2GJYA

Nmr solution structure of tensin1 ptb domain
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
144
structure length
144
Chain Sequence
GSHMGAACNVLFINSVEMESLTGPQAISKAVAETLVADPTPTATIVHFKVSAQGITLTDNQRKLFFRRHYPLNTVTFCDLDPQERKWTKTDGSGPAKLFGFVARKQGSTTDNVCHLFAELDPDQPAAAIVNFVSRVMLGSGQKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tensin
publication title The PTB domain of tensin: NMR solution structure and phosphoinositides binding studies.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Cell adhesion
total genus 18
structure length 144
sequence length 144
ec nomenclature
pdb deposition date 2006-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08416 PTB Phosphotyrosine-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2gjyA00
5C79A 4TKNA 3VIAA 4KHAA 4YONA 4HDOA 1MIZB 1UEFA 1H10A 2MDXA 4EKUA 3O96A 5DHFB 1X1GA 5C16A 1SHCA 5C5BB 2ZPYA 2KUPA 3SUZA 2GJYA 4K2OA 1V88A 2OQBA 3HQCA 2Y7BA 2RNRB 2UZSA 1BTKA 3TFMA 3QIJA 1Q67A 1TQZA 3WYFB 3MPXA 5J3QA 2VKIA 4DX8A 2R09A 1WJ1A 1ZC3B 1OY2A 1KI1B 4KAXB 3TVVA 4F7HA 4PQ0A 2MKRA 4WJ7A 5JLJB 2D9ZA 4ZRKA 4HAXB 2L2IA 1U27A 2CODA 1MK9B 2D10A 2ROZB 5JHGA 1V5PA 2COCA 5HE0A 3GYOA 3BINA 1E5WA 3KRXA 3A8QA 3DXCA 1AQCA 1Y19B 2LOZA 2I5CA 3SNHA 1MKEA 3IVFA 5KQ1A 1X1FA 1XKEA 3ODXA 3PVLA 3SO6A 2YVCA 5EFXA 5DH9B 2EMSA 1EF1A 2Z0QA 4HAUB 2MFQA 4IFSA 1KZ7A 2NMBA 4A6KA 1N3HA 5HE1A 2DHKA 5JP4A 5CLQB 1V5UA 1WVHA 5J3TA 4NY0A 2AEHA 4Z2MB 2P8VA 2GCLA 3F0WA 1NU2A 2J59M 2YRYA 3D8DA 2DN6A 4DBBA 2P0HA 2I1JA 3PZDA 2DKPA 1GC7A 1FAOA 1U5EA 3AJ4A 4BBKA 1DROA 2DYNA 1WGUA 2LYDA 2M38A 2YF0A 2J0KA 2K00A 3LJUX 4IAPA 1I7AA 3D8EA 3FSSA 4A6HA 5KCVA 1DDMA 3PSCA 1BWNA 1MK7B 3AU4A 3ODOA 1LW3A 1NTVA 3ML4A 1WG7A 1WJMA 1U5GA 2YS1A 2D2QA 2DKQA 1ISNA 2LULA 1K5GB 1GC6A 3FEHA 5L81A 5FI1A 1Y5OA 3QBVB 2W2XD 4Y94A 1UNPA 2RVBB 1RRPB 2D9XA 4HATB 4DX90 2Z0OA 2AL6A 3A98B 2CY4A 2LKOA 3QWMA 1X11A 1MPHA 2RLOA 2ROVA 1BAKA 4D0NB 2ELAA 5JHHA 4HB2B 3SV1A 2RUKB 3KY9A 1PFJA 4HAYB 1DDWA 1FGZA 2DX1A 1W1DA 1NTYA 1XD4A 3V5WA 2N0YA 1WI1A 2DFKA 4CHJA 2DHJA 2D9VA 5LONB 1OMWA 1XX0A 2LOXA 3ZDTA 2Y8GA 3BJIA 3ODWA 5J3YA 5FI0A 1EGXA 1FB8A 3A8PA 3ULCA 1ZVRA 3PVWA 2ADZA 4NSWA 2CAYA 1LB1A 4P7IA 1Z87A 2D9WA 1FOEA 1FHOA 2UZRA 2D9YA 2X18A 2G35A 3M1IB 2QKMA 2CRFA 4HB4B 3PP2A 4PNKA 2EJ8A 1IRSA 1U29A 2UVMA 1U2BA 2V76A 2CY5A 5LOPB 1DYNA 3KZ1A 4F7UP 1EVHA 1BTNA 3DXDA 4C0AA 4XWXA 1ZC4B 1PLSA 1WGQA 2YS5A 2EC1A 2XQNM 4F7GA 4GXBA 4KHBB 4GMVA 5C6RA 1FHWA 3P7ZA 2BCJA 1V89A 2IFSA 3PG7A 2Y8FA 2R0DA 4MY6A 1J19A 4GMXB 4HDQA 1H4RA 2VSZA 1FGYA 2W2XC 2ELBA 3F5RA 5DHAB 2VRWB 4MT7A 2PZ1A 2Q13A 2E2XA 3FM8C 2FJLA 4A6FA 3MDBC 4K17A 1FHXA 4KVGB 4WSFA 1EAZA 2I1KA 2OTXA 2DLWA 3PEGA 2IYBA 3TW1A 1GG3A 5GOWB 2YSZA 3PVUA 3SYXA 4H8SA 2QKLA 3ZVRA 2D4QA 2J0JA 2KCJA 2YT0A 1U5FA 3DXEA 2DA0A 4ZRJA 2LG1A 4B6HA 4L6EA 3CXBB 3U7DA 4CYEA 2RGNB 4Z2NA 1P3RA 3OANA 1P6SA 2RSGA 1U5DA 4HHVA 3WA0A 2J0MA 2P0DA 1DBHA 2W2WA 1XODA 1UPRA 2Z0PA 