2GJYA

Nmr solution structure of tensin1 ptb domain
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
144
structure length
144
Chain Sequence
GSHMGAACNVLFINSVEMESLTGPQAISKAVAETLVADPTPTATIVHFKVSAQGITLTDNQRKLFFRRHYPLNTVTFCDLDPQERKWTKTDGSGPAKLFGFVARKQGSTTDNVCHLFAELDPDQPAAAIVNFVSRVMLGSGQKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords Tensin
publication title The PTB domain of tensin: NMR solution structure and phosphoinositides binding studies.
pubmed doi rcsb
source organism Gallus gallus
total genus 18
structure length 144
sequence length 144
ec nomenclature
pdb deposition date 2006-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08416 PTB Phosphotyrosine-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2gjyA00
2CY5A 1SHCA 3ODWA 4WSFA 3SYXA 2I1JA 2XQNM 4A6HA 3F0WA 1EGXA 4A5KA 2ROVA 2D11A 4HB3B 1U5GA 5D3XA 2AL6A 4D0NB 2V76A 3M1IB 4C0AA 1ZC3B 2D9WA 5DI9B 5J3TA 3HQCA 2DA0A 5J3QA 1GG3A 5C6RA 4A6KA 3F5RA 1U5FA 4IOYX 4MY6A 3TW1A 5FI1A 3D8EA 4DBBA 5HE3A 2LYDA 4K81A 4ZRJA 5HE1A 3RCPA 3CXBB 2HTHB 1EAZA 1W1HA 3T06A 4A6FA 2W2XC 4A6FB 4KHBB 3BJIA 1P5TA 3D8FA 2P8VA 4BBKA 1FB8A 1WG7A 2RLOA 3V5WA 2DN6A 3AU5A 1NI2A 2IYBA 1WJ1A 1TQZA 1J19A 1LW3A 2FJLA 1PFJA 5DIFB 3FSSA 1B55A 4P7IA 3U7DA 2D9XA 4KAXB 2AEHA 1V5MA 2CODA 4Z2MB 2EMTA 2K2UA 3PSCA 1LB1A 4IAPA 4CHMA 2BCJA 2RVBB 1MIXA 2CRFA 5D3YA 2ADZA 5JP4A 1KZGA 4F7HA 1WJMA 4K2OA 2COAA 2OQBA 4H8SA 5DHFB 1WGUA 2ZPYA 3DXDA 5C5BB 5KCVA 2DKPA 1Y5OA 2J0MA 4YONA 2P0FA 2Y7BA 4Y94A 2NMBA 2Z0QA 1U29A 2DHKA 5HE0A 4WVFB 2DHIA 3MPXA 1W1DA 4HB2B 1X1GA 2H7EA 2K2JA 2I5FA 2YS1A 3A8QA 1MK9B 1ISNA 4HDQA 3ULCA 2M38A 3N7CA 1M7RA 4ZRKA 4HAXB 4F7UP 3QBVB 1IRSA 3SUZA 5KQ1A 1Y19B 3IVFA 2PZ1A 4HHVA 1FOEA 3HK0A 1M7EA 1FGYA 2R09A 2LKOA 4CYEA 2CY4A 5J3YA 1BAKA 2X18A 4TKNA 5CLLB 1I2HA 4DX8A 4KHOA 1P6SA 3KZ1A 3GYPA 2DYQA 2UZSA 3PZDA 2OTXA 2DX1A 1DBHA 3OANA 3PEGA 2LULA 3SV1A 3PVLA 1WGQA 4GMXB 2KGXB 1UEFA 2YF0A 5D27A 2EJ8A 3AJ4A 1PLSA 1XCGA 3FEHA 3DXEA 3TFMA 5C16A 2I1KA 1V61A 2MDXA 1ZVRA 1DDWA 4GPTB 2GS0A 1XR0B 2KUPA 4HB0B 1V5PA 1ZC4B 1UNQA 1U27A 1NTVA 2DLWA 4CHJA 1GC6A 1DYNA 2COCA 4ZRIA 4HAWB 1XD4A 4HAYB 1FAOA 2LG1A 1UPQA 2UVMA 2RGNB 5HE2A 5L81A 1V5UA 1GC7A 3PVUA 3TO1A 3GYOA 3P6AA 2QKMA 2YS5A 2YVCA 1DROA 5KQ4A 3PG7A 2ROZB 1K5GB 3TVVA 2COFA 2L1CA 1H10A 5JHGA 4NY0A 3KRXA 2D10A 4KVGB 2YSZA 5LONB 4XWXA 2M14A 3UZTA 1FHXA 2Y8GA 2P0DA 1DDMA 2J0JA 2W2WA 3G9WA 1Z87A 2J0KA 2Y8FA 3ODOA 1UPRA 1QQGA 4L6EA 1KZ7A 1NU2A 4KHAA 2J59M 3A98B 1WI1A 3KRWA 3P7ZA 2Q13A 2CAYA 3DXCA 3X23A 1U2BA 2D9VA 2N0YA 1X11A 4GMVA 3SNHA 5JLJB 2VKIA 3AU4A 1X86A 1SGHA 1NTYA 1V88A 4DXAB 2YT0A 3ODXA 2HE7A 2D9YA 1WVHA 1MKEA 2R0DA 1Q67A 4HAVB 3NSUA 1U5DA 5JHHA 2G35A 4NSWA 2MKRA 3PP2A 3ULBA 3ML4A 2VSZA 2NZ8B 1E5WA 1P3RA 1U5EA 5DHAB 1ZM0A 2GCLA 2D2QA 2MFQA 2RNRB 5LOPB 4GZUA 5FI0A 2IFSA 3U8ZA 2UZRA 2DX5A 1K5DB 1MPHA 2DYNA 2EMSA 4MK0A 1X05A 2KCJA 2Z0OA 1AWEA 1UNRA 4EMOA 1MIZB 5DH9B 1N3HA 2QKLA 