;  2P0D A;  2YS5 A;  3U8Z A;  4KHA A;  2J0M A;  2E2X A;  2YT1 A;  2ROZ B;  2D9V A;  2DX1 A;  3AU5 A;  2LOX A;  1GC7 A;  2ROV A;  2DHI A;  2DHK A;  2EMS A;  1Z87 A;  3DXC A;  1GG3 A;  2COA A;  3A8Q A;  1U5G A;  3SV1 A;  2UZS A;  3HW2 B;  4A6K A;  4WJ7 A;  4MT7 A;  2DHJ A;  1WGU A;  4GPT B;  1EVH A;  1X11 A;  2IFS A;  1UNQ A;  5LOP B;  1OQN A;  5KQ4 A;  1NTY A;  2W2X D;  3UZT A;  4K2O A;  1FAO A;  3KRX A;  3SO6 A;  2RGN B;  4CYE A;  2RSG A;  5JHH A;  1QQG A;  3MDB C;  5DH9 B;  1PLS A;  1WVH A;  3VOQ A;  2D10 A;  2QKM A;  3A8P A;  3FEH A;  1H10 A;  5JHG A;  2RUK B;  2DTC A;  3AJ4 A;  3FM8 C;  4HHV A;  4D0N B;  1P5T A;  5J3Y A;  1WGQ A;  4K2P A;  2RNR B;  2KGX B;  2DYN A;  2P0H A;  2CY4 A;  1K5G B;  1FB8 A;  4YL8 A;  5C5B B;  2P8V A;  3TW1 A;  2NZ8 B;  2W2X C;  5C16 A;  2D9Z A;  5D3V A;  5DHF B;  2DFK A;  1ZSQ A;  1B55 A;  1W1H A;  1M7E A;  1UPQ A;  3G9W A;  1DDW A;  4EMO A;  2D9W A;  3U7D A;  2GCJ A;  1J0W A;  3NSU A;  1DBH A;  2J59 M;  4HDQ A;  5DHA B;  5C6R A;  3BIN A;  4XWX A;  1BTN A;  4HAV B;  4CHJ A;  5DI9 B;  2YS1 A;  3RCP A;  4A6F B;  1LW3 A;  3SYX A;  5HE0 A;  2DLW A;  3GYO A;  2K2U A;  2ELA A;  3OAN A;  2UVM A;  4Y94 A;  4GZU A;  2M38 A;  1H4R A;  1X05 A;  4NSW A;  2YT0 A;  2VKI A;  1MK7 B;  2VSZ A;  1ZM0 A;  4EKU A;  2CAY A;  1DDM A;  1LB1 A;  4ZRI A;  2RLO A;  3P7Z A;  1IRS A;  1MPH A;  1SGH A;  2FJL A;  4K81 A;  2JP2 A;  1W1D A;  3F5R A;  1EAZ A;  3IVF A;  5C5B A;  1U5D A;  2IYB A;  5GOW B;  2I5F A;  2R0D A;  2Z0Q A;  4A6H A;  1UNP A;  2I5C A;  2N23 A;  2XQN M;  3ULB A;  1XCG A;  5HE1 A;  2DN6 A;  2Y7B A;  2ZPY A;  1MAI A;  1FOE A;  3QBV B;  4L6E A;  2R09 A;  1FHX A;  2G35 A;  3SUZ A;  1AQC A;  1I7A A;  1TJ6 A;  2OTX A;  1RJ2 A;  3BJI A;  2ADZ A;  3KRW A;  3ZDT A;  4BBK A;  3PSC A;  3D8E A;  1XKE A;  3PZD A;  2VRW B;  4KAX B;  5DIF B;  2Y8F A;  4HAX B;  3WYF B;  1P6S A;  4A5K A;  2EMT A;  5J3Q A;  2LKO A;  1WJM A;  4ZRJ A;  2NMB A;  2Z0P A;  3DXE A;  4TKN A;  1FHW A;  2D2Q A;  4A6F A;  3CXB B;  3TCA A;  4WSF A;  2EJ8 A;  2H7D A;  4DX9 0;  1MIZ B;  2GJY A;  2DKQ A;  2HTH B;  5KCV A;  1ISN A;  2UZR A;  2CY5 A;  1XX0 A;  4HB0 B;  1KI1 B;  1M7R A;  3PVU A;  5D27 A;  4MY6 A;  5D3Y A;  4GMX B;  4KHO A;  2BCJ A;  2COD A;  4HB3 B;  1EGX A;  3PG7 A;  3PVL A;  4F7U P;  3F0W A;  4EJN A;  1U5F A;  5KQ1 A;  3ULC A;  4YON A;  5CLQ B;  3ODO A;  1RRP B;  2LUL A;  3KY9 A;  5FI0 A;  1FHO A;  3DXD A;  2YVC A;  5LON B;  4HAW B;  2QKL A;  3D8F A;  2YF0 A;  1WI1 A;  4B6H A;  3N7C A;  1TQZ A;  3FSS A;  2K00 A;  1XR0 B;  5D3X A;  3VIA A;  2COC A;  3X23 A;  4HAY B;  4PQ0 A;  1SHC A;  3M1I B;  2D4Q A;  3O96 A;  1N3H A;  1U5E A;  1WG7 A;  4HAZ B;  1WJ1 A;  4DBB A;  1P3R A;  3AU4 A;  5HE3 A;  5JP4 A;  1FGY A;  4GXB A;  1V89 A;  2PZ1 A;  4GN1 A;  3ODX A;  3A98 B;  4IFS A;  5CLL B;  4PNK A;  1KZG A;  3ODW A;  5JLJ B;  3P6A A;  2KUP A;  4IOY X;  3SNH A;  2MWN B;  4DXA B;  1FGZ A;  1PFJ A;  1NTV A;  4TYZ A;  4F7G A;  1U29 A;  2D11 A;  1V88 A;  2AL6 A;  2I1J A;  2I1K A;  4WVF B;  2MFQ A;  1V5U A;  2GS0 A;  1XD4 A;  4CHM A;  3KZ1 A;  2GCL A;  2DYQ A;  3KSY A;  1Y19 B;  2M14 A;  1W1G A;  4H8S A;  1DYN A;  1K5D B;  4HAT B;  4NY0 A;  3HQC A;  3QWM A;  2J0K A;  5D3W A;  1Y5O A;  2CRF A;  2Q13 A;  3PEG A;  5HE2 A;  1OY2 A;  1MIX A;  3ZVR A;  1BAK A;  2MKR A;  4KHB B;  4ZRK A;  1U2B A;  2H7E A;  2YRY A;  2N0Y A;  1OMW A;  4IAP A;  1U27 A;  3QIJ A;  5EFX A;  2LYD A;  2L1C A;  3MPX A;  1I2H A;  5L81 A;  1V61 A;  2P0F A;  3CIK A;  4MK0 A;  3D8D A;  2DKP A;  3TFM A;  1V5P A;  2Z0O A;  1EF1 A;  1MK9 B;  1AWE A;  1KZ7 A;  1BTK A;  3TO1 A;  2DA0 A;  4F7H A;  2ELB A;  2K2J A;  4HAU B;  1GC6 A;  1DDV A;  2YSZ A;  1QC6 A;  2OQB A;  1NI2 A;  1UPR A;  1Q67 A;  5C79 A;  2DX5 A;  3HK0 A;  4P7I A;  4KVG B;  3ML4 A;  1ZVR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...