5HE3A 1SGHA 3RCPA 3UZTA 4HAVB 2I5FA 1V5MA 2D11A 3N7CA 5D3VA 5C5BA 2DYQA 4K81A 4TYZA 1UNQA 1M7EA 3VOQA 3T06A 2GS0A 4EJNA 3P6AA 2K2JA 2N23A 1X86A 2KGXB 2EMTA 1OQNA 1XR0B 1DDVA 5D3WA 4EMOA 1XCGA 3G9WA 1UPQA 1B55A 1W1GA 4IOYX 1J0WA 3NSUA 1KZGA 2YT1A 2K2UA 4HAWB 1MIXA 5D27A 2HTHB 3D8FA 3KSYA 4MK0A 2P0FA 3CIKA 3GYPA 2COAA 3ULBA 4CHMA 5CLLB 4A5KA 2NZ8B 5HE2A 2COFA 1P5TA 1ZM0A 1ZSQA 1QQGA 2GCJA 4GZUA 1M7RA 5D3XA 4HAZB 1TJ6A 4KHOA 4DXAB 4HB0B 3HK0A 2H7DA 4A6FB 1QC6A 3AU5A 4HB3B 2JP2A 1NI2A 3KRWA 1W1HA 2HE7A 1TXDA 4WVFB 2M14A 2H7EA 4ZRIA 1UNRA 3X23A 5DIFB 4YL8A 3TO1A 2DHIA 1I2HA 1PMSA 1K5DB 1RJ2A 1V61A 3TCAA 5D3YA 1X05A 1AWEA 5DI9B 4GPTB 2DX5A 4GN1A 2DTCA 5KQ4A 3U8ZA 1MAIA 2L1CA 2YS3A 2MWNB 3HW2B 4K2PA
chains in the Genus database with same CATH superfamily
5C79A 4TKNA 3VIAA 4KHAA 4YONA 4OT1A 4HDOA 1MI1A 1MIZB 1UEFA 1H10A 2MDXA 4EKUA 3FVCA 3O96A 5DHFB 1X1GA 5C16A 1SHCA 5C5BB 2ZPYA 2KUPA 3SUZA 2GJYA 4K2OA 1V88A 2OQBA 3HQCA 2Y7BA 2RNRB 2R2YA 2UZSA 1BTKA 3TFMA 3QIJA 1Q67A 1TQZA 3WYFB 3MPXA 5J3QA 2VKIA 4DX8A 2R09A 1WJ1A 1ZC3B 1OY2A 1KI1B 4KAXB 3TVVA 4D6WA 4F7HA 4PQ0A 2MKRA 4WJ7A 5JLJB 2D9ZA 3NW8A 1T77A 4ZRKA 4HAXB 2L2IA 1U27A 2CODA 1MK9B 2D10A 2ROZB 4GNKB 5JHGA 1V5PA 2COCA 5HE0A 3GYOA 3BINA 1E5WA 3KRXA 3A8QA 5IRSA 3DXCA 2GUMA 1AQCA 1Y19B 2LOZA 4QJ3B 5I2MA 2I5CA 3SNHA 1MKEA 2Z4DA 3IVFA 3U12A 5KQ1A 1X1FA 1XKEA 3ODXA 3PVLA 3SO6A 2YVCA 5EFXA 5DH9B 2EMSA 1EF1A 2Z0QA 4HAUB 2MFQA 4IFSA 1KZ7A 2NMBA 4A6KA 1N3HA 5HE1A 2DHKA 2YT2A 5JP4A 5CLQB 1V5UA 2RRFA 1WVHA 5J3TA 4NY0A 2AEHA 4Z2MB 2P8VA 2GCLA 3F0WA 1NU2A 2J59M 2YRYA 3D8DA 2DN6A 4QJ4B 4DBBA 2P0HA 2I1JA 3PZDA 2DKPA 4KHBA 1GC7A 1FAOA 1U5EA 3A58A 3AJ4A 4BBKA 1DROA 2DYNA 1WGUA 2LYDA 1ZYIA 2M38A 2YF0A 2J0KA 2K00A 3LJUX 2KIGA 4IAPA 1I7AA 3D8EA 3FSSA 4A6HA 5I2SA 5KCVA 1DDMA 3PSCA 1BWNA 1MK7B 3AU4A 3ODOA 1LW3A 1NTVA 3ML4A 1WG7A 1WJMA 4QXAB 1U5GA 2YS1A 2D2QA 3NWAA 2DKQA 1ISNA 2LULA 1K5GB 1GC6A 3FEHA 5L81A 5FI1A 1Y5OA 3QBVB 2W2XD 4Y94A 1UNPA 3HIEA 2RVBB 1RRPB 2D9XA 4HATB 3HSAA 4DX90 2Z0OA 2AL6A 3A98B 2CY4A 2LKOA 3QWMA 1X11A 1MPHA 2RLOA 2ROVA 1BAKA 4D0NB 2ELAA 5JHHA 4HB2B 3SV1A 2RUKB 3KY9A 1PFJA 4HAYB 1DDWA 1FGZA 2DX1A 1W1DA 1NTYA 1XD4A 3V5WA 2N0YA 1WI1A 2DFKA 4CHJA 2DHJA 2D9VA 5LONB 1OMWA 1XX0A 2LOXA 3ZDTA 2Y8GA 3BJIA 3ODWA 5J3YA 5FI0A 1EGXA 1FB8A 3A8PA 3ULCA 1ZVRA 3PVWA 2ADZA 4NSWA 2CAYA 1LB1A 4P7IA 1Z87A 2D9WA 1FOEA 2K8EA 1FHOA 2UZRA 2D9YA 2X18A 2G35A 2QKMA 3M1IB 2CRFA 4HB4B 3PP2A 4PNKA 2EJ8A 1IRSA 1U29A 2UVMA 3NWFA 2Z14A 1U2BA 2V76A 2CY5A 5LOPB 1DYNA 3KZ1A 2KIEA 4F7UP 1EVHA 1BTNA 3DXDA 4C0AA 4XWXA 1ZC4B 1PLSA 1WGQA 2YS5A 5M4YB 2EC1A 2XQNM 4F7GA 4GXBA 4KHBB 4GMVA 5C6RA 1FHWA 3P7ZA 2BCJA 1V89A 2IFSA 3PG7A 2Y8FA 2R0DA 2ZKMX 4MY6A 3OHMB 1J19A 4GMXB 4HDQA 1H4RA 2VSZA 1FGYA 2W2XC 2ELBA 3F5RA 5DHAB 2VRWB 4MT7A 2PZ1A 2Q13A 2E2XA 3FM8C 2FJLA 4GOUA 4A6FA 3MDBC 4K17A 1FHXA 4KVGB 4WSFA 1EAZA 2I1KA 2OTXA 2DLWA 2KR0A 3PEGA 2IYBA 2K49A 3TW1A 1GG3A 5GOWB 2YSZA 