4K17A 4F7GA 1AQCA 1OMWA 2ELAA 4HB4B 1RJ2A 2K00A 4YL8A 2L2IA 3D8DA 2I5CA 5GOWB 3ZVRA 1BTKA 2RSGA 2W2XD 3QIJA 4HAZB 1OQNA 1QC6A 4TYZA 4B6HA 2RUKB 2ELBA 5D3WA 3FM8C 3QWMA 1PMSA 3VOQA 3ZDTA 5CLQB 4Z2NA 1RRPB 5D3VA 2LOXA 3MDBC 2DFKA 1I7AA 5C79A 4HAUB 2DHJA 2E2XA 1KI1B 1XODA 2JP2A 2H7DA 4PNKA 4MT7A 4IFSA 1OY2A 4WJ7A 3KY9A 2YT1A 1TJ6A 3VIAA 2LOZA 1BWNA 1V89A 2YS3A 1H4RA 1UNPA 1FHWA 1W1GA 2Z0PA 2VRWB 3A8PA 2MWNB 2EC1A 4K2PA 3KSYA 2D9ZA 2DKQA 1BTNA 1FHOA 3WA0A 2DTCA 1XKEA 2D4QA 3LJUX 3O96A 2YRYA 4GXBA 5C5BA 3BINA 4GN1A 2GJYA 1DDVA 1ZSQA 1TXDA 4EJNA 1EF1A 4HDOA 2GCJA 2N23A 1J0WA 4DX90 1MAIA 2P0HA 4PQ0A 1X1FA 3TCAA 3WYFB 3PVWA 1MK7B 3HW2B 1XX0A 4EKUA 3SO6A 1FGZA 3CIKA 4HATB 5EFXA 1EVHA
chains in the Genus database with same CATH superfamily
2CY5A 1SHCA 3ODWA 4WSFA 3SYXA 4QJ5B 2I1JA 2XQNM 4A6HA 3F0WA 1EGXA 4A5KA 3FVCA 2ROVA 4OT1A 2D11A 4HB3B 1U5GA 5D3XA 2AL6A 4D0NB 2V76A 3M1IB 2ZKMX 4C0AA 1ZC3B 2D9WA 5DI9B 4QJ4B 5J3TA 3HQCA 2DA0A 5J3QA 1GG3A 5C6RA 4A6KA 3F5RA 1U5FA 4IOYX 4MY6A 3TW1A 5FI1A 2YT2A 3D8EA 4DBBA 5HE3A 2LYDA 4K81A 4ZRJA 5HE1A 3RCPA 3CXBB 2HTHB 1EAZA 1W1HA 3T06A 4A6FA 2W2XC 4A6FB 4KHBB 3BJIA 1P5TA 3D8FA 2P8VA 4BBKA 1FB8A 1WG7A 2RLOA 3V5WA 2DN6A 3AU5A 1NI2A 2IYBA 1WJ1A 1TQZA 1J19A 1LW3A 2FJLA 1PFJA 5DIFB 3FSSA 1B55A 4P7IA 3U7DA 2D9XA 3NWAA 4KAXB 2AEHA 2NBVA 1V5MA 2CODA 4Z2MB 1ZYIA 2EMTA 2K2UA 3PSCA 1LB1A 4IAPA 4CHMA 2BCJA 2RVBB 2KUQA 1MIXA 2CRFA 5D3YA 2ADZA 3A58A 5JP4A 1KZGA 4F7HA 1WJMA 4K2OA 2COAA 2OQBA 4H8SA 5DHFB 1WGUA 2ZPYA 3DXDA 1T77A 4OSNA 5C5BB 5KCVA 2DKPA 1Y5OA 2J0MA 4YONA 2P0FA 2Y7BA 3U12A 4Y94A 2NMBA 2Z0QA 1U29A 2DHKA 5HE0A 4WVFB 2DHIA 3MPXA 1W1DA 3OHMB 4HB2B 1X1GA 2H7EA 2K2JA 2I5FA 2YS1A 3A8QA 1MK9B 1ISNA 5I2SA 4HDQA 3ULCA 2M38A 3N7CA 1M7RA 4ZRKA 4HAXB 4F7UP 3QBVB 1IRSA 3SUZA 5KQ1A 1Y19B 3IVFA 2PZ1A 4HHVA 1FOEA 3HK0A 1M7EA 1FGYA 2R09A 2LKOA 5LG4B 4CYEA 2CY4A 5J3YA 1BAKA 2X18A 4TKNA 5CLLB 1I2HA 4DX8A 4KHOA 1P6SA 2Z14A 3KZ1A 3GYPA 2DYQA 2UZSA 3PZDA 2OTXA 2DX1A 1DBHA 3OANA 3PEGA 4GOUA 2LULA 3SV1A 3PVLA 1WGQA 4GMXB 2KGXB 1UEFA 2YF0A 5D27A 2EJ8A 3AJ4A 1PLSA 4HSIA 1XCGA 3FEHA 3DXEA 2Z59A 4QXAB 3TFMA 2K8EA 5C16A 2I1KA 1V61A 2MDXA 1ZVRA 4D6WA 1DDWA 4GPTB 2GS0A 1XR0B 2KUPA 4HB0B 1V5PA 1ZC4B 1UNQA 1U27A 1NTVA 2DLWA 4CHJA 1GC6A 1DYNA 2COCA 4ZRIA 4HAWB 1XD4A 4HAYB 1FAOA 2LG1A 1UPQA 2UVMA 2RGNB 5HE2A 5L81A 1V5UA 3NWFA 1GC7A 3PVUA 3TO1A 3GYOA 3P6AA 2QKMA 2YS5A 2YVCA 1DROA 5KQ4A 3PG7A 2ROZB 1K5GB 3TVVA 2COFA 2L1CA 1H10A 5JHGA 4NY0A 5I2MA 3KRXA 2D10A 3DCXA 4DIXA 4KVGB 2YSZA 5LONB 4XWXA 2M14A 3UZTA 1FHXA 2Y8GA 2P0DA 1DDMA 2J0JA 2W2WA 3G9WA 1Z87A 4CSQA 2J0KA 2Y8FA 3ODOA 2GUMA 1UPRA 1QQGA 4L6EA 1KZ7A 1NU2A 4KHAA 2J59M 3A98B 1WI1A 3KRWA 3P7ZA 2Q13A 2CAYA 3DXCA 3X23A 1U2BA 3HIEA 2D9VA 2N0YA 1X11A 4GMVA 3SNHA 5JLJB 2VKIA 3AU4A 1X86A 1SGHA 1NTYA 1V88A 4DXAB 2YT0A 3ODXA 2HE7A 2D9YA 1WVHA 1MKEA 3B77A 2R0DA 2RRFA 1Q67A 4HAVB 3NSUA 4L1RA 1U5DA 5JHHA 2G35A 4NSWA 2MKRA 3PP2A 3ULBA 