2GJYA

Nmr solution structure of tensin1 ptb domain
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
144
structure length
144
Chain Sequence
GSHMGAACNVLFINSVEMESLTGPQAISKAVAETLVADPTPTATIVHFKVSAQGITLTDNQRKLFFRRHYPLNTVTFCDLDPQERKWTKTDGSGPAKLFGFVARKQGSTTDNVCHLFAELDPDQPAAAIVNFVSRVMLGSGQKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tensin
publication title The PTB domain of tensin: NMR solution structure and phosphoinositides binding studies.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Cell adhesion
total genus 18
structure length 144
sequence length 144
ec nomenclature
pdb deposition date 2006-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08416 PTB Phosphotyrosine-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2gjyA00
2AL6A 3PP2A 4L6EA 1X1GA 4K2OA 1GC7A 2FJLA 4WJ7A 3KZ1A 2VSZA 5FI1A 1WVHA 2MDXA 4WVFB 2L1CA 1TJ6A 2CRFA 2P8VA 4ZRIA 5HE3A 1QC6A 3TCAA 5C79A 3WA0A 2YT0A 1PFJA 1GG3A 5JHGA 5KQ4A 3QWMA 4BBKA 1V89A 1V5UA 2QKLA 4D0NB 1WJMA 2LOXA 1DDWA 1PMSA 1P6SA 2P0HA 4ZRKA 2R0DA 1X1FA 2DHJA 3A8QA 2LULA 1WGUA 3A98B 3P7ZA 2J59M 4CYEA 2J0JA 4GZUA 2DHKA 2YS1A 3F0WA 3CIKA 3KRWA 1LB1A 2RSGA 4HAVB 3X23A 2D10A 1Y5OA 3AU4A 3DXCA 5C16A 2CODA 1SGHA 5LOPB 1FB8A 1DDVA 2DKPA 1U5FA 4IFSA 2VRWB 4IAPA 2D11A 2NZ8B 5D27A 1P3RA 4KAXB 3M1IB 4F7HA 1W1HA 2QKMA 2X18A 4K17A 2DHIA 3WYFB 2YVCA 2D2QA 4P7IA 3BINA 4PNKA 2MWNB 1FGYA 2D9WA 5DHAB 1B55A 3VIAA 2D9ZA 1XODA 2W2XC 1I2HA 2Q13A 1ISNA 1U2BA 1RJ2A 2COCA 2D9XA 3KSYA 3GYPA 2W2XD 5DHFB 3FEHA 3HQCA 1BTNA 3IVFA 1ZM0A 3DXDA 3SUZA 4TYZA 4HB3B 4HAXB 2Z0PA 4WSFA 5CLQB 2N0YA 4DXAB 5C5BA 2DYQA 2EJ8A 1Z87A 1NU2A 1Q67A 2CY5A 2Y7BA 2DLWA 1WI1A 1MK9B 2YRYA 2DA0A 1X86A 3SNHA 1NTYA 2W2WA 3AU5A 5L81A 1V61A 1KI1B 1N3HA 1U5DA 2E2XA 4YONA 3QIJA 1OMWA 2GCLA 4EMOA 1EAZA 2DX5A 4GXBA 1MIZB 2M38A 3TW1A 3V5WA 3UZTA 5J3QA 1BAKA 1OQNA 3ODXA 2LKOA 3F5RA 1UPQA 4Z2MB 3A8PA 1XR0B 