3PVUA 3SYXA 4H8SA 3B77A 2QKLA 3ZVRA 2D4QA 2J0JA 2KCJA 2YT0A 1U5FA 3DXEA 2DA0A 4ZRJA 2LG1A 4B6HA 4L6EA 3CXBB 3U7DA 4CYEA 2RGNB 4Z2NA 1P3RA 3OANA 1P6SA 2RSGA 1U5DA 4HHVA 3WA0A 2J0MA 2P0DA 1DBHA 2W2WA 1XODA 1UPRA 2Z0PA 5HE3A 1SGHA 3RCPA 3UZTA 4HAVB 2I5FA 1V5MA 2D11A 3N7CA 5D3VA 5C5BA 2DYQA 2NBVA 4K81A 4TYZA 1UNQA 1M7EA 3VOQA 3T06A 2GS0A 4EJNA 3P6AA 2K2JA 2N23A 1X86A 2KGXB 2EMTA 1OQNA 1XR0B 1DDVA 5D3WA 4CSQA 4EMOA 1XCGA 3G9WA 4L1RA 1UPQA 1B55A 1W1GA 5LG4B 4IOYX 1J0WA 3NSUA 1KZGA 2YT1A 4DIXA 2K2UA 4HAWB 1MIXA 2FJUB 5D27A 2HTHB 3D8FA 3KSYA 4MK0A 2P0FA 3CIKA 3GYPA 2COAA 2KUQA 3ULBA 4CHMA 5CLLB 4A5KA 2NZ8B 5HE2A 2COFA 1P5TA 1ZM0A 1ZSQA 1QQGA 2GCJA 4GZUA 1M7RA 5D3XA 4HAZB 1TJ6A 4KHOA 4DXAB 4HB0B 3HK0A 2H7DA 4A6FB 1QC6A 3AU5A 4HB3B 2JP2A 1NI2A 3KRWA 1W1HA 2HE7A 1TXDA 4WVFB 2M14A 3DCXA 2H7EA 4ZRIA 1UNRA 2Z59A 3X23A 5DIFB 4YL8A 4HSIA 3TO1A 4QJ5B 2DHIA 1I2HA 4OSNA 1PMSA 1K5DB 1RJ2A 1V61A 3NWDA 3TCAA 5D3YA 1X05A 1AWEA 5DI9B 4GPTB 2DX5A 4GN1A 2DTCA 5KQ4A 3U8ZA 1MAIA 2L1CA 2YS3A 2MWNB 3HW2B 2Z13A 4K2PA
chains in the Genus database with same CATH topology
5C79A 4TKNA 3VIAA 4KHAA 4YONA 4HDOA 1MIZB 1UEFA 1H10A 2MDXA 4EKUA 3O96A 5DHFB 1X1GA 5C16A 1SHCA 5C5BB 2ZPYA 2KUPA 3SUZA 2GJYA 4K2OA 1V88A 2OQBA 3HQCA 2Y7BA 2RNRB 2UZSA 1BTKA 3TFMA 3QIJA 1Q67A 1TQZA 3WYFB 3MPXA 5J3QA 2VKIA 4DX8A 2R09A 1WJ1A 1ZC3B 1OY2A 1KI1B 4KAXB 3TVVA 4F7HA 4PQ0A 2MKRA 4WJ7A 5JLJB 2D9ZA 4ZRKA 4HAXB 2L2IA 1U27A 2CODA 1MK9B 2D10A 2ROZB 5JHGA 1V5PA 2COCA 5HE0A 3GYOA 3BINA 1E5WA 3KRXA 3A8QA 3DXCA 1AQCA 1Y19B 2LOZA 2I5CA 3SNHA 1MKEA 3IVFA 5KQ1A 1X1FA 1XKEA 3ODXA 3PVLA 3SO6A 2YVCA 5EFXA 5DH9B 2EMSA 1EF1A 2Z0QA 4HAUB 2MFQA 4IFSA 1KZ7A 2NMBA 4A6KA 1N3HA 5HE1A 2DHKA 5JP4A 5CLQB 1V5UA 1WVHA 5J3TA 4NY0A 2AEHA 4Z2MB 2P8VA 2GCLA 3F0WA 1NU2A 2J59M 2YRYA 3D8DA 2DN6A 4DBBA 2P0HA 2I1JA 3PZDA 2DKPA 1GC7A 1FAOA 1U5EA 3AJ4A 4BBKA 1DROA 2DYNA 1WGUA 2LYDA 2M38A 2YF0A 2J0KA 2K00A 3LJUX 4IAPA 1I7AA 3D8EA 3FSSA 4A6HA 5KCVA 1DDMA 3PSCA 1BWNA 1MK7B 3AU4A 3ODOA 1LW3A 1NTVA 3ML4A 1WG7A 1WJMA 1U5GA 2YS1A 2D2QA 2DKQA 1ISNA 2LULA 1K5GB 1GC6A 3FEHA 5L81A 5FI1A 1Y5OA 3QBVB 2W2XD 4Y94A 1UNPA 2RVBB 1RRPB 2D9XA 4HATB 4DX90 2Z0OA 2AL6A 3A98B 2CY4A 2LKOA 3QWMA 1X11A 1MPHA 2RLOA 2ROVA 1BAKA 4D0NB 2ELAA 5JHHA 4HB2B 3SV1A 2RUKB 3KY9A 1PFJA 4HAYB 1DDWA 1FGZA 2DX1A 1W1DA 1NTYA 1XD4A 3V5WA 2N0YA 1WI1A 2DFKA 4CHJA 2DHJA 2D9VA 5LONB 1OMWA 1XX0A 2LOXA 3ZDTA 2Y8GA 3BJIA 3ODWA 5J3YA 5FI0A 1EGXA 1FB8A 3A8PA 3ULCA 1ZVRA 3PVWA 2ADZA 4NSWA 2CAYA 1LB1A 4P7IA 1Z87A 2D9WA 1FOEA 1FHOA 2UZRA 2D9YA 2X18A 2G35A 3M1IB 2QKMA 2CRFA 4HB4B 3PP2A 4PNKA 2EJ8A 1IRSA 1U29A 2UVMA 1U2BA 2V76A 2CY5A 5LOPB 1DYNA 3KZ1A 4F7UP 1EVHA 1BTNA 3DXDA 4C0AA 4XWXA 1ZC4B 1PLSA 1WGQA 2YS5A 2EC1A 2XQNM 4F7GA 4GXBA 4KHBB 4GMVA 5C6RA 1FHWA 3P7ZA 2BCJA 1V89A 2IFSA 3PG7A 2Y8FA 2R0DA 4MY6A 1J19A 4GMXB 4HDQA 1H4RA 2VSZA 1FGYA 2W2XC 2ELBA 3F5RA 5DHAB 2VRWB 4MT7A 2PZ1A 2Q13A 2E2XA 3FM8C 2FJLA 4A6FA 3MDBC 