2VSZA 3ML4A 5M4YB 2NZ8B 1E5WA 1P3RA 1U5EA 5DHAB 1ZM0A 2GCLA 2D2QA 2MFQA 2RNRB 5LOPB 4GZUA 5FI0A 2IFSA 3U8ZA 2UZRA 2DX5A 1K5DB 1MPHA 2DYNA 2K49A 2EMSA 4MK0A 1X05A 2KCJA 2Z0OA 1AWEA 1UNRA 3HSAA 4EMOA 1MIZB 5DH9B 1N3HA 2QKLA 4K17A 4F7GA 1AQCA 1OMWA 3NWDA 2ELAA 4HB4B 1RJ2A 2K00A 4YL8A 2L2IA 3D8DA 2I5CA 5GOWB 3ZVRA 1BTKA 2RSGA 2W2XD 3QIJA 4HAZB 1OQNA 1QC6A 4TYZA 4B6HA 2RUKB 2ELBA 2KR0A 5D3WA 3FM8C 3QWMA 2Z4DA 1PMSA 3NW8A 3VOQA 3ZDTA 5CLQB 4Z2NA 1RRPB 5D3VA 2LOXA 4KHBA 4QJ3B 3MDBC 2DFKA 1I7AA 5C79A 4HAUB 2DHJA 2E2XA 1KI1B 1XODA 1MI1A 2FJUB 2JP2A 2H7DA 4PNKA 4MT7A 4IFSA 1OY2A 4WJ7A 3KY9A 2YT1A 2R2YA 1TJ6A 3VIAA 2LOZA 1BWNA 1V89A 2YS3A 1H4RA 1UNPA 5IRSA 1FHWA 1W1GA 2Z0PA 2Z13A 2VRWB 3A8PA 2MWNB 2EC1A 2KIGA 4K2PA 3KSYA 2D9ZA 2DKQA 1BTNA 1FHOA 3WA0A 2DTCA 1XKEA 2D4QA 3LJUX 3O96A 2YRYA 4GXBA 5C5BA 3BINA 2KIEA 4GN1A 2GJYA 1DDVA 1ZSQA 1TXDA 4EJNA 1EF1A 4HDOA 2GCJA 2N23A 1J0WA 4DX90 1MAIA 2P0HA 4PQ0A 1X1FA 3TCAA 3WYFB 3PVWA 1MK7B 3HW2B 1XX0A 4EKUA 3SO6A 1FGZA 3CIKA 4HATB 4GNKB 5EFXA 1EVHA
chains in the Genus database with same CATH topology
2CY5A 1SHCA 3ODWA 4WSFA 3SYXA 2I1JA 2XQNM 4A6HA 3F0WA 1EGXA 4A5KA 2ROVA 2D11A 4HB3B 1U5GA 5D3XA 2AL6A 4D0NB 2V76A 3M1IB 4C0AA 1ZC3B 2D9WA 5DI9B 5J3TA 3HQCA 2DA0A 5J3QA 1GG3A 5C6RA 4A6KA 3F5RA 1U5FA 4IOYX 4MY6A 3TW1A 5FI1A 3D8EA 4DBBA 5HE3A 2LYDA 4K81A 4ZRJA 5HE1A 3RCPA 3CXBB 2HTHB 1EAZA 1W1HA 3T06A 4A6FA 2W2XC 4A6FB 4KHBB 3BJIA 1P5TA 3D8FA 2P8VA 4BBKA 1FB8A 1WG7A 2RLOA 3V5WA 2DN6A 3AU5A 1NI2A 2IYBA 1WJ1A 1TQZA 1J19A 1LW3A 2FJLA 1PFJA 5DIFB 3FSSA 1B55A 4P7IA 3U7DA 2D9XA 4KAXB 2AEHA 1V5MA 2CODA 4Z2MB 2EMTA 2K2UA 3PSCA 1LB1A 4IAPA 4CHMA 2BCJA 2RVBB 1MIXA 2CRFA 5D3YA 2ADZA 5JP4A 1KZGA 4F7HA 1WJMA 4K2OA 2COAA 2OQBA 4H8SA 5DHFB 1WGUA 2ZPYA 3DXDA 5C5BB 5KCVA 2DKPA 1Y5OA 2J0MA 4YONA 2P0FA 2Y7BA 4Y94A 2NMBA 2Z0QA 1U29A 2DHKA 5HE0A 4WVFB 2DHIA 3MPXA 1W1DA 4HB2B 1X1GA 2H7EA 2K2JA 2I5FA 2YS1A 3A8QA 1MK9B 1ISNA 4HDQA 3ULCA 2M38A 3N7CA 1M7RA 4ZRKA 4HAXB 4F7UP 3QBVB 1IRSA 3SUZA 5KQ1A 1Y19B 3IVFA 2PZ1A 4HHVA 1FOEA 3HK0A 1M7EA 1FGYA 2R09A 2LKOA 4CYEA 2CY4A 5J3YA 1BAKA 2X18A 4TKNA 5CLLB 1I2HA 4DX8A 4KHOA 1P6SA 3KZ1A 3GYPA 2DYQA 2UZSA 3PZDA 2OTXA 2DX1A 1DBHA 3OANA 3PEGA 2LULA 3SV1A 3PVLA 1WGQA 4GMXB 2KGXB 1UEFA 2YF0A 5D27A 2EJ8A 3AJ4A 1PLSA 1XCGA 3FEHA 3DXEA 3TFMA 5C16A 2I1KA 1V61A 2MDXA 1ZVRA 1DDWA 4GPTB 2GS0A 1XR0B 2KUPA 4HB0B 1V5PA 1ZC4B 1UNQA 1U27A 1NTVA 2DLWA 4CHJA 1GC6A 1DYNA 2COCA 4ZRIA 4HAWB 1XD4A 4HAYB 1FAOA 2LG1A 1UPQA 2UVMA 2RGNB 5HE2A 5L81A 1V5UA 1GC7A 3PVUA 3TO1A 3GYOA 3P6AA 2QKMA 2YS5A 2YVCA 1DROA 5KQ4A 3PG7A 2ROZB 1K5GB 3TVVA 2COFA 2L1CA 1H10A 5JHGA 4NY0A 3KRXA 2D10A 4KVGB 2YSZA 5LONB 4XWXA 2M14A 3UZTA 1FHXA 2Y8GA 2P0DA 1DDMA 2J0JA 2W2WA 3G9WA 1Z87A 2J0KA 2Y8FA 3ODOA 1UPRA 1QQGA 4L6EA 1KZ7A 1NU2A 4KHAA 2J59M 3A98B 1WI1A 3KRWA 3P7ZA 2Q13A 2CAYA 3DXCA 3X23A 1U2BA 2D9VA 2N0YA 1X11A 4GMVA 3SNHA 5JLJB 2VKIA 3AU4A 1X86A 1SGHA 1NTYA 1V88A 4DXAB 