2GJYA

Nmr solution structure of tensin1 ptb domain
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
144
structure length
144
Chain Sequence
b'GSHMGAACNVLFINSVEMESLTGPQAISKAVAETLVADPTPTATIVHFKVSAQGITLTDNQRKLFFRRHYPLNTVTFCDLDPQERKWTKTDGSGPAKLFGFVARKQGSTTDNVCHLFAELDPDQPAAAIVNFVSRVMLGSGQKR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tensin
publication title The PTB domain of tensin: NMR solution structure and phosphoinositides binding studies.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Cell adhesion
total genus 18
structure length 144
sequence length 144
ec nomenclature
pdb deposition date 2006-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08416 PTB Phosphotyrosine-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2gjyA00
5FI1A 1EGXA 1W1GA 4IOYX 1UNPA 5HE1A 2OQBA 3AU5A 1MKEA 3AJ4A 4IFSA 2I5CA 1RRPB 4HDOA 2YT1A 4XWXA 1V5PA 2DLWA 1V5UA 2H7EA 2HE7A 2UVMA 3TO1A 1U27A 4A6FB 4HB4B 4L6EA 2EMTA 3FEHA 1X11A 1N3HA 2J59M 2AEHA 2DX5A 3WYFB 5LOPB 4DBBA 2COFA 1QC6A 1PFJA 4K17A 2RUKB 3OANA 4HAUB 4ZRJA 1P6SA 2DYQA 1BWNA 1PMSA 1UEFA 1FAOA 5JHHA 2G35A 1MK7B 3KY9A 4DX90 2EMSA 3DXCA 3GYOA 1LB1A 1U5EA 2H7DA 1KZGA 3SNHA 1SHCA 1V88A 1MK9B 2VRWB 2Z0OA 5HE2A 5LONB 1X1GA 1FGZA 5D3VA 1K5DB 2LULA 1XODA 3SV1A 3SYXA 5JLJB 2AL6A 2D9ZA 1EVHA 1NI2A 1U5FA 2YS3A 1W1DA 3F5RA 4WVFB 5DIFB 3MPXA 5KQ4A 4EKUA 4HAWB 4GPTB 1KI1B 4HDQA 4HHVA 4KVGB 4HAXB 2YVCA 4HB0B 1B55A 1EAZA 2E2XA 2LKOA 1WVHA 4KHBB 2W2XC 1Q67A 3BINA 4HB3B 4HAZB 1ZVRA 2ROZB 4F7UP 2VKIA 2DN6A 2LOZA 1EF1A 3O96A 4IAPA 2P0FA 1BTNA 4Z2MB 4A6HA 2M14A 5DHAB 2OTXA 1TJ6A 3ZDTA 3PVUA 3TVVA 1U5GA 2P8VA 3QWMA 2DX1A 1BAKA 3PVLA 2J0KA 2RNRB 1WGUA 1U29A 3V5WA 1OMWA 1Y5OA 2W2XD 4GXBA 3D8DA 2IYBA 3KSYA 2EC1A 1DROA 4EJNA 1AQCA 4BBKA 4DXAB 1ZC4B 4GMXB 2Y8FA 2YSZA 3BJIA 4K2OA 2CY4A 2M38A 4KHAA 3QBVB 1XKEA 1M7EA 3PVWA 2UZRA 1V61A 5CLQB 1OY2A 2I1JA 2J0JA 2LG1A 2RVBB 4Y94A 3U8ZA 1GC7A 1H4RA 3ODWA 5D3YA 2ELBA 1FHWA 2VSZA 2K2JA 2I1KA 3TFMA 3NSUA 4CHJA 1ISNA 2DHKA 3PZDA 4MT7A 2DA0A 4HAYB 4GMVA 4K81A 5L81A 2ADZA 2L1CA 5D3XA 1GC6A 1KZ7A 2QKLA 1DDVA 4YL8A 2D2QA 2BCJA 3VIAA 1XR0B 2COCA 2J0MA 4GZUA 3ULBA 2COAA 3FM8C 4CHMA 2X18A 1Y19B 1P3RA 4MY6A 2Q13A 2YT0A 2UZSA 2FJLA 3ML4A 2YS1A 3A8QA 3ULCA 2RGNB 2DTCA 3D8EA 1BTKA 1U5DA 4WSFA 5GOWB 4KAXB 1V5MA 1NTYA 2N23A 1XX0A 5DHFB 2DFKA 4H8SA 3U7DA 2V76A 4K2PA 2ELAA 1H10A 5KQ1A 2R0DA 1P5TA 4C0AA 1TQZA 2RSGA 1WI1A 1WG7A 3A8PA 2GCJA 1V89A 5J3YA 3HW2B 4ZRIA 2GS0A 2Y7BA 1UPQA 2XQNM 2KUPA 2MDXA 1J0WA 2ZPYA 2LOXA 3KZ1A 1E5WA 2D4QA 3SUZA 4ZRKA 3DXEA 4CYEA 2DHIA 2MFQA 2D9WA 4DX8A 2EJ8A 3CIKA 1K5GB 2YRYA 1FHOA 4NSWA 4Z2NA 1TXDA 1UNQA 1FOEA 1SGHA 4D0NB 2DKQA 2IFSA 3VOQA 1MPHA 3T06A 1UNRA 1WJ1A 4EMOA 1OQNA 2NMBA 3A98B 1U2BA 2CY5A 3UZTA 3N7CA 2D9VA 1GG3A 1M7RA 3P6AA 3P7ZA 1MIZB 3RCPA 1DYNA 2D11A 4A5KA 2N0YA 3F0WA 1RJ2A 5EFXA 3G9WA 2GJYA 2YS5A 4WJ7A 3IVFA 3TCAA 2KGXB 5D3WA 3SO6A 3KRWA 2ROVA 1ZM0A 2D9XA 1FHXA 1I2HA 