4K17A 1FHXA 4KVGB 4WSFA 1EAZA 2I1KA 2OTXA 2DLWA 3PEGA 2IYBA 3TW1A 1GG3A 5GOWB 2YSZA 3PVUA 3SYXA 4H8SA 2QKLA 3ZVRA 2D4QA 2J0JA 2KCJA 2YT0A 1U5FA 3DXEA 2DA0A 4ZRJA 2LG1A 4B6HA 4L6EA 3CXBB 3U7DA 4CYEA 2RGNB 4Z2NA 1P3RA 3OANA 1P6SA 2RSGA 1U5DA 4HHVA 3WA0A 2J0MA 2P0DA 1DBHA 2W2WA 1XODA 1UPRA 2Z0PA 5HE3A 1SGHA 3RCPA 3UZTA 4HAVB 2I5FA 1V5MA 2D11A 3N7CA 5D3VA 5C5BA 2DYQA 4K81A 4TYZA 1UNQA 1M7EA 3VOQA 3T06A 2GS0A 4EJNA 3P6AA 2K2JA 2N23A 1X86A 2KGXB 2EMTA 1OQNA 1XR0B 1DDVA 5D3WA 4EMOA 1XCGA 3G9WA 1UPQA 1B55A 1W1GA 4IOYX 1J0WA 3NSUA 1KZGA 2YT1A 2K2UA 4HAWB 1MIXA 5D27A 2HTHB 3D8FA 3KSYA 4MK0A 2P0FA 3CIKA 3GYPA 2COAA 3ULBA 4CHMA 5CLLB 4A5KA 2NZ8B 5HE2A 2COFA 1P5TA 1ZM0A 1ZSQA 1QQGA 2GCJA 4GZUA 1M7RA 5D3XA 4HAZB 1TJ6A 4KHOA 4DXAB 4HB0B 3HK0A 2H7DA 4A6FB 1QC6A 3AU5A 4HB3B 2JP2A 1NI2A 3KRWA 1W1HA 2HE7A 1TXDA 4WVFB 2M14A 2H7EA 4ZRIA 1UNRA 3X23A 5DIFB 4YL8A 3TO1A 2DHIA 1I2HA 1PMSA 1K5DB 1RJ2A 1V61A 3TCAA 5D3YA 1X05A 1AWEA 5DI9B 4GPTB 2DX5A 4GN1A 2DTCA 5KQ4A 3U8ZA 1MAIA 2L1CA 2YS3A 2MWNB 3HW2B 4K2PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C79 A;  4TKN A;  3VIA A;  4KHA A;  4YON A;  4HDO A;  1MIZ B;  1UEF A;  1H10 A;  2MDX A;  4EKU A;  3O96 A;  5DHF B;  1X1G A;  5C16 A;  1SHC A;  5C5B B;  2ZPY A;  2KUP A;  3SUZ A;  2GJY A;  4K2O A;  1V88 A;  2OQB A;  3HQC A;  2Y7B A;  2RNR B;  2UZS A;  1BTK A;  3TFM A;  3QIJ A;  1Q67 A;  1TQZ A;  3WYF B;  3MPX A;  5J3Q A;  2VKI A;  4DX8 A;  2R09 A;  1WJ1 A;  1ZC3 B;  1OY2 A;  1KI1 B;  4KAX B;  3TVV A;  4F7H A;  4PQ0 A;  2MKR A;  4WJ7 A;  5JLJ B;  2D9Z A;  4ZRK A;  4HAX B;  2L2I A;  1U27 A;  2COD A;  1MK9 B;  2D10 A;  2ROZ B;  5JHG A;  1V5P A;  2COC A;  5HE0 A;  3GYO A;  3BIN A;  1E5W A;  3KRX A;  3A8Q A;  3DXC A;  1AQC A;  1Y19 B;  2LOZ A;  2I5C A;  3SNH A;  1MKE A;  3IVF A;  5KQ1 A;  1X1F A;  1XKE A;  3ODX A;  3PVL A;  3SO6 A;  2YVC A;  5EFX A;  5DH9 B;  2EMS A;  1EF1 A;  2Z0Q A;  4HAU B;  2MFQ A;  4IFS A;  1KZ7 A;  2NMB A;  4A6K A;  1N3H A;  5HE1 A;  2DHK A;  5JP4 A;  5CLQ B;  1V5U A;  1WVH A;  5J3T A;  4NY0 A;  2AEH A;  4Z2M B;  2P8V A;  2GCL A;  3F0W A;  1NU2 A;  2J59 M;  2YRY A;  3D8D A;  2DN6 A;  4DBB A;  2P0H A;  2I1J A;  3PZD A;  2DKP A;  1GC7 A;  1FAO A;  1U5E A;  3AJ4 A;  4BBK A;  1DRO A;  2DYN A;  1WGU A;  2LYD A;  2M38 A;  2YF0 A;  2J0K A;  2K00 A;  3LJU X;  4IAP A;  1I7A A;  3D8E A;  3FSS A;  4A6H A;  5KCV A;  1DDM A;  3PSC A;  1BWN A;  1MK7 B;  3AU4 A;  3ODO A;  1LW3 A;  1NTV A;  3ML4 A;  1WG7 A;  1WJM A;  1U5G A;  2YS1 A;  2D2Q A;  2DKQ A;  1ISN A;  2LUL A;  1K5G B;  1GC6 A;  3FEH A;  5L81 A;  5FI1 A;  1Y5O A;  3QBV B;  2W2X D;  4Y94 A;  1UNP A;  2RVB B;  1RRP B;  2D9X A;  4HAT B;  4DX9 0;  2Z0O A;  2AL6 A;  3A98 B;  2CY4 A;  2LKO A;  3QWM A;  1X11 A;  1MPH A;  2RLO A;  2ROV A;  1BAK A;  4D0N B;  2ELA A;  5JHH A;  4HB2 B;  3SV1 A;  2RUK B;  3KY9 A;  1PFJ A;  4HAY B;  1DDW A;  1FGZ A;  2DX1 A;  1W1D A;  1NTY A;  1XD4 A;  