2YT0A 3ODXA 2HE7A 2D9YA 1WVHA 1MKEA 2R0DA 1Q67A 4HAVB 3NSUA 1U5DA 5JHHA 2G35A 4NSWA 2MKRA 3PP2A 3ULBA 3ML4A 2VSZA 2NZ8B 1E5WA 1P3RA 1U5EA 5DHAB 1ZM0A 2GCLA 2D2QA 2MFQA 2RNRB 5LOPB 4GZUA 5FI0A 2IFSA 3U8ZA 2UZRA 2DX5A 1K5DB 1MPHA 2DYNA 2EMSA 4MK0A 1X05A 2KCJA 2Z0OA 1AWEA 1UNRA 4EMOA 1MIZB 5DH9B 1N3HA 2QKLA 4K17A 4F7GA 1AQCA 1OMWA 2ELAA 4HB4B 1RJ2A 2K00A 4YL8A 2L2IA 3D8DA 2I5CA 5GOWB 3ZVRA 1BTKA 2RSGA 2W2XD 3QIJA 4HAZB 1OQNA 1QC6A 4TYZA 4B6HA 2RUKB 2ELBA 5D3WA 3FM8C 3QWMA 1PMSA 3VOQA 3ZDTA 5CLQB 4Z2NA 1RRPB 5D3VA 2LOXA 3MDBC 2DFKA 1I7AA 5C79A 4HAUB 2DHJA 2E2XA 1KI1B 1XODA 2JP2A 2H7DA 4PNKA 4MT7A 4IFSA 1OY2A 4WJ7A 3KY9A 2YT1A 1TJ6A 3VIAA 2LOZA 1BWNA 1V89A 2YS3A 1H4RA 1UNPA 1FHWA 1W1GA 2Z0PA 2VRWB 3A8PA 2MWNB 2EC1A 4K2PA 3KSYA 2D9ZA 2DKQA 1BTNA 1FHOA 3WA0A 2DTCA 1XKEA 2D4QA 3LJUX 3O96A 2YRYA 4GXBA 5C5BA 3BINA 4GN1A 2GJYA 1DDVA 1ZSQA 1TXDA 4EJNA 1EF1A 4HDOA 2GCJA 2N23A 1J0WA 4DX90 1MAIA 2P0HA 4PQ0A 1X1FA 3TCAA 3WYFB 3PVWA 1MK7B 3HW2B 1XX0A 4EKUA 3SO6A 1FGZA 3CIKA 4HATB 5EFXA 1EVHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CY5 A;  1SHC A;  3ODW A;  4WSF A;  3SYX A;  2I1J A;  2XQN M;  4A6H A;  3F0W A;  1EGX A;  4A5K A;  2ROV A;  2D11 A;  4HB3 B;  1U5G A;  5D3X A;  2AL6 A;  4D0N B;  2V76 A;  3M1I B;  4C0A A;  1ZC3 B;  2D9W A;  5DI9 B;  5J3T A;  3HQC A;  2DA0 A;  5J3Q A;  1GG3 A;  5C6R A;  4A6K A;  3F5R A;  1U5F A;  4IOY X;  4MY6 A;  3TW1 A;  5FI1 A;  3D8E A;  4DBB A;  5HE3 A;  2LYD A;  4K81 A;  4ZRJ A;  5HE1 A;  3RCP A;  3CXB B;  2HTH B;  1EAZ A;  1W1H A;  3T06 A;  4A6F A;  2W2X C;  4A6F B;  4KHB B;  3BJI A;  1P5T A;  3D8F A;  2P8V A;  4BBK A;  1FB8 A;  1WG7 A;  2RLO A;  3V5W A;  2DN6 A;  3AU5 A;  1NI2 A;  2IYB A;  1WJ1 A;  1TQZ A;  1J19 A;  1LW3 A;  2FJL A;  1PFJ A;  5DIF B;  3FSS A;  1B55 A;  4P7I A;  3U7D A;  2D9X A;  4KAX B;  2AEH A;  1V5M A;  2COD A;  4Z2M B;  2EMT A;  2K2U A;  3PSC A;  1LB1 A;  4IAP A;  4CHM A;  2BCJ A;  2RVB B;  1MIX A;  2CRF A;  5D3Y A;  2ADZ A;  5JP4 A;  1KZG A;  4F7H A;  1WJM A;  4K2O A;  2COA A;  2OQB A;  4H8S A;  5DHF B;  1WGU A;  2ZPY A;  3DXD A;  5C5B B;  5KCV A;  2DKP A;  1Y5O A;  2J0M A;  4YON A;  2P0F A;  2Y7B A;  4Y94 A;  2NMB A;  2Z0Q A;  1U29 A;  2DHK A;  5HE0 A;  4WVF B;  2DHI A;  3MPX A;  1W1D A;  4HB2 B;  1X1G A;  2H7E A;  2K2J A;  2I5F A;  2YS1 A;  3A8Q A;  1MK9 B;  1ISN A;  4HDQ A;  3ULC A;  2M38 A;  3N7C A;  1M7R A;  4ZRK A;  4HAX B;  4F7U P;  3QBV B;  1IRS A;  3SUZ A;  5KQ1 A;  1Y19 B;  3IVF A;  2PZ1 A;  4HHV A;  1FOE A;  3HK0 A;  1M7E A;  1FGY A;  2R09 A;  2LKO A;  4CYE A;  2CY4 A;  5J3Y A;  1BAK A;  2X18 A;  4TKN A;  5CLL B;  1I2H A;  4DX8 A;  4KHO A;  1P6S A;  3KZ1 A;  3GYP A;  2DYQ A;  2UZS A;  3PZD A;  2OTX A;  2DX1 A;  1DBH A;  3OAN A;  3PEG A;  2LUL A;  3SV1 A;  3PVL A;  1WGQ A;  4GMX B;  2KGX B;  1UEF A;  2YF0 A;  5D27 A;  2EJ8 A;  3AJ4 A;  1PLS A;  1XCG A;  3FEH A;  3DXE A;  3TFM A;  5C16 A;  2I1K A;  1V61 A;  