4P7IA 5HE0A 3ZVRA 1WGQA 3PSCA 1WJMA 1PLSA 4HATB 1ZSQA 3PP2A 2Z0PA 4F7GA 1MIXA 2D10A 3X23A 1DBHA 1X05A 2PZ1A 5C5BA 3HK0A 1X86A 1AWEA 2CRFA 1XD4A 1LW3A 5C16A 3CXBB 2YF0A 1NU2A 2DYNA 2DKPA 2HTHB 5FI0A 3D8FA 3LJUX 3FSSA 5D27A 4A6KA 1XCGA 2L2IA 2D9YA 3PEGA 1FB8A 2GCLA 2CODA 2LYDA 2P0DA 3DXDA 1IRSA 4MK0A 4HAVB 2QKMA 1UPRA 1Z87A 1X1FA 1FGYA 1MAIA 3ODXA 2Z0QA 2CAYA 2W2WA 5J3QA 4B6HA 1W1HA 2R09A 3MDBC 4PQ0A 5C5BB 5DI9B 4TKNA 3M1IB 2KCJA 5C6RA 3TW1A 2Y8GA 5KCVA 5J3TA 4TYZA 2K00A 2MWNB 4F7HA 1QQGA 5JHGA 3AU4A 5HE3A 2P0HA 3PG7A 5JP4A 5DH9B 3HQCA 4HB2B 3ODOA 4A6FA 4YONA 2MKRA 1NTVA 5C79A 1ZC3B 3QIJA 4PNKA 2JP2A 1J19A 2I5FA 2DHJA 3GYPA 5CLLB 4NY0A 1I7AA 3KRXA 1DDMA 1DDWA 3WA0A 4GN1A 2RLOA 2K2UA 4KHOA 2NZ8B
chains in the Genus database with same CATH superfamily
5FI1A 1EGXA 1W1GA 4IOYX 1UNPA 5HE1A 2OQBA 3AU5A 1MKEA 3AJ4A 4IFSA 2I5CA 1RRPB 4HDOA 2YT1A 4XWXA 1V5PA 2DLWA 1V5UA 2H7EA 2HE7A 2UVMA 3TO1A 1U27A 4A6FB 4HB4B 4L6EA 2EMTA 3FEHA 1X11A 1N3HA 2J59M 2AEHA 2DX5A 3WYFB 5LOPB 4DBBA 2COFA 1QC6A 1PFJA 4K17A 2KUQA 2RUKB 3OANA 4HAUB 4ZRJA 4QJ3B 1P6SA 2DYQA 1BWNA 1PMSA 1UEFA 1FAOA 5JHHA 2G35A 1MK7B 3KY9A 4DX90 2EMSA 3DXCA 3GYOA 1LB1A 1U5EA 2H7DA 1KZGA 3SNHA 4KHBA 2Z59A 1SHCA 1V88A 1MK9B 2VRWB 2Z0OA 3NWFA 5HE2A 5LONB 1X1GA 1FGZA 5D3VA 1K5DB 2LULA 1XODA 3SV1A 3SYXA 4QJ4B 5JLJB 2AL6A 2D9ZA 1EVHA 1NI2A 1U5FA 2YT2A 3A58A 2NBVA 2YS3A 1W1DA 3F5RA 4WVFB 5DIFB 3MPXA 5KQ4A 4EKUA 4HAWB 4GPTB 1KI1B 4HDQA 4CSQA 4HHVA 4KVGB 4HAXB 2YVCA 4HB0B 1B55A 1EAZA 2E2XA 2LKOA 1WVHA 4KHBB 2W2XC 1Q67A 3BINA 4HB3B 3HIEA 4HAZB 3FVCA 1ZVRA 2ROZB 4F7UP 2VKIA 2DN6A 2LOZA 2RRFA 1EF1A 3O96A 4IAPA 2P0FA 1BTNA 4Z2MB 4A6HA 2M14A 5DHAB 2OTXA 1TJ6A 3ZDTA 3PVUA 3TVVA 1U5GA 2P8VA 3QWMA 2DX1A 1BAKA 3PVLA 2J0KA 2RNRB 1WGUA 1U29A 3V5WA 1OMWA 2Z14A 1Y5OA 2W2XD 4L1RA 4GXBA 3D8DA 2IYBA 5LG4B 1MI1A 3KSYA 2EC1A 1DROA 4EJNA 1AQCA 4BBKA 4DXAB 1ZC4B 4GMXB 2Y8FA 2YSZA 4D6WA 3BJIA 4K2OA 2CY4A 2M38A 4KHAA 3QBVB 1XKEA 1M7EA 3PVWA 2UZRA 2ZKMX 2Z4DA 1V61A 1ZYIA 5CLQB 1OY2A 2I1JA 2J0JA 2LG1A 2RVBB 4Y94A 3U8ZA 1GC7A 1H4RA 3ODWA 5D3YA 2ELBA 1FHWA 2VSZA 2K2JA 2I1KA 3TFMA 3NSUA 4CHJA 1ISNA 2DHKA 3B77A 3PZDA 4MT7A 2DA0A 4HAYB 4GMVA 4K81A 5L81A 2ADZA 2L1CA 5D3XA 1GC6A 1KZ7A 2QKLA 1DDVA 4YL8A 2D2QA 2BCJA 2KIEA 3VIAA 1XR0B 2COCA 3DCXA 2J0MA 4GZUA 3ULBA 2COAA 3FM8C 4CHMA 2X18A 1Y19B 1P3RA 4MY6A 2Q13A 2YT0A 2K49A 2UZSA 2FJLA 3ML4A 2YS1A 3A8QA 3ULCA 2RGNB 2DTCA 3D8EA 1BTKA 1U5DA 4WSFA 5GOWB 4KAXB 1V5MA 1NTYA 2N23A 1XX0A 5DHFB 2DFKA 4H8SA 3U7DA 2V76A 4K2PA 2ELAA 1H10A 5KQ1A 2R0DA 1P5TA 4C0AA 1TQZA 2RSGA 1WI1A 1WG7A 3A8PA 4GNKB 2GCJA 1V89A 5J3YA 1T77A 3HW2B 4ZRIA 2GS0A 2Y7BA 1UPQA 2XQNM 2KUPA 2MDXA 1J0WA 2ZPYA 2LOXA 3KZ1A 1E5WA 2D4QA 3SUZA 4ZRKA 3DXEA 4CYEA 2DHIA 2MFQA 2D9WA 4DX8A 2EJ8A 3CIKA 1K5GB 5I2MA 2YRYA 1FHOA 4NSWA 4Z2NA 5IRSA 1TXDA 1UNQA 3HSAA 1FOEA 4OT1A 1SGHA 4D0NB 2DKQA 2IFSA 3VOQA 1MPHA 3T06A 3U12A 1UNRA 1WJ1A 4EMOA 1OQNA 2NMBA 3A98B 1U2BA 