3V5W A;  2N0Y A;  1WI1 A;  2DFK A;  4CHJ A;  2DHJ A;  2D9V A;  5LON B;  1OMW A;  1XX0 A;  2LOX A;  3ZDT A;  2Y8G A;  3BJI A;  3ODW A;  5J3Y A;  5FI0 A;  1EGX A;  1FB8 A;  3A8P A;  3ULC A;  1ZVR A;  3PVW A;  2ADZ A;  4NSW A;  2CAY A;  1LB1 A;  4P7I A;  1Z87 A;  2D9W A;  1FOE A;  1FHO A;  2UZR A;  2D9Y A;  2X18 A;  2G35 A;  3M1I B;  2QKM A;  2CRF A;  4HB4 B;  3PP2 A;  4PNK A;  2EJ8 A;  1IRS A;  1U29 A;  2UVM A;  1U2B A;  2V76 A;  2CY5 A;  5LOP B;  1DYN A;  3KZ1 A;  4F7U P;  1EVH A;  1BTN A;  3DXD A;  4C0A A;  4XWX A;  1ZC4 B;  1PLS A;  1WGQ A;  2YS5 A;  2EC1 A;  2XQN M;  4F7G A;  4GXB A;  4KHB B;  4GMV A;  5C6R A;  1FHW A;  3P7Z A;  2BCJ A;  1V89 A;  2IFS A;  3PG7 A;  2Y8F A;  2R0D A;  4MY6 A;  1J19 A;  4GMX B;  4HDQ A;  1H4R A;  2VSZ A;  1FGY A;  2W2X C;  2ELB A;  3F5R A;  5DHA B;  2VRW B;  4MT7 A;  2PZ1 A;  2Q13 A;  2E2X A;  3FM8 C;  2FJL A;  4A6F A;  3MDB C;  4K17 A;  1FHX A;  4KVG B;  4WSF A;  1EAZ A;  2I1K A;  2OTX A;  2DLW A;  3PEG A;  2IYB A;  3TW1 A;  1GG3 A;  5GOW B;  2YSZ A;  3PVU A;  3SYX A;  4H8S A;  2QKL A;  3ZVR A;  2D4Q A;  2J0J A;  2KCJ A;  2YT0 A;  1U5F A;  3DXE A;  2DA0 A;  4ZRJ A;  2LG1 A;  4B6H A;  4L6E A;  3CXB B;  3U7D A;  4CYE A;  2RGN B;  4Z2N A;  1P3R A;  3OAN A;  1P6S A;  2RSG A;  1U5D A;  4HHV A;  3WA0 A;  2J0M A;  2P0D A;  1DBH A;  2W2W A;  1XOD A;  1UPR A;  2Z0P A;  5HE3 A;  1SGH A;  3RCP A;  3UZT A;  4HAV B;  2I5F A;  1V5M A;  2D11 A;  3N7C A;  5D3V A;  5C5B A;  2DYQ A;  4K81 A;  4TYZ A;  1UNQ A;  1M7E A;  3VOQ A;  3T06 A;  2GS0 A;  4EJN A;  3P6A A;  2K2J A;  2N23 A;  1X86 A;  2KGX B;  2EMT A;  1OQN A;  1XR0 B;  1DDV A;  5D3W A;  4EMO A;  1XCG A;  3G9W A;  1UPQ A;  1B55 A;  1W1G A;  4IOY X;  1J0W A;  3NSU A;  1KZG A;  2YT1 A;  2K2U A;  4HAW B;  1MIX A;  5D27 A;  2HTH B;  3D8F A;  3KSY A;  4MK0 A;  2P0F A;  3CIK A;  3GYP A;  2COA A;  3ULB A;  4CHM A;  5CLL B;  4A5K A;  2NZ8 B;  5HE2 A;  2COF A;  1P5T A;  1ZM0 A;  1ZSQ A;  1QQG A;  2GCJ A;  4GZU A;  1M7R A;  5D3X A;  4HAZ B;  1TJ6 A;  4KHO A;  4DXA B;  4HB0 B;  3HK0 A;  2H7D A;  4A6F B;  1QC6 A;  3AU5 A;  4HB3 B;  2JP2 A;  1NI2 A;  3KRW A;  1W1H A;  2HE7 A;  1TXD A;  4WVF B;  2M14 A;  2H7E A;  4ZRI A;  1UNR A;  3X23 A;  5DIF B;  4YL8 A;  3TO1 A;  2DHI A;  1I2H A;  1PMS A;  1K5D B;  1RJ2 A;  1V61 A;  3TCA A;  5D3Y A;  1X05 A;  1AWE A;  5DI9 B;  4GPT B;  2DX5 A;  4GN1 A;  2DTC A;  5KQ4 A;  3U8Z A;  1MAI A;  2L1C A;  2YS3 A;  2MWN B;  3HW2 B;  4K2P A; 
#chains in the Genus database with same CATH topology