2MDX A;  1ZVR A;  1DDW A;  4GPT B;  2GS0 A;  1XR0 B;  2KUP A;  4HB0 B;  1V5P A;  1ZC4 B;  1UNQ A;  1U27 A;  1NTV A;  2DLW A;  4CHJ A;  1GC6 A;  1DYN A;  2COC A;  4ZRI A;  4HAW B;  1XD4 A;  4HAY B;  1FAO A;  2LG1 A;  1UPQ A;  2UVM A;  2RGN B;  5HE2 A;  5L81 A;  1V5U A;  1GC7 A;  3PVU A;  3TO1 A;  3GYO A;  3P6A A;  2QKM A;  2YS5 A;  2YVC A;  1DRO A;  5KQ4 A;  3PG7 A;  2ROZ B;  1K5G B;  3TVV A;  2COF A;  2L1C A;  1H10 A;  5JHG A;  4NY0 A;  3KRX A;  2D10 A;  4KVG B;  2YSZ A;  5LON B;  4XWX A;  2M14 A;  3UZT A;  1FHX A;  2Y8G A;  2P0D A;  1DDM A;  2J0J A;  2W2W A;  3G9W A;  1Z87 A;  2J0K A;  2Y8F A;  3ODO A;  1UPR A;  1QQG A;  4L6E A;  1KZ7 A;  1NU2 A;  4KHA A;  2J59 M;  3A98 B;  1WI1 A;  3KRW A;  3P7Z A;  2Q13 A;  2CAY A;  3DXC A;  3X23 A;  1U2B A;  2D9V A;  2N0Y A;  1X11 A;  4GMV A;  3SNH A;  5JLJ B;  2VKI A;  3AU4 A;  1X86 A;  1SGH A;  1NTY A;  1V88 A;  4DXA B;  2YT0 A;  3ODX A;  2HE7 A;  2D9Y A;  1WVH A;  1MKE A;  2R0D A;  1Q67 A;  4HAV B;  3NSU A;  1U5D A;  5JHH A;  2G35 A;  4NSW A;  2MKR A;  3PP2 A;  3ULB A;  3ML4 A;  2VSZ A;  2NZ8 B;  1E5W A;  1P3R A;  1U5E A;  5DHA B;  1ZM0 A;  2GCL A;  2D2Q A;  2MFQ A;  2RNR B;  5LOP B;  4GZU A;  5FI0 A;  2IFS A;  3U8Z A;  2UZR A;  2DX5 A;  1K5D B;  1MPH A;  2DYN A;  2EMS A;  4MK0 A;  1X05 A;  2KCJ A;  2Z0O A;  1AWE A;  1UNR A;  4EMO A;  1MIZ B;  5DH9 B;  1N3H A;  2QKL A;  4K17 A;  4F7G A;  1AQC A;  1OMW A;  2ELA A;  4HB4 B;  1RJ2 A;  2K00 A;  4YL8 A;  2L2I A;  3D8D A;  2I5C A;  5GOW B;  3ZVR A;  1BTK A;  2RSG A;  2W2X D;  3QIJ A;  4HAZ B;  1OQN A;  1QC6 A;  4TYZ A;  4B6H A;  2RUK B;  2ELB A;  5D3W A;  3FM8 C;  3QWM A;  1PMS A;  3VOQ A;  3ZDT A;  5CLQ B;  4Z2N A;  1RRP B;  5D3V A;  2LOX A;  3MDB C;  2DFK A;  1I7A A;  5C79 A;  4HAU B;  2DHJ A;  2E2X A;  1KI1 B;  1XOD A;  2JP2 A;  2H7D A;  4PNK A;  4MT7 A;  4IFS A;  1OY2 A;  4WJ7 A;  3KY9 A;  2YT1 A;  1TJ6 A;  3VIA A;  2LOZ A;  1BWN A;  1V89 A;  2YS3 A;  1H4R A;  1UNP A;  1FHW A;  1W1G A;  2Z0P A;  2VRW B;  3A8P A;  2MWN B;  2EC1 A;  4K2P A;  3KSY A;  2D9Z A;  2DKQ A;  1BTN A;  1FHO A;  3WA0 A;  2DTC A;  1XKE A;  2D4Q A;  3LJU X;  3O96 A;  2YRY A;  4GXB A;  5C5B A;  3BIN A;  4GN1 A;  2GJY A;  1DDV A;  1ZSQ A;  1TXD A;  4EJN A;  1EF1 A;  4HDO A;  2GCJ A;  2N23 A;  1J0W A;  4DX9 0;  1MAI A;  2P0H A;  4PQ0 A;  1X1F A;  3TCA A;  3WYF B;  3PVW A;  1MK7 B;  3HW2 B;  1XX0 A;  4EKU A;  3SO6 A;  1FGZ A;  3CIK A;  4HAT B;  5EFX A;  1EVH A; 
#chains in the Genus database with same CATH topology