3VOQA 2MKRA 1OY2A 5D3YA 2OQBA 4DX8A 1FHOA 1J0WA 1H4RA 4YL8A 1XX0A 3KRXA 2LYDA 2VKIA 3SO6A 1MKEA 1X11A 1P5TA 1UEFA 5C5BB 1DYNA 3ODWA 2RGNB 4HB2B 3ULBA 2J0KA 4HDQA 2YT1A 4KHOA 2Z0OA 1H10A 3ULCA 2LOZA 2ELAA 2H7EA 4HAYB 3HW2B 2GS0A 3PG7A 4DBBA 4GN1A 1NI2A 3PZDA 3RCPA 2YS3A 1ZC3B 5HE1A 2RNRB 4GPTB 1WG7A 1EF1A 1XD4A 4A5KA 3KY9A 1BTKA 2D9VA 1J19A 5DH9B 2LG1A 1V5MA 3FSSA 3T06A 1ZSQA 2Y8FA 2L2IA 2G35A 4A6KA 5EFXA 2XQNM 1EVHA 5KCVA 3PVUA 2HTHB 3D8EA 5JP4A 5GOWB 4CHJA 5HE0A 1NTVA 1MIXA 1AQCA 3SYXA 5HE2A 3PSCA 2V76A 2EC1A 4HAUB 3N7CA 5D3VA 2MFQA 4PQ0A 3ZDTA 1X05A 2M14A 4HHVA 1MK7B 2I5FA 4Z2NA 3LJUX 1U5GA 5CLLB 1WJ1A 3D8FA 2EMTA 2P0DA 3TFMA 1U29A 1M7EA 4ZRJA 1XKEA 4C0AA 1MAIA 1MPHA 2D9YA 2D4QA 1EGXA 3U7DA 2RVBB 4MY6A 3MDBC 5J3TA 1Y19B 1DROA 2IFSA 3BJIA 1BWNA 4KHBB 1U5EA 4F7UP 4CHMA 5JLJB 4A6FA 1TXDA 4DX90 4GMXB 4HAZB 2BCJA 1K5GB 4HB0B 4EKUA 4K2PA 1I7AA 1W1GA 2COFA 3QBVB 1GC6A 2ELBA 1WGQA 1FHWA 1QQGA 1FOEA 4HB4B 4F7GA 2I1JA 3GYOA 1V5PA 3G9WA 2CAYA 5J3YA 2YF0A 2Y8GA 1SHCA 3PVLA 2COAA 1KZGA 4NSWA 3HK0A 1FAOA 1K5DB 2K2JA 2RUKB 1E5WA 2N23A 1IRSA 2P0FA 3TO1A 2I1KA 1UPRA 1UNPA 3NSUA 4KVGB 1DBHA 5JHHA 3MPXA 2R09A 2DN6A 4TKNA 1KZ7A 5KQ1A 5LONB 3D8DA 4H8SA 2AEHA 1ZVRA 3PEGA 5C6RA 4A6FB 3OANA 1U27A 4MK0A 2EMSA 4EJNA 4A6HA 3ZVRA 3PVWA 1PLSA 2JP2A 2ADZA 2KGXB 2DTCA 3O96A 2DKQA 2GCJA 3CXBB 4HDOA 1LW3A 2KCJA 2RLOA 4KHAA 2I5CA 2ROVA 2UVMA 3ODOA 4Y94A 2J0MA 4B6HA 2NMBA 4XWXA 3P6AA 5D3XA 1V88A 2YSZA 4MT7A 5D3WA 2KUPA 2H7DA 1UNRA 4HATB 1XCGA 2HE7A 2UZRA 1FGZA 1UNQA 3FM8C 2DX1A 1ZC4B 1M7RA 4HAWB 2DYNA 1W1DA 4NY0A 1RRPB 4IOYX 2ZPYA 2PZ1A 2GJYA 5FI0A 2CY4A 4GMVA 3SV1A 5DI9B 1FHXA 2ROZB 1DDMA 1AWEA 2K2UA 2Z0QA 4K81A 2IYBA 2DFKA 2K00A 3U8ZA 2UZSA 2YS5A 3ML4A 1TQZA 3AJ4A 3DXEA 3TVVA 5DIFB 2OTXA
chains in the Genus database with same CATH superfamily