2CY5A 3UZTA 3N7CA 2D9VA 1GG3A 1M7RA 3P6AA 3P7ZA 1MIZB 2KIGA 3RCPA 1DYNA 2D11A 4A5KA 5I2SA 2GUMA 2N0YA 3F0WA 1RJ2A 5EFXA 3G9WA 2GJYA 2YS5A 4QJ5B 2FJUB 4WJ7A 3IVFA 3TCAA 2KGXB 5D3WA 3SO6A 3KRWA 4QXAB 2ROVA 1ZM0A 2D9XA 4HSIA 1FHXA 1I2HA 4P7IA 5HE0A 3ZVRA 1WGQA 3PSCA 2KR0A 1WJMA 1PLSA 4HATB 1ZSQA 3PP2A 2Z0PA 4F7GA 3NWAA 1MIXA 2D10A 3X23A 1DBHA 1X05A 2PZ1A 5C5BA 3HK0A 1X86A 1AWEA 2CRFA 1XD4A 1LW3A 5C16A 3CXBB 2YF0A 1NU2A 2DYNA 4GOUA 2DKPA 2HTHB 5FI0A 3D8FA 3OHMB 3LJUX 3NWDA 3FSSA 5D27A 4A6KA 1XCGA 2L2IA 2D9YA 3PEGA 1FB8A 2GCLA 2CODA 2LYDA 2P0DA 3DXDA 2R2YA 1IRSA 4MK0A 4HAVB 2QKMA 1UPRA 1Z87A 1X1FA 1FGYA 1MAIA 3ODXA 2Z0QA 2CAYA 2W2WA 5J3QA 4B6HA 1W1HA 2R09A 3MDBC 4PQ0A 5C5BB 5DI9B 4TKNA 3M1IB 2KCJA 5C6RA 4DIXA 3TW1A 2Y8GA 5KCVA 5J3TA 4TYZA 2K00A 2MWNB 4F7HA 1QQGA 5JHGA 3AU4A 5HE3A 2P0HA 2Z13A 3PG7A 5JP4A 2K8EA 5DH9B 3HQCA 4HB2B 5M4YB 3ODOA 4OSNA 4A6FA 4YONA 2MKRA 1NTVA 5C79A 1ZC3B 3QIJA 4PNKA 2JP2A 1J19A 2I5FA 2DHJA 3GYPA 5CLLB 4NY0A 1I7AA 3KRXA 1DDMA 1DDWA 3WA0A 4GN1A 2RLOA 3NW8A 2K2UA 4KHOA 2NZ8B
chains in the Genus database with same CATH topology
5FI1A 1EGXA 1W1GA 4IOYX 1UNPA 5HE1A 2OQBA 3AU5A 1MKEA 3AJ4A 4IFSA 2I5CA 1RRPB 4HDOA 2YT1A 4XWXA 1V5PA 2DLWA 1V5UA 2H7EA 2HE7A 2UVMA 3TO1A 1U27A 4A6FB 4HB4B 4L6EA 2EMTA 3FEHA 1X11A 1N3HA 2J59M 2AEHA 2DX5A 3WYFB 5LOPB 4DBBA 2COFA 1QC6A 1PFJA 4K17A 2RUKB 3OANA 4HAUB 4ZRJA 1P6SA 2DYQA 1BWNA 1PMSA 1UEFA 1FAOA 5JHHA 2G35A 1MK7B 3KY9A 4DX90 2EMSA 3DXCA 3GYOA 1LB1A 1U5EA 2H7DA 1KZGA 3SNHA 1SHCA 1V88A 1MK9B 2VRWB 2Z0OA 5HE2A 5LONB 1X1GA 1FGZA 5D3VA 1K5DB 2LULA 1XODA 3SV1A 3SYXA 5JLJB 2AL6A 2D9ZA 1EVHA 1NI2A 1U5FA 2YS3A 1W1DA 3F5RA 4WVFB 5DIFB 3MPXA 5KQ4A 4EKUA 4HAWB 4GPTB 1KI1B 4HDQA 4HHVA 4KVGB 4HAXB 2YVCA 4HB0B 1B55A 1EAZA 2E2XA 2LKOA 1WVHA 4KHBB 2W2XC 1Q67A 3BINA 4HB3B 4HAZB 1ZVRA 2ROZB 4F7UP 2VKIA 2DN6A 2LOZA 1EF1A 3O96A 4IAPA 2P0FA 1BTNA 4Z2MB 4A6HA 2M14A 5DHAB 2OTXA 1TJ6A 3ZDTA 3PVUA 3TVVA 1U5GA 2P8VA 3QWMA 2DX1A 1BAKA 3PVLA 2J0KA 2RNRB 1WGUA 1U29A 3V5WA 1OMWA 1Y5OA 2W2XD 4GXBA 3D8DA 2IYBA 3KSYA 2EC1A 1DROA 4EJNA 1AQCA 4BBKA 4DXAB 1ZC4B 4GMXB 2Y8FA 2YSZA 3BJIA 4K2OA 2CY4A 2M38A 4KHAA 3QBVB 1XKEA 1M7EA 3PVWA 2UZRA 1V61A 5CLQB 1OY2A 2I1JA 2J0JA 2LG1A 2RVBB 4Y94A 3U8ZA 1GC7A 1H4RA 3ODWA 5D3YA 2ELBA 1FHWA 2VSZA 2K2JA 2I1KA 3TFMA 3NSUA 4CHJA 1ISNA 2DHKA 3PZDA 4MT7A 2DA0A 4HAYB 4GMVA 4K81A 5L81A 2ADZA 2L1CA 5D3XA 1GC6A 1KZ7A 2QKLA 1DDVA 4YL8A 2D2QA 2BCJA 3VIAA 1XR0B 2COCA 2J0MA 4GZUA 3ULBA 2COAA 3FM8C 4CHMA 2X18A 1Y19B 1P3RA 4MY6A 2Q13A 2YT0A 2UZSA 2FJLA 3ML4A 2YS1A 3A8QA 3ULCA 2RGNB 2DTCA 3D8EA 1BTKA 1U5DA 4WSFA 5GOWB 4KAXB 1V5MA 1NTYA 2N23A 1XX0A 5DHFB 2DFKA 4H8SA 3U7DA 2V76A 4K2PA 2ELAA 1H10A 5KQ1A 2R0DA 1P5TA 4C0AA 1TQZA 2RSGA 1WI1A 1WG7A 3A8PA 2GCJA 1V89A 5J3YA 3HW2B 4ZRIA 2GS0A 2Y7BA 1UPQA 2XQNM 2KUPA 2MDXA 1J0WA 2ZPYA 2LOXA 3KZ1A 1E5WA 2D4QA 3SUZA 4ZRKA 3DXEA 4CYEA 2DHIA 2MFQA 2D9WA 4DX8A 2EJ8A 3CIKA 1K5GB 2YRYA 1FHOA 4NSWA 