 2CY5 A;  1SHC A;  3ODW A;  4WSF A;  3SYX A;  4QJ5 B;  2I1J A;  2XQN M;  4A6H A;  3F0W A;  1EGX A;  4A5K A;  3FVC A;  2ROV A;  4OT1 A;  2D11 A;  4HB3 B;  1U5G A;  5D3X A;  2AL6 A;  4D0N B;  2V76 A;  3M1I B;  2ZKM X;  4C0A A;  1ZC3 B;  2D9W A;  5DI9 B;  4QJ4 B;  5J3T A;  3HQC A;  2DA0 A;  5J3Q A;  1GG3 A;  5C6R A;  4A6K A;  3F5R A;  1U5F A;  4IOY X;  4MY6 A;  3TW1 A;  5FI1 A;  2YT2 A;  3D8E A;  4DBB A;  5HE3 A;  2LYD A;  4K81 A;  4ZRJ A;  5HE1 A;  3RCP A;  3CXB B;  2HTH B;  1EAZ A;  1W1H A;  3T06 A;  4A6F A;  2W2X C;  4A6F B;  4KHB B;  3BJI A;  1P5T A;  3D8F A;  2P8V A;  4BBK A;  1FB8 A;  1WG7 A;  2RLO A;  3V5W A;  2DN6 A;  3AU5 A;  1NI2 A;  2IYB A;  1WJ1 A;  1TQZ A;  1J19 A;  1LW3 A;  2FJL A;  1PFJ A;  5DIF B;  3FSS A;  1B55 A;  4P7I A;  3U7D A;  2D9X A;  3NWA A;  4KAX B;  2AEH A;  2NBV A;  1V5M A;  2COD A;  4Z2M B;  1ZYI A;  2EMT A;  2K2U A;  3PSC A;  1LB1 A;  4IAP A;  4CHM A;  2BCJ A;  2RVB B;  2KUQ A;  1MIX A;  2CRF A;  5D3Y A;  2ADZ A;  3A58 A;  5JP4 A;  1KZG A;  4F7H A;  1WJM A;  4K2O A;  2COA A;  2OQB A;  4H8S A;  5DHF B;  1WGU A;  2ZPY A;  3DXD A;  1T77 A;  4OSN A;  5C5B B;  5KCV A;  2DKP A;  1Y5O A;  2J0M A;  4YON A;  2P0F A;  2Y7B A;  3U12 A;  4Y94 A;  2NMB A;  2Z0Q A;  1U29 A;  2DHK A;  5HE0 A;  4WVF B;  2DHI A;  3MPX A;  1W1D A;  3OHM B;  4HB2 B;  1X1G A;  2H7E A;  2K2J A;  2I5F A;  2YS1 A;  3A8Q A;  1MK9 B;  1ISN A;  5I2S A;  4HDQ A;  3ULC A;  2M38 A;  3N7C A;  1M7R A;  4ZRK A;  4HAX B;  4F7U P;  3QBV B;  1IRS A;  3SUZ A;  5KQ1 A;  1Y19 B;  3IVF A;  2PZ1 A;  4HHV A;  1FOE A;  3HK0 A;  1M7E A;  1FGY A;  2R09 A;  2LKO A;  5LG4 B;  4CYE A;  2CY4 A;  5J3Y A;  1BAK A;  2X18 A;  4TKN A;  5CLL B;  1I2H A;  4DX8 A;  4KHO A;  1P6S A;  2Z14 A;  3KZ1 A;  3GYP A;  2DYQ A;  2UZS A;  3PZD A;  2OTX A;  2DX1 A;  1DBH A;  3OAN A;  3PEG A;  4GOU A;  2LUL A;  3SV1 A;  3PVL A;  1WGQ A;  4GMX B;  2KGX B;  1UEF A;  2YF0 A;  5D27 A;  2EJ8 A;  3AJ4 A;  1PLS A;  4HSI A;  1XCG A;  3FEH A;  3DXE A;  2Z59 A;  4QXA B;  3TFM A;  2K8E A;  5C16 A;  2I1K A;  1V61 A;  2MDX A;  1ZVR A;  4D6W A;  1DDW A;  4GPT B;  2GS0 A;  1XR0 B;  2KUP A;  4HB0 B;  1V5P A;  1ZC4 B;  1UNQ A;  1U27 A;  1NTV A;  2DLW A;  4CHJ A;  1GC6 A;  1DYN A;  2COC A;  4ZRI A;  4HAW B;  1XD4 A;  4HAY B;  1FAO A;  2LG1 A;  1UPQ A;  2UVM A;  2RGN B;  5HE2 A;  5L81 A;  1V5U A;  3NWF A;  1GC7 A;  3PVU A;  3TO1 A;  3GYO A;  3P6A A;  2QKM A;  2YS5 A;  2YVC A;  1DRO A;  5KQ4 A;  3PG7 A;  2ROZ B;  1K5G B;  3TVV A;  2COF A;  2L1C A;  1H10 A;  5JHG A;  4NY0 A;  5I2M A;  3KRX A;  2D10 A;  3DCX A;  4DIX A;  4KVG B;  2YSZ A;  5LON B;  4XWX A;  2M14 A;  3UZT A;  1FHX A;  2Y8G A;  2P0D A;  1DDM A;  2J0J A;  2W2W A;  3G9W A;  1Z87 A;  4CSQ A;  2J0K A;  2Y8F A;  3ODO A;  2GUM A;  1UPR A;  1QQG A;  4L6E A;  1KZ7 A;  1NU2 A;  4KHA A;  2J59 M;  3A98 B;  1WI1 A;  3KRW A;  3P7Z A;  2Q13 A;  2CAY A;  3DXC A;  3X23 A;  1U2B A;  3HIE A;  2D9V A;  2N0Y A;  1X11 A;  4GMV A;  3SNH A;  5JLJ B;  2VKI A;  3AU4 A;  1X86 A;  1SGH A;  1NTY A;  1V88 A;  4DXA B;  2YT0 A;  3ODX A;  2HE7 A;  2D9Y A;  1WVH A;  1MKE A;  3B77 A;  2R0D A;  2RRF A;  1Q67 A;  4HAV B;  3NSU A;  4L1R A;  1U5D A;  5JHH A;  2G35 A;  4NSW A;  2MKR A;  3PP2 A;  3ULB A;  2VSZ A;  3ML4 A;  5M4Y B;  2NZ8 B;  1E5W A;  1P3R A;  1U5E A;  5DHA B;  1ZM0 A;  2GCL A;  2D2Q A;  