2AL6A 5I2MA 3PP2A 4L6EA 1X1GA 4K2OA 1GC7A 2FJLA 4WJ7A 3KZ1A 2VSZA 5FI1A 1WVHA 2MDXA 3NWAA 4WVFB 2L1CA 1TJ6A 2CRFA 2P8VA 4ZRIA 5HE3A 1QC6A 3TCAA 5C79A 3WA0A 2YT0A 1PFJA 1GG3A 5JHGA 5KQ4A 3QWMA 4BBKA 1V89A 1V5UA 2QKLA 4D0NB 1WJMA 2LOXA 1DDWA 1PMSA 1P6SA 2P0HA 4ZRKA 2R0DA 1X1FA 2DHJA 3A8QA 2LULA 2K49A 1WGUA 2KR0A 3A98B 3P7ZA 2J59M 4CYEA 2J0JA 4GZUA 2DHKA 2YS1A 3F0WA 3CIKA 3KRWA 1LB1A 2RSGA 4HAVB 3X23A 2D10A 1Y5OA 3AU4A 3DXCA 2Z59A 5C16A 2CODA 1SGHA 5LOPB 1FB8A 1DDVA 2DKPA 1U5FA 4IFSA 2VRWB 4IAPA 2D11A 2NZ8B 5D27A 1P3RA 4KAXB 3M1IB 4F7HA 1W1HA 2QKMA 2X18A 2GUMA 4K17A 2DHIA 3WYFB 2YVCA 2D2QA 4QJ4B 4P7IA 3BINA 4PNKA 2MWNB 1FGYA 2D9WA 3U12A 5DHAB 1B55A 3VIAA 2D9ZA 1XODA 2W2XC 1I2HA 2Q13A 1ISNA 1U2BA 1RJ2A 2COCA 2D9XA 3KSYA 3HSAA 3GYPA 2W2XD 5DHFB 3FEHA 3HQCA 1BTNA 3IVFA 1ZM0A 3DXDA 3B77A 3SUZA 4TYZA 4HB3B 4HAXB 2Z0PA 4WSFA 5CLQB 2N0YA 4DXAB 5C5BA 2DYQA 2EJ8A 1Z87A 1NU2A 1Q67A 2CY5A 2Y7BA 2DLWA 1WI1A 1MK9B 2YRYA 2DA0A 1X86A 3SNHA 1NTYA 2W2WA 3AU5A 5L81A 1V61A 1KI1B 1N3HA 1U5DA 3NWDA 2E2XA 4YONA 3QIJA 1OMWA 2GCLA 4EMOA 1EAZA 2DX5A 4GXBA 1MIZB 1ZYIA 2M38A 3TW1A 5IRSA 3V5WA 3UZTA 5J3QA 1BAKA 1OQNA 3ODXA 2LKOA 3F5RA 1UPQA 2KIEA 2ZKMX 3A8PA 4Z2MB 2R2YA 1XR0B 3VOQA 2MKRA 1OY2A 5D3YA 4HSIA 2OQBA 4DX8A 1FHOA 3OHMB 1J0WA 1H4RA 4YL8A 1XX0A 3KRXA 2LYDA 2VKIA 3SO6A 1MKEA 1X11A 1P5TA 1UEFA 5C5BB 1DYNA 3ODWA 2RGNB 4HB2B 3ULBA 2J0KA 4HDQA 2YT1A 4KHOA 2Z0OA 1H10A 3ULCA 2LOZA 2ELAA 2H7EA 4OSNA 4HAYB 3HW2B 2GS0A 3PG7A 4DBBA 4GN1A 1NI2A 3PZDA 3RCPA 2YS3A 1ZC3B 5HE1A 3NWFA 2RNRB 4GPTB 1WG7A 1EF1A 1XD4A 4A5KA 3KY9A 1BTKA 4CSQA 2D9VA 1J19A 5DH9B 2LG1A 4QJ5B 5M4YB 1V5MA 3FSSA 3T06A 1MI1A 1ZSQA 2KIGA 2Y8FA 2L2IA 2G35A 4A6KA 5EFXA 2XQNM 1EVHA 5KCVA 3PVUA 3HIEA 2HTHB 3D8EA 5JP4A 2K8EA 5GOWB 4CHJA 5HE0A 1NTVA 1MIXA 1AQCA 3SYXA 5HE2A 3PSCA 2V76A 2EC1A 4HAUB 3N7CA 4GOUA 5D3VA 2MFQA 4PQ0A 3ZDTA 1X05A 2M14A 2Z4DA 4HHVA 1MK7B 2I5FA 3NW8A 4Z2NA 3LJUX 1U5GA 5CLLB 1WJ1A 2FJUB 3D8FA 2EMTA 2P0DA 3TFMA 1U29A 1M7EA 4ZRJA 