4Z2NA 1TXDA 1UNQA 1FOEA 1SGHA 4D0NB 2DKQA 2IFSA 3VOQA 1MPHA 3T06A 1UNRA 1WJ1A 4EMOA 1OQNA 2NMBA 3A98B 1U2BA 2CY5A 3UZTA 3N7CA 2D9VA 1GG3A 1M7RA 3P6AA 3P7ZA 1MIZB 3RCPA 1DYNA 2D11A 4A5KA 2N0YA 3F0WA 1RJ2A 5EFXA 3G9WA 2GJYA 2YS5A 4WJ7A 3IVFA 3TCAA 2KGXB 5D3WA 3SO6A 3KRWA 2ROVA 1ZM0A 2D9XA 1FHXA 1I2HA 4P7IA 5HE0A 3ZVRA 1WGQA 3PSCA 1WJMA 1PLSA 4HATB 1ZSQA 3PP2A 2Z0PA 4F7GA 1MIXA 2D10A 3X23A 1DBHA 1X05A 2PZ1A 5C5BA 3HK0A 1X86A 1AWEA 2CRFA 1XD4A 1LW3A 5C16A 3CXBB 2YF0A 1NU2A 2DYNA 2DKPA 2HTHB 5FI0A 3D8FA 3LJUX 3FSSA 5D27A 4A6KA 1XCGA 2L2IA 2D9YA 3PEGA 1FB8A 2GCLA 2CODA 2LYDA 2P0DA 3DXDA 1IRSA 4MK0A 4HAVB 2QKMA 1UPRA 1Z87A 1X1FA 1FGYA 1MAIA 3ODXA 2Z0QA 2CAYA 2W2WA 5J3QA 4B6HA 1W1HA 2R09A 3MDBC 4PQ0A 5C5BB 5DI9B 4TKNA 3M1IB 2KCJA 5C6RA 3TW1A 2Y8GA 5KCVA 5J3TA 4TYZA 2K00A 2MWNB 4F7HA 1QQGA 5JHGA 3AU4A 5HE3A 2P0HA 3PG7A 5JP4A 5DH9B 3HQCA 4HB2B 3ODOA 4A6FA 4YONA 2MKRA 1NTVA 5C79A 1ZC3B 3QIJA 4PNKA 2JP2A 1J19A 2I5FA 2DHJA 3GYPA 5CLLB 4NY0A 1I7AA 3KRXA 1DDMA 1DDWA 3WA0A 4GN1A 2RLOA 2K2UA 4KHOA 2NZ8B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FI1 A;  1EGX A;  1W1G A;  4IOY X;  1UNP A;  5HE1 A;  2OQB A;  3AU5 A;  1MKE A;  3AJ4 A;  4IFS A;  2I5C A;  1RRP B;  4HDO A;  2YT1 A;  4XWX A;  1V5P A;  2DLW A;  1V5U A;  2H7E A;  2HE7 A;  2UVM A;  3TO1 A;  1U27 A;  4A6F B;  4HB4 B;  4L6E A;  2EMT A;  3FEH A;  1X11 A;  1N3H A;  2J59 M;  2AEH A;  2DX5 A;  3WYF B;  5LOP B;  4DBB A;  2COF A;  1QC6 A;  1PFJ A;  4K17 A;  2RUK B;  3OAN A;  4HAU B;  4ZRJ A;  1P6S A;  2DYQ A;  1BWN A;  1PMS A;  1UEF A;  1FAO A;  5JHH A;  2G35 A;  1MK7 B;  3KY9 A;  4DX9 0;  2EMS A;  3DXC A;  3GYO A;  1LB1 A;  1U5E A;  2H7D A;  1KZG A;  3SNH A;  1SHC A;  1V88 A;  1MK9 B;  2VRW B;  2Z0O A;  5HE2 A;  5LON B;  1X1G A;  1FGZ A;  5D3V A;  1K5D B;  2LUL A;  1XOD A;  3SV1 A;  3SYX A;  5JLJ B;  2AL6 A;  2D9Z A;  1EVH A;  1NI2 A;  1U5F A;  2YS3 A;  1W1D A;  3F5R A;  4WVF B;  5DIF B;  3MPX A;  5KQ4 A;  4EKU A;  4HAW B;  4GPT B;  1KI1 B;  4HDQ A;  4HHV A;  4KVG B;  4HAX B;  2YVC A;  4HB0 B;  1B55 A;  1EAZ A;  2E2X A;  2LKO A;  1WVH A;  4KHB B;  2W2X C;  1Q67 A;  3BIN A;  4HB3 B;  4HAZ B;  1ZVR A;  2ROZ B;  4F7U P;  2VKI A;  2DN6 A;  2LOZ A;  1EF1 A;  3O96 A;  4IAP A;  2P0F A;  1BTN A;  4Z2M B;  4A6H A;  2M14 A;  5DHA B;  2OTX A;  1TJ6 A;  3ZDT A;  3PVU A;  3TVV A;  1U5G A;  2P8V A;  3QWM A;  2DX1 A;  1BAK A;  3PVL A;  2J0K A;  2RNR B;  1WGU A;  1U29 A;  3V5W A;  1OMW A;  1Y5O A;  2W2X D;  4GXB A;  3D8D A;  2IYB A;  3KSY A;  2EC1 A;  1DRO A;  4EJN A;  1AQC A;  4BBK A;  4DXA B;  1ZC4 B;  4GMX B;  2Y8F A;  2YSZ A;  3BJI A;  4K2O A;  2CY4 A;  2M38 A;  4KHA A;  3QBV B;  1XKE A;  1M7E A;  3PVW A;  2UZR A;  1V61 A;  5CLQ B;  1OY2 A;  2I1J A;  2J0J A;  2LG1 A;  2RVB B;  4Y94 A;  3U8Z A;  1GC7 A;  1H4R A;  3ODW A;  5D3Y A;  2ELB A;  1FHW A;  2VSZ A;  2K2J A;  2I1K A;  3TFM A;  3NSU A;  4CHJ A;  1ISN A;  2DHK A;  3PZD A;  4MT7 A;  