2MFQ A;  2RNR B;  5LOP B;  4GZU A;  5FI0 A;  2IFS A;  3U8Z A;  2UZR A;  2DX5 A;  1K5D B;  1MPH A;  2DYN A;  2K49 A;  2EMS A;  4MK0 A;  1X05 A;  2KCJ A;  2Z0O A;  1AWE A;  1UNR A;  3HSA A;  4EMO A;  1MIZ B;  5DH9 B;  1N3H A;  2QKL A;  4K17 A;  4F7G A;  1AQC A;  1OMW A;  3NWD A;  2ELA A;  4HB4 B;  1RJ2 A;  2K00 A;  4YL8 A;  2L2I A;  3D8D A;  2I5C A;  5GOW B;  3ZVR A;  1BTK A;  2RSG A;  2W2X D;  3QIJ A;  4HAZ B;  1OQN A;  1QC6 A;  4TYZ A;  4B6H A;  2RUK B;  2ELB A;  2KR0 A;  5D3W A;  3FM8 C;  3QWM A;  2Z4D A;  1PMS A;  3NW8 A;  3VOQ A;  3ZDT A;  5CLQ B;  4Z2N A;  1RRP B;  5D3V A;  2LOX A;  4KHB A;  4QJ3 B;  3MDB C;  2DFK A;  1I7A A;  5C79 A;  4HAU B;  2DHJ A;  2E2X A;  1KI1 B;  1XOD A;  1MI1 A;  2FJU B;  2JP2 A;  2H7D A;  4PNK A;  4MT7 A;  4IFS A;  1OY2 A;  4WJ7 A;  3KY9 A;  2YT1 A;  2R2Y A;  1TJ6 A;  3VIA A;  2LOZ A;  1BWN A;  1V89 A;  2YS3 A;  1H4R A;  1UNP A;  5IRS A;  1FHW A;  1W1G A;  2Z0P A;  2Z13 A;  2VRW B;  3A8P A;  2MWN B;  2EC1 A;  2KIG A;  4K2P A;  3KSY A;  2D9Z A;  2DKQ A;  1BTN A;  1FHO A;  3WA0 A;  2DTC A;  1XKE A;  2D4Q A;  3LJU X;  3O96 A;  2YRY A;  4GXB A;  5C5B A;  3BIN A;  2KIE A;  4GN1 A;  2GJY A;  1DDV A;  1ZSQ A;  1TXD A;  4EJN A;  1EF1 A;  4HDO A;  2GCJ A;  2N23 A;  1J0W A;  4DX9 0;  1MAI A;  2P0H A;  4PQ0 A;  1X1F A;  3TCA A;  3WYF B;  3PVW A;  1MK7 B;  3HW2 B;  1XX0 A;  4EKU A;  3SO6 A;  1FGZ A;  3CIK A;  4HAT B;  4GNK B;  5EFX A;  1EVH A; 
#chains in the Genus database with same CATH homology
 2CY5 A;  1SHC A;  3ODW A;  4WSF A;  3SYX A;  2I1J A;  2XQN M;  4A6H A;  3F0W A;  1EGX A;  4A5K A;  2ROV A;  2D11 A;  4HB3 B;  1U5G A;  5D3X A;  2AL6 A;  4D0N B;  2V76 A;  3M1I B;  4C0A A;  1ZC3 B;  2D9W A;  5DI9 B;  5J3T A;  3HQC A;  2DA0 A;  5J3Q A;  1GG3 A;  5C6R A;  4A6K A;  3F5R A;  1U5F A;  4IOY X;  4MY6 A;  3TW1 A;  5FI1 A;  3D8E A;  4DBB A;  5HE3 A;  2LYD A;  4K81 A;  4ZRJ A;  5HE1 A;  3RCP A;  3CXB B;  2HTH B;  1EAZ A;  1W1H A;  3T06 A;  4A6F A;  2W2X C;  4A6F B;  4KHB B;  3BJI A;  1P5T A;  3D8F A;  2P8V A;  4BBK A;  1FB8 A;  1WG7 A;  2RLO A;  3V5W A;  2DN6 A;  3AU5 A;  1NI2 A;  2IYB A;  1WJ1 A;  1TQZ A;  1J19 A;  1LW3 A;  2FJL A;  1PFJ A;  5DIF B;  3FSS A;  1B55 A;  4P7I A;  3U7D A;  2D9X A;  4KAX B;  2AEH A;  1V5M A;  2COD A;  4Z2M B;  2EMT A;  2K2U A;  3PSC A;  1LB1 A;  4IAP A;  4CHM A;  2BCJ A;  2RVB B;  1MIX A;  2CRF A;  5D3Y A;  2ADZ A;  5JP4 A;  1KZG A;  4F7H A;  1WJM A;  4K2O A;  2COA A;  2OQB A;  4H8S A;  5DHF B;  1WGU A;  2ZPY A;  3DXD A;  5C5B B;  5KCV A;  2DKP A;  1Y5O A;  2J0M A;  4YON A;  2P0F A;  2Y7B A;  4Y94 A;  2NMB A;  2Z0Q A;  1U29 A;  2DHK A;  5HE0 A;  4WVF B;  2DHI A;  3MPX A;  1W1D A;  4HB2 B;  1X1G A;  2H7E A;  2K2J A;  2I5F A;  2YS1 A;  3A8Q A;  1MK9 B;  1ISN A;  4HDQ A;  3ULC A;  2M38 A;  3N7C A;  1M7R A;  4ZRK A;  4HAX B;  4F7U P;  3QBV B;  1IRS A;  3SUZ A;  5KQ1 A;  1Y19 B;  3IVF A;  2PZ1 A;  4HHV A;  1FOE A;  3HK0 