4DIXA 1XKEA 4C0AA 2RRFA 1MAIA 1MPHA 2D9YA 2D4QA 1EGXA 3U7DA 2RVBB 4MY6A 3MDBC 5J3TA 1Y19B 1DROA 2IFSA 3BJIA 1BWNA 4KHBB 1U5EA 4F7UP 4CHMA 5JLJB 4A6FA 2NBVA 1TXDA 4DX90 4GMXB 4HAZB 2BCJA 1K5GB 4HB0B 4EKUA 4K2PA 1I7AA 1W1GA 2KUQA 2COFA 3QBVB 1GC6A 2ELBA 1WGQA 1FHWA 1QQGA 1FOEA 4HB4B 4F7GA 2I1JA 3GYOA 1V5PA 3G9WA 2CAYA 2Z13A 5J3YA 2YF0A 2Y8GA 1SHCA 3PVLA 4D6WA 2Z14A 2COAA 1KZGA 4NSWA 3HK0A 1FAOA 1K5DB 2K2JA 2RUKB 1E5WA 2N23A 1IRSA 2P0FA 3TO1A 2I1KA 1UPRA 1UNPA 3NSUA 4KVGB 1DBHA 5JHHA 3MPXA 2R09A 2DN6A 4TKNA 4QXAB 1KZ7A 5KQ1A 5LONB 3D8DA 4H8SA 2AEHA 4OT1A 1ZVRA 3PEGA 5C6RA 4A6FB 3OANA 1U27A 4L1RA 4MK0A 2EMSA 3DCXA 4EJNA 4A6HA 4KHBA 3ZVRA 3PVWA 1PLSA 2JP2A 2ADZA 2KGXB 2DTCA 3O96A 2DKQA 2GCJA 3CXBB 4HDOA 1LW3A 2KCJA 2RLOA 4KHAA 2I5CA 2ROVA 2UVMA 3ODOA 4Y94A 2YT2A 2J0MA 4B6HA 2NMBA 4XWXA 3P6AA 5D3XA 1V88A 2YSZA 4MT7A 5D3WA 2KUPA 2H7DA 1UNRA 4HATB 4QJ3B 4GNKB 1XCGA 2HE7A 2UZRA 1FGZA 1UNQA 3FM8C 2DX1A 1ZC4B 1M7RA 4HAWB 2DYNA 3A58A 1W1DA 4NY0A 1RRPB 4IOYX 2ZPYA 2PZ1A 2GJYA 5FI0A 1T77A 2CY4A 4GMVA 3SV1A 5LG4B 5DI9B 1FHXA 2ROZB 1DDMA 1AWEA 5I2SA 2K2UA 2Z0QA 4K81A 2IYBA 2DFKA 2K00A 3FVCA 3U8ZA 2UZSA 2YS5A 3ML4A 1TQZA 3AJ4A 3DXEA 3TVVA 5DIFB 2OTXA
chains in the Genus database with same CATH topology
2AL6A 3PP2A 4L6EA 1X1GA 4K2OA 1GC7A 2FJLA 4WJ7A 3KZ1A 2VSZA 5FI1A 1WVHA 2MDXA 4WVFB 2L1CA 1TJ6A 2CRFA 2P8VA 4ZRIA 5HE3A 1QC6A 3TCAA 5C79A 3WA0A 2YT0A 1PFJA 1GG3A 5JHGA 5KQ4A 3QWMA 4BBKA 1V89A 1V5UA 2QKLA 4D0NB 1WJMA 2LOXA 1DDWA 1PMSA 1P6SA 2P0HA 4ZRKA 2R0DA 1X1FA 2DHJA 3A8QA 2LULA 1WGUA 3A98B 3P7ZA 2J59M 4CYEA 2J0JA 4GZUA 2DHKA 2YS1A 3F0WA 3CIKA 3KRWA 1LB1A 2RSGA 4HAVB 3X23A 2D10A 1Y5OA 3AU4A 3DXCA 5C16A 2CODA 1SGHA 5LOPB 1FB8A 1DDVA 2DKPA 1U5FA 4IFSA 2VRWB 4IAPA 2D11A 2NZ8B 5D27A 1P3RA 4KAXB 3M1IB 4F7HA 1W1HA 2QKMA 2X18A 4K17A 2DHIA 3WYFB 2YVCA 2D2QA 4P7IA 3BINA 4PNKA 2MWNB 1FGYA 2D9WA 5DHAB 1B55A 3VIAA 2D9ZA 1XODA 