2DA0 A;  4HAY B;  4GMV A;  4K81 A;  5L81 A;  2ADZ A;  2L1C A;  5D3X A;  1GC6 A;  1KZ7 A;  2QKL A;  1DDV A;  4YL8 A;  2D2Q A;  2BCJ A;  3VIA A;  1XR0 B;  2COC A;  2J0M A;  4GZU A;  3ULB A;  2COA A;  3FM8 C;  4CHM A;  2X18 A;  1Y19 B;  1P3R A;  4MY6 A;  2Q13 A;  2YT0 A;  2UZS A;  2FJL A;  3ML4 A;  2YS1 A;  3A8Q A;  3ULC A;  2RGN B;  2DTC A;  3D8E A;  1BTK A;  1U5D A;  4WSF A;  5GOW B;  4KAX B;  1V5M A;  1NTY A;  2N23 A;  1XX0 A;  5DHF B;  2DFK A;  4H8S A;  3U7D A;  2V76 A;  4K2P A;  2ELA A;  1H10 A;  5KQ1 A;  2R0D A;  1P5T A;  4C0A A;  1TQZ A;  2RSG A;  1WI1 A;  1WG7 A;  3A8P A;  2GCJ A;  1V89 A;  5J3Y A;  3HW2 B;  4ZRI A;  2GS0 A;  2Y7B A;  1UPQ A;  2XQN M;  2KUP A;  2MDX A;  1J0W A;  2ZPY A;  2LOX A;  3KZ1 A;  1E5W A;  2D4Q A;  3SUZ A;  4ZRK A;  3DXE A;  4CYE A;  2DHI A;  2MFQ A;  2D9W A;  4DX8 A;  2EJ8 A;  3CIK A;  1K5G B;  2YRY A;  1FHO A;  4NSW A;  4Z2N A;  1TXD A;  1UNQ A;  1FOE A;  1SGH A;  4D0N B;  2DKQ A;  2IFS A;  3VOQ A;  1MPH A;  3T06 A;  1UNR A;  1WJ1 A;  4EMO A;  1OQN A;  2NMB A;  3A98 B;  1U2B A;  2CY5 A;  3UZT A;  3N7C A;  2D9V A;  1GG3 A;  1M7R A;  3P6A A;  3P7Z A;  1MIZ B;  3RCP A;  1DYN A;  2D11 A;  4A5K A;  2N0Y A;  3F0W A;  1RJ2 A;  5EFX A;  3G9W A;  2GJY A;  2YS5 A;  4WJ7 A;  3IVF A;  3TCA A;  2KGX B;  5D3W A;  3SO6 A;  3KRW A;  2ROV A;  1ZM0 A;  2D9X A;  1FHX A;  1I2H A;  4P7I A;  5HE0 A;  3ZVR A;  1WGQ A;  3PSC A;  1WJM A;  1PLS A;  4HAT B;  1ZSQ A;  3PP2 A;  2Z0P A;  4F7G A;  1MIX A;  2D10 A;  3X23 A;  1DBH A;  1X05 A;  2PZ1 A;  5C5B A;  3HK0 A;  1X86 A;  1AWE A;  2CRF A;  1XD4 A;  1LW3 A;  5C16 A;  3CXB B;  2YF0 A;  1NU2 A;  2DYN A;  2DKP A;  2HTH B;  5FI0 A;  3D8F A;  3LJU X;  3FSS A;  5D27 A;  4A6K A;  1XCG A;  2L2I A;  2D9Y A;  3PEG A;  1FB8 A;  2GCL A;  2COD A;  2LYD A;  2P0D A;  3DXD A;  1IRS A;  4MK0 A;  4HAV B;  2QKM A;  1UPR A;  1Z87 A;  1X1F A;  1FGY A;  1MAI A;  3ODX A;  2Z0Q A;  2CAY A;  2W2W A;  5J3Q A;  4B6H A;  1W1H A;  2R09 A;  3MDB C;  4PQ0 A;  5C5B B;  5DI9 B;  4TKN A;  3M1I B;  2KCJ A;  5C6R A;  3TW1 A;  2Y8G A;  5KCV A;  5J3T A;  4TYZ A;  2K00 A;  2MWN B;  4F7H A;  1QQG A;  5JHG A;  3AU4 A;  5HE3 A;  2P0H A;  3PG7 A;  5JP4 A;  5DH9 B;  3HQC A;  4HB2 B;  3ODO A;  4A6F A;  4YON A;  2MKR A;  1NTV A;  5C79 A;  1ZC3 B;  3QIJ A;  4PNK A;  2JP2 A;  1J19 A;  2I5F A;  2DHJ A;  3GYP A;  5CLL B;  4NY0 A;  1I7A A;  3KRX A;  1DDM A;  1DDW A;  3WA0 A;  4GN1 A;  2RLO A;  2K2U A;  4KHO A;  2NZ8 B; 
#chains in the Genus database with same CATH topology