 5C79 A;  4TKN A;  3VIA A;  4KHA A;  4YON A;  4OT1 A;  4HDO A;  1MI1 A;  1MIZ B;  1UEF A;  1H10 A;  2MDX A;  4EKU A;  3FVC A;  3O96 A;  5DHF B;  1X1G A;  5C16 A;  1SHC A;  5C5B B;  2ZPY A;  2KUP A;  3SUZ A;  2GJY A;  4K2O A;  1V88 A;  2OQB A;  3HQC A;  2Y7B A;  2RNR B;  2R2Y A;  2UZS A;  1BTK A;  3TFM A;  3QIJ A;  1Q67 A;  1TQZ A;  3WYF B;  3MPX A;  5J3Q A;  2VKI A;  4DX8 A;  2R09 A;  1WJ1 A;  1ZC3 B;  1OY2 A;  1KI1 B;  4KAX B;  3TVV A;  4D6W A;  4F7H A;  4PQ0 A;  2MKR A;  4WJ7 A;  5JLJ B;  2D9Z A;  3NW8 A;  1T77 A;  4ZRK A;  4HAX B;  2L2I A;  1U27 A;  2COD A;  1MK9 B;  2D10 A;  2ROZ B;  4GNK B;  5JHG A;  1V5P A;  2COC A;  5HE0 A;  3GYO A;  3BIN A;  1E5W A;  3KRX A;  3A8Q A;  5IRS A;  3DXC A;  2GUM A;  1AQC A;  1Y19 B;  2LOZ A;  4QJ3 B;  5I2M A;  2I5C A;  3SNH A;  1MKE A;  2Z4D A;  3IVF A;  3U12 A;  5KQ1 A;  1X1F A;  1XKE A;  3ODX A;  3PVL A;  3SO6 A;  2YVC A;  5EFX A;  5DH9 B;  2EMS A;  1EF1 A;  2Z0Q A;  4HAU B;  2MFQ A;  4IFS A;  1KZ7 A;  2NMB A;  4A6K A;  1N3H A;  5HE1 A;  2DHK A;  2YT2 A;  5JP4 A;  5CLQ B;  1V5U A;  2RRF A;  1WVH A;  5J3T A;  4NY0 A;  2AEH A;  4Z2M B;  2P8V A;  2GCL A;  3F0W A;  1NU2 A;  2J59 M;  2YRY A;  3D8D A;  2DN6 A;  4QJ4 B;  4DBB A;  2P0H A;  2I1J A;  3PZD A;  2DKP A;  4KHB A;  1GC7 A;  1FAO A;  1U5E A;  3A58 A;  3AJ4 A;  4BBK A;  1DRO A;  2DYN A;  1WGU A;  2LYD A;  1ZYI A;  2M38 A;  2YF0 A;  2J0K A;  2K00 A;  3LJU X;  2KIG A;  4IAP A;  1I7A A;  3D8E A;  3FSS A;  4A6H A;  5I2S A;  5KCV A;  1DDM A;  3PSC A;  1BWN A;  1MK7 B;  3AU4 A;  3ODO A;  1LW3 A;  1NTV A;  3ML4 A;  1WG7 A;  1WJM A;  4QXA B;  1U5G A;  2YS1 A;  2D2Q A;  3NWA A;  2DKQ A;  1ISN A;  2LUL A;  1K5G B;  1GC6 A;  3FEH A;  5L81 A;  5FI1 A;  1Y5O A;  3QBV B;  2W2X D;  4Y94 A;  1UNP A;  3HIE A;  2RVB B;  1RRP B;  2D9X A;  4HAT B;  3HSA A;  4DX9 0;  2Z0O A;  2AL6 A;  3A98 B;  2CY4 A;  2LKO A;  3QWM A;  1X11 A;  1MPH A;  2RLO A;  2ROV A;  1BAK A;  4D0N B;  2ELA A;  5JHH A;  4HB2 B;  3SV1 A;  2RUK B;  3KY9 A;  1PFJ A;  4HAY B;  1DDW A;  1FGZ A;  2DX1 A;  1W1D A;  1NTY A;  1XD4 A;  3V5W A;  2N0Y A;  1WI1 A;  2DFK A;  4CHJ A;  2DHJ A;  2D9V A;  5LON B;  1OMW A;  1XX0 A;  2LOX A;  3ZDT A;  2Y8G A;  3BJI A;  3ODW A;  5J3Y A;  5FI0 A;  1EGX A;  1FB8 A;  3A8P A;  3ULC A;  1ZVR A;  3PVW A;  2ADZ A;  4NSW A;  2CAY A;  1LB1 A;  4P7I A;  1Z87 A;  2D9W A;  1FOE A;  2K8E A;  1FHO A;  2UZR A;  2D9Y A;  2X18 A;  2G35 A;  2QKM A;  3M1I B;  2CRF A;  4HB4 B;  3PP2 A;  4PNK A;  2EJ8 A;  1IRS A;  1U29 A;  2UVM A;  3NWF A;  2Z14 A;  1U2B A;  2V76 A;  2CY5 A;  5LOP B;  1DYN A;  3KZ1 A;  2KIE A;  4F7U P;  1EVH A;  1BTN A;  3DXD A;  4C0A A;  4XWX A;  1ZC4 B;  1PLS A;  1WGQ A;  2YS5 A;  5M4Y B;  2EC1 A;  2XQN M;  4F7G A;  4GXB A;  4KHB B;  4GMV A;  5C6R A;  1FHW A;  3P7Z A;  2BCJ A;  1V89 A;  2IFS A;  3PG7 A;  2Y8F A;  2R0D A;  2ZKM X;  4MY6 A;  3OHM B;  1J19 A;  4GMX B;  4HDQ A;  1H4R A;  2VSZ A;  1FGY A;  2W2X C;  2ELB A;  3F5R A;  5DHA B;  2VRW B;  4MT7 A;  2PZ1 A;  2Q13 A;  2E2X A;  3FM8 C;  2FJL A;  4GOU A;  4A6F A;  3MDB C;  4K17 A;  1FHX A;  4KVG B;  4WSF A;  1EAZ A;  2I1K A;  2OTX A;  2DLW A;  2KR0 A;  3PEG A;  2IYB A;  2K49 A;  3TW1 A;  1GG3 A;  5GOW B;  2YSZ A;  3PVU A;  3SYX A;  4H8S A;  3B77 A;  2QKL A;  3ZVR A;  2D4Q A;  2J0J A;  2KCJ A;  2YT0 A;  1U5F A;  3DXE A;  2DA0 A;  