2W2XC 1I2HA 2Q13A 1ISNA 1U2BA 1RJ2A 2COCA 2D9XA 3KSYA 3GYPA 2W2XD 5DHFB 3FEHA 3HQCA 1BTNA 3IVFA 1ZM0A 3DXDA 3SUZA 4TYZA 4HB3B 4HAXB 2Z0PA 4WSFA 5CLQB 2N0YA 4DXAB 5C5BA 2DYQA 2EJ8A 1Z87A 1NU2A 1Q67A 2CY5A 2Y7BA 2DLWA 1WI1A 1MK9B 2YRYA 2DA0A 1X86A 3SNHA 1NTYA 2W2WA 3AU5A 5L81A 1V61A 1KI1B 1N3HA 1U5DA 2E2XA 4YONA 3QIJA 1OMWA 2GCLA 4EMOA 1EAZA 2DX5A 4GXBA 1MIZB 2M38A 3TW1A 3V5WA 3UZTA 5J3QA 1BAKA 1OQNA 3ODXA 2LKOA 3F5RA 1UPQA 4Z2MB 3A8PA 1XR0B 3VOQA 2MKRA 1OY2A 5D3YA 2OQBA 4DX8A 1FHOA 1J0WA 1H4RA 4YL8A 1XX0A 3KRXA 2LYDA 2VKIA 3SO6A 1MKEA 1X11A 1P5TA 1UEFA 5C5BB 1DYNA 3ODWA 2RGNB 4HB2B 3ULBA 2J0KA 4HDQA 2YT1A 4KHOA 2Z0OA 1H10A 3ULCA 2LOZA 2ELAA 2H7EA 4HAYB 3HW2B 2GS0A 3PG7A 4DBBA 4GN1A 1NI2A 3PZDA 3RCPA 2YS3A 1ZC3B 5HE1A 2RNRB 4GPTB 1WG7A 1EF1A 1XD4A 4A5KA 3KY9A 1BTKA 2D9VA 1J19A 5DH9B 2LG1A 1V5MA 3FSSA 3T06A 1ZSQA 2Y8FA 2L2IA 2G35A 4A6KA 5EFXA 2XQNM 1EVHA 5KCVA 3PVUA 2HTHB 3D8EA 5JP4A 5GOWB 4CHJA 5HE0A 1NTVA 1MIXA 1AQCA 3SYXA 5HE2A 3PSCA 2V76A 2EC1A 4HAUB 3N7CA 5D3VA 2MFQA 4PQ0A 3ZDTA 1X05A 2M14A 4HHVA 1MK7B 2I5FA 4Z2NA 3LJUX 1U5GA 5CLLB 1WJ1A 3D8FA 2EMTA 2P0DA 3TFMA 1U29A 1M7EA 4ZRJA 1XKEA 4C0AA 1MAIA 1MPHA 2D9YA 2D4QA 1EGXA 3U7DA 2RVBB 4MY6A 3MDBC 5J3TA 1Y19B 1DROA 2IFSA 3BJIA 1BWNA 4KHBB 1U5EA 4F7UP 4CHMA 5JLJB 4A6FA 1TXDA 4DX90 4GMXB 4HAZB 2BCJA 1K5GB 4HB0B 4EKUA 4K2PA 1I7AA 1W1GA 2COFA 3QBVB 1GC6A 2ELBA 1WGQA 1FHWA 1QQGA 1FOEA 4HB4B 4F7GA 2I1JA 3GYOA 1V5PA 3G9WA 2CAYA 5J3YA 2YF0A 2Y8GA 1SHCA 3PVLA 2COAA 1KZGA 4NSWA 3HK0A 1FAOA 1K5DB 2K2JA 2RUKB 1E5WA 2N23A 1IRSA 2P0FA 3TO1A 2I1KA 1UPRA 1UNPA 3NSUA 4KVGB 1DBHA 5JHHA 3MPXA 2R09A 2DN6A 4TKNA 1KZ7A 5KQ1A 5LONB 3D8DA 4H8SA 2AEHA 1ZVRA 3PEGA 5C6RA 4A6FB 3OANA 1U27A 4MK0A 2EMSA 4EJNA 4A6HA 3ZVRA 3PVWA 1PLSA 2JP2A 2ADZA 2KGXB 2DTCA 3O96A 2DKQA 2GCJA 3CXBB 4HDOA 1LW3A 2KCJA 2RLOA 4KHAA 2I5CA 2ROVA 2UVMA 3ODOA 4Y94A 2J0MA 4B6HA 2NMBA 4XWXA 3P6AA 5D3XA 