 5FI1 A;  1EGX A;  1W1G A;  4IOY X;  1UNP A;  5HE1 A;  2OQB A;  3AU5 A;  1MKE A;  3AJ4 A;  4IFS A;  2I5C A;  1RRP B;  4HDO A;  2YT1 A;  4XWX A;  1V5P A;  2DLW A;  1V5U A;  2H7E A;  2HE7 A;  2UVM A;  3TO1 A;  1U27 A;  4A6F B;  4HB4 B;  4L6E A;  2EMT A;  3FEH A;  1X11 A;  1N3H A;  2J59 M;  2AEH A;  2DX5 A;  3WYF B;  5LOP B;  4DBB A;  2COF A;  1QC6 A;  1PFJ A;  4K17 A;  2KUQ A;  2RUK B;  3OAN A;  4HAU B;  4ZRJ A;  4QJ3 B;  1P6S A;  2DYQ A;  1BWN A;  1PMS A;  1UEF A;  1FAO A;  5JHH A;  2G35 A;  1MK7 B;  3KY9 A;  4DX9 0;  2EMS A;  3DXC A;  3GYO A;  1LB1 A;  1U5E A;  2H7D A;  1KZG A;  3SNH A;  4KHB A;  2Z59 A;  1SHC A;  1V88 A;  1MK9 B;  2VRW B;  2Z0O A;  3NWF A;  5HE2 A;  5LON B;  1X1G A;  1FGZ A;  5D3V A;  1K5D B;  2LUL A;  1XOD A;  3SV1 A;  3SYX A;  4QJ4 B;  5JLJ B;  2AL6 A;  2D9Z A;  1EVH A;  1NI2 A;  1U5F A;  2YT2 A;  3A58 A;  2NBV A;  2YS3 A;  1W1D A;  3F5R A;  4WVF B;  5DIF B;  3MPX A;  5KQ4 A;  4EKU A;  4HAW B;  4GPT B;  1KI1 B;  4HDQ A;  4CSQ A;  4HHV A;  4KVG B;  4HAX B;  2YVC A;  4HB0 B;  1B55 A;  1EAZ A;  2E2X A;  2LKO A;  1WVH A;  4KHB B;  2W2X C;  1Q67 A;  3BIN A;  4HB3 B;  3HIE A;  4HAZ B;  3FVC A;  1ZVR A;  2ROZ B;  4F7U P;  2VKI A;  2DN6 A;  2LOZ A;  2RRF A;  1EF1 A;  3O96 A;  4IAP A;  2P0F A;  1BTN A;  4Z2M B;  4A6H A;  2M14 A;  5DHA B;  2OTX A;  1TJ6 A;  3ZDT A;  3PVU A;  3TVV A;  1U5G A;  2P8V A;  3QWM A;  2DX1 A;  1BAK A;  3PVL A;  2J0K A;  2RNR B;  1WGU A;  1U29 A;  3V5W A;  1OMW A;  2Z14 A;  1Y5O A;  2W2X D;  4L1R A;  4GXB A;  3D8D A;  2IYB A;  5LG4 B;  1MI1 A;  3KSY A;  2EC1 A;  1DRO A;  4EJN A;  1AQC A;  4BBK A;  4DXA B;  1ZC4 B;  4GMX B;  2Y8F A;  2YSZ A;  4D6W A;  3BJI A;  4K2O A;  2CY4 A;  2M38 A;  4KHA A;  3QBV B;  1XKE A;  1M7E A;  3PVW A;  2UZR A;  2ZKM X;  2Z4D A;  1V61 A;  1ZYI A;  5CLQ B;  1OY2 A;  2I1J A;  2J0J A;  2LG1 A;  2RVB B;  4Y94 A;  3U8Z A;  1GC7 A;  1H4R A;  3ODW A;  5D3Y A;  2ELB A;  1FHW A;  2VSZ A;  2K2J A;  2I1K A;  3TFM A;  3NSU A;  4CHJ A;  1ISN A;  2DHK A;  3B77 A;  3PZD A;  4MT7 A;  2DA0 A;  4HAY B;  4GMV A;  4K81 A;  5L81 A;  2ADZ A;  2L1C A;  5D3X A;  1GC6 A;  1KZ7 A;  2QKL A;  1DDV A;  4YL8 A;  2D2Q A;  2BCJ A;  2KIE A;  3VIA A;  1XR0 B;  2COC A;  3DCX A;  2J0M A;  4GZU A;  3ULB A;  2COA A;  3FM8 C;  4CHM A;  2X18 A;  1Y19 B;  1P3R A;  4MY6 A;  2Q13 A;  2YT0 A;  2K49 A;  2UZS A;  2FJL A;  3ML4 A;  2YS1 A;  3A8Q A;  3ULC A;  2RGN B;  2DTC A;  3D8E A;  1BTK A;  1U5D A;  4WSF A;  5GOW B;  4KAX B;  1V5M A;  1NTY A;  2N23 A;  1XX0 A;  5DHF B;  2DFK A;  4H8S A;  3U7D A;  2V76 A;  4K2P A;  2ELA A;  1H10 A;  5KQ1 A;  2R0D A;  1P5T A;  4C0A A;  1TQZ A;  2RSG A;  1WI1 A;  1WG7 A;  3A8P A;  4GNK B;  2GCJ A;  1V89 A;  5J3Y A;  1T77 A;  3HW2 B;  4ZRI A;  2GS0 A;  2Y7B A;  1UPQ A;  2XQN M;  2KUP A;  2MDX A;  1J0W A;  2ZPY A;  2LOX A;  3KZ1 A;  1E5W A;  2D4Q A;  3SUZ A;  4ZRK A;  3DXE A;  4CYE A;  2DHI A;  2MFQ A;  2D9W A;  4DX8 A;  2EJ8 A;  3CIK A;  1K5G B;  5I2M A;  2YRY A;  1FHO A;  4NSW A;  4Z2N A;  5IRS A;  1TXD A;  1UNQ A;  3HSA A;  1FOE A;  4OT1 A;  1SGH A;  4D0N B;  2DKQ A;  2IFS A;  3VOQ A;  1MPH A;  3T06 A;  3U12 A;  1UNR A;  1WJ1 A;  4EMO A;  1OQN A;  2NMB A;  3A98 B;  1U2B A;  2CY5 A;  3UZT A;  3N7C A;  2D9V A;  1GG3 A;  1M7R A;  3P6A A;  3P7Z A;  1MIZ B;  2KIG A;  3RCP A;  1DYN A;  2D11 A;  4A5K A;  