4ZRJ A;  2LG1 A;  4B6H A;  4L6E A;  3CXB B;  3U7D A;  4CYE A;  2RGN B;  4Z2N A;  1P3R A;  3OAN A;  1P6S A;  2RSG A;  1U5D A;  4HHV A;  3WA0 A;  2J0M A;  2P0D A;  1DBH A;  2W2W A;  1XOD A;  1UPR A;  2Z0P A;  5HE3 A;  1SGH A;  3RCP A;  3UZT A;  4HAV B;  2I5F A;  1V5M A;  2D11 A;  3N7C A;  5D3V A;  5C5B A;  2DYQ A;  2NBV A;  4K81 A;  4TYZ A;  1UNQ A;  1M7E A;  3VOQ A;  3T06 A;  2GS0 A;  4EJN A;  3P6A A;  2K2J A;  2N23 A;  1X86 A;  2KGX B;  2EMT A;  1OQN A;  1XR0 B;  1DDV A;  5D3W A;  4CSQ A;  4EMO A;  1XCG A;  3G9W A;  4L1R A;  1UPQ A;  1B55 A;  1W1G A;  5LG4 B;  4IOY X;  1J0W A;  3NSU A;  1KZG A;  2YT1 A;  4DIX A;  2K2U A;  4HAW B;  1MIX A;  2FJU B;  5D27 A;  2HTH B;  3D8F A;  3KSY A;  4MK0 A;  2P0F A;  3CIK A;  3GYP A;  2COA A;  2KUQ A;  3ULB A;  4CHM A;  5CLL B;  4A5K A;  2NZ8 B;  5HE2 A;  2COF A;  1P5T A;  1ZM0 A;  1ZSQ A;  1QQG A;  2GCJ A;  4GZU A;  1M7R A;  5D3X A;  4HAZ B;  1TJ6 A;  4KHO A;  4DXA B;  4HB0 B;  3HK0 A;  2H7D A;  4A6F B;  1QC6 A;  3AU5 A;  4HB3 B;  2JP2 A;  1NI2 A;  3KRW A;  1W1H A;  2HE7 A;  1TXD A;  4WVF B;  2M14 A;  3DCX A;  2H7E A;  4ZRI A;  1UNR A;  2Z59 A;  3X23 A;  5DIF B;  4YL8 A;  4HSI A;  3TO1 A;  4QJ5 B;  2DHI A;  1I2H A;  4OSN A;  1PMS A;  1K5D B;  1RJ2 A;  1V61 A;  3NWD A;  3TCA A;  5D3Y A;  1X05 A;  1AWE A;  5DI9 B;  4GPT B;  2DX5 A;  4GN1 A;  2DTC A;  5KQ4 A;  3U8Z A;  1MAI A;  2L1C A;  2YS3 A;  2MWN B;  3HW2 B;  2Z13 A;  4K2P A; 
#chains in the Genus database with same CATH homology
 5C79 A;  4TKN A;  3VIA A;  4KHA A;  4YON A;  4HDO A;  1MIZ B;  1UEF A;  1H10 A;  2MDX A;  4EKU A;  3O96 A;  5DHF B;  1X1G A;  5C16 A;  1SHC A;  5C5B B;  2ZPY A;  2KUP A;  3SUZ A;  2GJY A;  4K2O A;  1V88 A;  2OQB A;  3HQC A;  2Y7B A;  2RNR B;  2UZS A;  1BTK A;  3TFM A;  3QIJ A;  1Q67 A;  1TQZ A;  3WYF B;  3MPX A;  5J3Q A;  2VKI A;  4DX8 A;  2R09 A;  1WJ1 A;  1ZC3 B;  1OY2 A;  1KI1 B;  4KAX B;  3TVV A;  4F7H A;  4PQ0 A;  2MKR A;  4WJ7 A;  5JLJ B;  2D9Z A;  4ZRK A;  4HAX B;  2L2I A;  1U27 A;  2COD A;  1MK9 B;  2D10 A;  2ROZ B;  5JHG A;  1V5P A;  2COC A;  5HE0 A;  3GYO A;  3BIN A;  1E5W A;  3KRX A;  3A8Q A;  3DXC A;  1AQC A;  1Y19 B;  2LOZ A;  2I5C A;  3SNH A;  1MKE A;  3IVF A;  5KQ1 A;  1X1F A;  1XKE A;  3ODX A;  3PVL A;  3SO6 A;  2YVC A;  5EFX A;  5DH9 B;  2EMS A;  1EF1 A;  2Z0Q A;  4HAU B;  2MFQ A;  4IFS A;  1KZ7 A;  2NMB A;  4A6K A;  1N3H A;  5HE1 A;  2DHK A;  5JP4 A;  5CLQ B;  1V5U A;  1WVH A;  5J3T A;  4NY0 A;  2AEH A;  4Z2M B;  2P8V A;  2GCL A;  3F0W A;  1NU2 A;  2J59 M;  2YRY A;  3D8D A;  2DN6 A;  4DBB A;  2P0H A;  2I1J A;  3PZD A;  2DKP A;  1GC7 A;  1FAO A;  1U5E A;  3AJ4 A;  4BBK A;  1DRO A;  2DYN A;  1WGU A;  2LYD A;  2M38 A;  2YF0 A;  2J0K A;  2K00 A;  3LJU X;  4IAP A;  1I7A A;  3D8E A;  3FSS A;  4A6H A;  5KCV A;  1DDM A;  3PSC A;  1BWN A;  1MK7 B;  3AU4 A;  3ODO A;  1LW3 A;  1NTV A;  3ML4 A;  1WG7 A;  1WJM A;  1U5G A;  2YS1 A;  2D2Q A;  