A;  1M7E A;  1FGY A;  2R09 A;  2LKO A;  4CYE A;  2CY4 A;  5J3Y A;  1BAK A;  2X18 A;  4TKN A;  5CLL B;  1I2H A;  4DX8 A;  4KHO A;  1P6S A;  3KZ1 A;  3GYP A;  2DYQ A;  2UZS A;  3PZD A;  2OTX A;  2DX1 A;  1DBH A;  3OAN A;  3PEG A;  2LUL A;  3SV1 A;  3PVL A;  1WGQ A;  4GMX B;  2KGX B;  1UEF A;  2YF0 A;  5D27 A;  2EJ8 A;  3AJ4 A;  1PLS A;  1XCG A;  3FEH A;  3DXE A;  3TFM A;  5C16 A;  2I1K A;  1V61 A;  2MDX A;  1ZVR A;  1DDW A;  4GPT B;  2GS0 A;  1XR0 B;  2KUP A;  4HB0 B;  1V5P A;  1ZC4 B;  1UNQ A;  1U27 A;  1NTV A;  2DLW A;  4CHJ A;  1GC6 A;  1DYN A;  2COC A;  4ZRI A;  4HAW B;  1XD4 A;  4HAY B;  1FAO A;  2LG1 A;  1UPQ A;  2UVM A;  2RGN B;  5HE2 A;  5L81 A;  1V5U A;  1GC7 A;  3PVU A;  3TO1 A;  3GYO A;  3P6A A;  2QKM A;  2YS5 A;  2YVC A;  1DRO A;  5KQ4 A;  3PG7 A;  2ROZ B;  1K5G B;  3TVV A;  2COF A;  2L1C A;  1H10 A;  5JHG A;  4NY0 A;  3KRX A;  2D10 A;  4KVG B;  2YSZ A;  5LON B;  4XWX A;  2M14 A;  3UZT A;  1FHX A;  2Y8G A;  2P0D A;  1DDM A;  2J0J A;  2W2W A;  3G9W A;  1Z87 A;  2J0K A;  2Y8F A;  3ODO A;  1UPR A;  1QQG A;  4L6E A;  1KZ7 A;  1NU2 A;  4KHA A;  2J59 M;  3A98 B;  1WI1 A;  3KRW A;  3P7Z A;  2Q13 A;  2CAY A;  3DXC A;  3X23 A;  1U2B A;  2D9V A;  2N0Y A;  1X11 A;  4GMV A;  3SNH A;  5JLJ B;  2VKI A;  3AU4 A;  1X86 A;  1SGH A;  1NTY A;  1V88 A;  4DXA B;  2YT0 A;  3ODX A;  2HE7 A;  2D9Y A;  1WVH A;  1MKE A;  2R0D A;  1Q67 A;  4HAV B;  3NSU A;  1U5D A;  5JHH A;  2G35 A;  4NSW A;  2MKR A;  3PP2 A;  3ULB A;  3ML4 A;  2VSZ A;  2NZ8 B;  1E5W A;  1P3R A;  1U5E A;  5DHA B;  1ZM0 A;  2GCL A;  2D2Q A;  2MFQ A;  2RNR B;  5LOP B;  4GZU A;  5FI0 A;  2IFS A;  3U8Z A;  2UZR A;  2DX5 A;  1K5D B;  1MPH A;  2DYN A;  2EMS A;  4MK0 A;  1X05 A;  2KCJ A;  2Z0O A;  1AWE A;  1UNR A;  4EMO A;  1MIZ B;  5DH9 B;  1N3H A;  2QKL A;  4K17 A;  4F7G A;  1AQC A;  1OMW A;  2ELA A;  4HB4 B;  1RJ2 A;  2K00 A;  4YL8 A;  2L2I A;  3D8D A;  2I5C A;  5GOW B;  3ZVR A;  1BTK A;  2RSG A;  2W2X D;  3QIJ A;  4HAZ B;  1OQN A;  1QC6 A;  4TYZ A;  4B6H A;  2RUK B;  2ELB A;  5D3W A;  3FM8 C;  3QWM A;  1PMS A;  3VOQ A;  3ZDT A;  5CLQ B;  4Z2N A;  1RRP B;  5D3V A;  2LOX A;  3MDB C;  2DFK A;  1I7A A;  5C79 A;  4HAU B;  2DHJ A;  2E2X A;  1KI1 B;  1XOD A;  2JP2 A;  2H7D A;  4PNK A;  4MT7 A;  4IFS A;  1OY2 A;  4WJ7 A;  3KY9 A;  2YT1 A;  1TJ6 A;  3VIA A;  2LOZ A;  1BWN A;  1V89 A;  2YS3 A;  1H4R A;  1UNP A;  1FHW A;  1W1G A;  2Z0P A;  2VRW B;  3A8P A;  2MWN B;  2EC1 A;  4K2P A;  3KSY A;  2D9Z A;  2DKQ A;  1BTN A;  1FHO A;  3WA0 A;  2DTC A;  1XKE A;  2D4Q A;  3LJU X;  3O96 A;  2YRY A;  4GXB A;  5C5B A;  3BIN A;  4GN1 A;  2GJY A;  1DDV A;  1ZSQ A;  1TXD A;  4EJN A;  1EF1 A;  4HDO A;  2GCJ A;  2N23 A;  1J0W A;  4DX9 0;  1MAI A;  2P0H A;  4PQ0 A;  1X1F A;  3TCA A;  3WYF B;  3PVW A;  1MK7 B;  3HW2 B;  1XX0 A;  4EKU A;  3SO6 A;  1FGZ A;  3CIK A;  4HAT B;  5EFX A;  1EVH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...