5I2S A;  2GUM A;  2N0Y A;  3F0W A;  1RJ2 A;  5EFX A;  3G9W A;  2GJY A;  2YS5 A;  4QJ5 B;  2FJU B;  4WJ7 A;  3IVF A;  3TCA A;  2KGX B;  5D3W A;  3SO6 A;  3KRW A;  4QXA B;  2ROV A;  1ZM0 A;  2D9X A;  4HSI A;  1FHX A;  1I2H A;  4P7I A;  5HE0 A;  3ZVR A;  1WGQ A;  3PSC A;  2KR0 A;  1WJM A;  1PLS A;  4HAT B;  1ZSQ A;  3PP2 A;  2Z0P A;  4F7G A;  3NWA A;  1MIX A;  2D10 A;  3X23 A;  1DBH A;  1X05 A;  2PZ1 A;  5C5B A;  3HK0 A;  1X86 A;  1AWE A;  2CRF A;  1XD4 A;  1LW3 A;  5C16 A;  3CXB B;  2YF0 A;  1NU2 A;  2DYN A;  4GOU A;  2DKP A;  2HTH B;  5FI0 A;  3D8F A;  3OHM B;  3LJU X;  3NWD A;  3FSS A;  5D27 A;  4A6K A;  1XCG A;  2L2I A;  2D9Y A;  3PEG A;  1FB8 A;  2GCL A;  2COD A;  2LYD A;  2P0D A;  3DXD A;  2R2Y A;  1IRS A;  4MK0 A;  4HAV B;  2QKM A;  1UPR A;  1Z87 A;  1X1F A;  1FGY A;  1MAI A;  3ODX A;  2Z0Q A;  2CAY A;  2W2W A;  5J3Q A;  4B6H A;  1W1H A;  2R09 A;  3MDB C;  4PQ0 A;  5C5B B;  5DI9 B;  4TKN A;  3M1I B;  2KCJ A;  5C6R A;  4DIX A;  3TW1 A;  2Y8G A;  5KCV A;  5J3T A;  4TYZ A;  2K00 A;  2MWN B;  4F7H A;  1QQG A;  5JHG A;  3AU4 A;  5HE3 A;  2P0H A;  2Z13 A;  3PG7 A;  5JP4 A;  2K8E A;  5DH9 B;  3HQC A;  4HB2 B;  5M4Y B;  3ODO A;  4OSN A;  4A6F A;  4YON A;  2MKR A;  1NTV A;  5C79 A;  1ZC3 B;  3QIJ A;  4PNK A;  2JP2 A;  1J19 A;  2I5F A;  2DHJ A;  3GYP A;  5CLL B;  4NY0 A;  1I7A A;  3KRX A;  1DDM A;  1DDW A;  3WA0 A;  4GN1 A;  2RLO A;  3NW8 A;  2K2U A;  4KHO A;  2NZ8 B; 
#chains in the Genus database with same CATH homology
 5FI1 A;  1EGX A;  1W1G A;  4IOY X;  1UNP A;  5HE1 A;  2OQB A;  3AU5 A;  1MKE A;  3AJ4 A;  4IFS A;  2I5C A;  1RRP B;  4HDO A;  2YT1 A;  4XWX A;  1V5P A;  2DLW A;  1V5U A;  2H7E A;  2HE7 A;  2UVM A;  3TO1 A;  1U27 A;  4A6F B;  4HB4 B;  4L6E A;  2EMT A;  3FEH A;  1X11 A;  1N3H A;  2J59 M;  2AEH A;  2DX5 A;  3WYF B;  5LOP B;  4DBB A;  2COF A;  1QC6 A;  1PFJ A;  4K17 A;  2RUK B;  3OAN A;  4HAU B;  4ZRJ A;  1P6S A;  2DYQ A;  1BWN A;  1PMS A;  1UEF A;  1FAO A;  5JHH A;  2G35 A;  1MK7 B;  3KY9 A;  4DX9 0;  2EMS A;  3DXC A;  3GYO A;  1LB1 A;  1U5E A;  2H7D A;  1KZG A;  3SNH A;  1SHC A;  1V88 A;  1MK9 B;  2VRW B;  2Z0O A;  5HE2 A;  5LON B;  1X1G A;  1FGZ A;  5D3V A;  1K5D B;  2LUL A;  1XOD A;  3SV1 A;  3SYX A;  5JLJ B;  2AL6 A;  2D9Z A;  1EVH A;  1NI2 A;  1U5F A;  2YS3 A;  1W1D A;  3F5R A;  4WVF B;  5DIF B;  3MPX A;  5KQ4 A;  4EKU A;  4HAW B;  4GPT B;  1KI1 B;  4HDQ A;  4HHV A;  4KVG B;  4HAX B;  2YVC A;  4HB0 B;  1B55 A;  1EAZ A;  2E2X A;  2LKO A;  1WVH A;  4KHB B;  2W2X C;  1Q67 A;  3BIN A;  4HB3 B;  4HAZ B;  1ZVR A;  2ROZ B;  4F7U P;  2VKI A;  2DN6 A;  2LOZ A;  1EF1 A;  3O96 A;  4IAP A;  2P0F A;  1BTN A;  4Z2M B;  4A6H A;  2M14 A;  5DHA B;  2OTX A;  1TJ6 A;  3ZDT A;  3PVU A;  3TVV A;  1U5G A;  2P8V A;  3QWM A;  2DX1 A;  1BAK A;  3PVL A;  2J0K A;  2RNR B;  1WGU A;  1U29 A;  3V5W A;  1OMW A;  1Y5O A;  2W2X D;  4GXB A;  3D8D A;  2IYB A;  3KSY A;  2EC1 A;  