2DKQ A;  1ISN A;  2LUL A;  1K5G B;  1GC6 A;  3FEH A;  5L81 A;  5FI1 A;  1Y5O A;  3QBV B;  2W2X D;  4Y94 A;  1UNP A;  2RVB B;  1RRP B;  2D9X A;  4HAT B;  4DX9 0;  2Z0O A;  2AL6 A;  3A98 B;  2CY4 A;  2LKO A;  3QWM A;  1X11 A;  1MPH A;  2RLO A;  2ROV A;  1BAK A;  4D0N B;  2ELA A;  5JHH A;  4HB2 B;  3SV1 A;  2RUK B;  3KY9 A;  1PFJ A;  4HAY B;  1DDW A;  1FGZ A;  2DX1 A;  1W1D A;  1NTY A;  1XD4 A;  3V5W A;  2N0Y A;  1WI1 A;  2DFK A;  4CHJ A;  2DHJ A;  2D9V A;  5LON B;  1OMW A;  1XX0 A;  2LOX A;  3ZDT A;  2Y8G A;  3BJI A;  3ODW A;  5J3Y A;  5FI0 A;  1EGX A;  1FB8 A;  3A8P A;  3ULC A;  1ZVR A;  3PVW A;  2ADZ A;  4NSW A;  2CAY A;  1LB1 A;  4P7I A;  1Z87 A;  2D9W A;  1FOE A;  1FHO A;  2UZR A;  2D9Y A;  2X18 A;  2G35 A;  3M1I B;  2QKM A;  2CRF A;  4HB4 B;  3PP2 A;  4PNK A;  2EJ8 A;  1IRS A;  1U29 A;  2UVM A;  1U2B A;  2V76 A;  2CY5 A;  5LOP B;  1DYN A;  3KZ1 A;  4F7U P;  1EVH A;  1BTN A;  3DXD A;  4C0A A;  4XWX A;  1ZC4 B;  1PLS A;  1WGQ A;  2YS5 A;  2EC1 A;  2XQN M;  4F7G A;  4GXB A;  4KHB B;  4GMV A;  5C6R A;  1FHW A;  3P7Z A;  2BCJ A;  1V89 A;  2IFS A;  3PG7 A;  2Y8F A;  2R0D A;  4MY6 A;  1J19 A;  4GMX B;  4HDQ A;  1H4R A;  2VSZ A;  1FGY A;  2W2X C;  2ELB A;  3F5R A;  5DHA B;  2VRW B;  4MT7 A;  2PZ1 A;  2Q13 A;  2E2X A;  3FM8 C;  2FJL A;  4A6F A;  3MDB C;  4K17 A;  1FHX A;  4KVG B;  4WSF A;  1EAZ A;  2I1K A;  2OTX A;  2DLW A;  3PEG A;  2IYB A;  3TW1 A;  1GG3 A;  5GOW B;  2YSZ A;  3PVU A;  3SYX A;  4H8S A;  2QKL A;  3ZVR A;  2D4Q A;  2J0J A;  2KCJ A;  2YT0 A;  1U5F A;  3DXE A;  2DA0 A;  4ZRJ A;  2LG1 A;  4B6H A;  4L6E A;  3CXB B;  3U7D A;  4CYE A;  2RGN B;  4Z2N A;  1P3R A;  3OAN A;  1P6S A;  2RSG A;  1U5D A;  4HHV A;  3WA0 A;  2J0M A;  2P0D A;  1DBH A;  2W2W A;  1XOD A;  1UPR A;  2Z0P A;  5HE3 A;  1SGH A;  3RCP A;  3UZT A;  4HAV B;  2I5F A;  1V5M A;  2D11 A;  3N7C A;  5D3V A;  5C5B A;  2DYQ A;  4K81 A;  4TYZ A;  1UNQ A;  1M7E A;  3VOQ A;  3T06 A;  2GS0 A;  4EJN A;  3P6A A;  2K2J A;  2N23 A;  1X86 A;  2KGX B;  2EMT A;  1OQN A;  1XR0 B;  1DDV A;  5D3W A;  4EMO A;  1XCG A;  3G9W A;  1UPQ A;  1B55 A;  1W1G A;  4IOY X;  1J0W A;  3NSU A;  1KZG A;  2YT1 A;  2K2U A;  4HAW B;  1MIX A;  5D27 A;  2HTH B;  3D8F A;  3KSY A;  4MK0 A;  2P0F A;  3CIK A;  3GYP A;  2COA A;  3ULB A;  4CHM A;  5CLL B;  4A5K A;  2NZ8 B;  5HE2 A;  2COF A;  1P5T A;  1ZM0 A;  1ZSQ A;  1QQG A;  2GCJ A;  4GZU A;  1M7R A;  5D3X A;  4HAZ B;  1TJ6 A;  4KHO A;  4DXA B;  4HB0 B;  3HK0 A;  2H7D A;  4A6F B;  1QC6 A;  3AU5 A;  4HB3 B;  2JP2 A;  1NI2 A;  3KRW A;  1W1H A;  2HE7 A;  1TXD A;  4WVF B;  2M14 A;  2H7E A;  4ZRI A;  1UNR A;  3X23 A;  5DIF B;  4YL8 A;  3TO1 A;  2DHI A;  1I2H A;  1PMS A;  1K5D B;  1RJ2 A;  1V61 A;  3TCA A;  5D3Y A;  1X05 A;  1AWE A;  5DI9 B;  4GPT B;  2DX5 A;  4GN1 A;  2DTC A;  5KQ4 A;  3U8Z A;  1MAI A;  2L1C A;  2YS3 A;  2MWN B;  3HW2 B;  4K2P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...