1DRO A;  4EJN A;  1AQC A;  4BBK A;  4DXA B;  1ZC4 B;  4GMX B;  2Y8F A;  2YSZ A;  3BJI A;  4K2O A;  2CY4 A;  2M38 A;  4KHA A;  3QBV B;  1XKE A;  1M7E A;  3PVW A;  2UZR A;  1V61 A;  5CLQ B;  1OY2 A;  2I1J A;  2J0J A;  2LG1 A;  2RVB B;  4Y94 A;  3U8Z A;  1GC7 A;  1H4R A;  3ODW A;  5D3Y A;  2ELB A;  1FHW A;  2VSZ A;  2K2J A;  2I1K A;  3TFM A;  3NSU A;  4CHJ A;  1ISN A;  2DHK A;  3PZD A;  4MT7 A;  2DA0 A;  4HAY B;  4GMV A;  4K81 A;  5L81 A;  2ADZ A;  2L1C A;  5D3X A;  1GC6 A;  1KZ7 A;  2QKL A;  1DDV A;  4YL8 A;  2D2Q A;  2BCJ A;  3VIA A;  1XR0 B;  2COC A;  2J0M A;  4GZU A;  3ULB A;  2COA A;  3FM8 C;  4CHM A;  2X18 A;  1Y19 B;  1P3R A;  4MY6 A;  2Q13 A;  2YT0 A;  2UZS A;  2FJL A;  3ML4 A;  2YS1 A;  3A8Q A;  3ULC A;  2RGN B;  2DTC A;  3D8E A;  1BTK A;  1U5D A;  4WSF A;  5GOW B;  4KAX B;  1V5M A;  1NTY A;  2N23 A;  1XX0 A;  5DHF B;  2DFK A;  4H8S A;  3U7D A;  2V76 A;  4K2P A;  2ELA A;  1H10 A;  5KQ1 A;  2R0D A;  1P5T A;  4C0A A;  1TQZ A;  2RSG A;  1WI1 A;  1WG7 A;  3A8P A;  2GCJ A;  1V89 A;  5J3Y A;  3HW2 B;  4ZRI A;  2GS0 A;  2Y7B A;  1UPQ A;  2XQN M;  2KUP A;  2MDX A;  1J0W A;  2ZPY A;  2LOX A;  3KZ1 A;  1E5W A;  2D4Q A;  3SUZ A;  4ZRK A;  3DXE A;  4CYE A;  2DHI A;  2MFQ A;  2D9W A;  4DX8 A;  2EJ8 A;  3CIK A;  1K5G B;  2YRY A;  1FHO A;  4NSW A;  4Z2N A;  1TXD A;  1UNQ A;  1FOE A;  1SGH A;  4D0N B;  2DKQ A;  2IFS A;  3VOQ A;  1MPH A;  3T06 A;  1UNR A;  1WJ1 A;  4EMO A;  1OQN A;  2NMB A;  3A98 B;  1U2B A;  2CY5 A;  3UZT A;  3N7C A;  2D9V A;  1GG3 A;  1M7R A;  3P6A A;  3P7Z A;  1MIZ B;  3RCP A;  1DYN A;  2D11 A;  4A5K A;  2N0Y A;  3F0W A;  1RJ2 A;  5EFX A;  3G9W A;  2GJY A;  2YS5 A;  4WJ7 A;  3IVF A;  3TCA A;  2KGX B;  5D3W A;  3SO6 A;  3KRW A;  2ROV A;  1ZM0 A;  2D9X A;  1FHX A;  1I2H A;  4P7I A;  5HE0 A;  3ZVR A;  1WGQ A;  3PSC A;  1WJM A;  1PLS A;  4HAT B;  1ZSQ A;  3PP2 A;  2Z0P A;  4F7G A;  1MIX A;  2D10 A;  3X23 A;  1DBH A;  1X05 A;  2PZ1 A;  5C5B A;  3HK0 A;  1X86 A;  1AWE A;  2CRF A;  1XD4 A;  1LW3 A;  5C16 A;  3CXB B;  2YF0 A;  1NU2 A;  2DYN A;  2DKP A;  2HTH B;  5FI0 A;  3D8F A;  3LJU X;  3FSS A;  5D27 A;  4A6K A;  1XCG A;  2L2I A;  2D9Y A;  3PEG A;  1FB8 A;  2GCL A;  2COD A;  2LYD A;  2P0D A;  3DXD A;  1IRS A;  4MK0 A;  4HAV B;  2QKM A;  1UPR A;  1Z87 A;  1X1F A;  1FGY A;  1MAI A;  3ODX A;  2Z0Q A;  2CAY A;  2W2W A;  5J3Q A;  4B6H A;  1W1H A;  2R09 A;  3MDB C;  4PQ0 A;  5C5B B;  5DI9 B;  4TKN A;  3M1I B;  2KCJ A;  5C6R A;  3TW1 A;  2Y8G A;  5KCV A;  5J3T A;  4TYZ A;  2K00 A;  2MWN B;  4F7H A;  1QQG A;  5JHG A;  3AU4 A;  5HE3 A;  2P0H A;  3PG7 A;  5JP4 A;  5DH9 B;  3HQC A;  4HB2 B;  3ODO A;  4A6F A;  4YON A;  2MKR A;  1NTV A;  5C79 A;  1ZC3 B;  3QIJ A;  4PNK A;  2JP2 A;  1J19 A;  2I5F A;  2DHJ A;  3GYP A;  5CLL B;  4NY0 A;  1I7A A;  3KRX A;  1DDM A;  1DDW A;  3WA0 A;  4GN1 A;  2RLO A;  2K2U A;  4KHO A;  2NZ8 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...