1V88A 2YSZA 4MT7A 5D3WA 2KUPA 2H7DA 1UNRA 4HATB 1XCGA 2HE7A 2UZRA 1FGZA 1UNQA 3FM8C 2DX1A 1ZC4B 1M7RA 4HAWB 2DYNA 1W1DA 4NY0A 1RRPB 4IOYX 2ZPYA 2PZ1A 2GJYA 5FI0A 2CY4A 4GMVA 3SV1A 5DI9B 1FHXA 2ROZB 1DDMA 1AWEA 2K2UA 2Z0QA 4K81A 2IYBA 2DFKA 2K00A 3U8ZA 2UZSA 2YS5A 3ML4A 1TQZA 3AJ4A 3DXEA 3TVVA 5DIFB 2OTXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AL6 A;  3PP2 A;  4L6E A;  1X1G A;  4K2O A;  1GC7 A;  2FJL A;  4WJ7 A;  3KZ1 A;  2VSZ A;  5FI1 A;  1WVH A;  2MDX A;  4WVF B;  2L1C A;  1TJ6 A;  2CRF A;  2P8V A;  4ZRI A;  5HE3 A;  1QC6 A;  3TCA A;  5C79 A;  3WA0 A;  2YT0 A;  1PFJ A;  1GG3 A;  5JHG A;  5KQ4 A;  3QWM A;  4BBK A;  1V89 A;  1V5U A;  2QKL A;  4D0N B;  1WJM A;  2LOX A;  1DDW A;  1PMS A;  1P6S A;  2P0H A;  4ZRK A;  2R0D A;  1X1F A;  2DHJ A;  3A8Q A;  2LUL A;  1WGU A;  3A98 B;  3P7Z A;  2J59 M;  4CYE A;  2J0J A;  4GZU A;  2DHK A;  2YS1 A;  3F0W A;  3CIK A;  3KRW A;  1LB1 A;  2RSG A;  4HAV B;  3X23 A;  2D10 A;  1Y5O A;  3AU4 A;  3DXC A;  5C16 A;  2COD A;  1SGH A;  5LOP B;  1FB8 A;  1DDV A;  2DKP A;  1U5F A;  4IFS A;  2VRW B;  4IAP A;  2D11 A;  2NZ8 B;  5D27 A;  1P3R A;  4KAX B;  3M1I B;  4F7H A;  1W1H A;  2QKM A;  2X18 A;  4K17 A;  2DHI A;  3WYF B;  2YVC A;  2D2Q A;  4P7I A;  3BIN A;  4PNK A;  2MWN B;  1FGY A;  2D9W A;  5DHA B;  1B55 A;  3VIA A;  2D9Z A;  1XOD A;  2W2X C;  1I2H A;  2Q13 A;  1ISN A;  1U2B A;  1RJ2 A;  2COC A;  2D9X A;  3KSY A;  3GYP A;  2W2X D;  5DHF B;  3FEH A;  3HQC A;  1BTN A;  3IVF A;  1ZM0 A;  3DXD A;  3SUZ A;  4TYZ A;  4HB3 B;  4HAX B;  2Z0P A;  4WSF A;  5CLQ B;  2N0Y A;  4DXA B;  5C5B A;  2DYQ A;  2EJ8 A;  1Z87 A;  1NU2 A;  1Q67 A;  2CY5 A;  2Y7B A;  2DLW A;  1WI1 A;  1MK9 B;  2YRY A;  2DA0 A;  1X86 A;  3SNH A;  1NTY A;  2W2W A;  3AU5 A;  5L81 A;  1V61 A;  1KI1 B;  1N3H A;  1U5D A;  2E2X A;  4YON A;  3QIJ A;  1OMW A;  2GCL A;  4EMO A;  1EAZ A;  2DX5 A;  4GXB A;  1MIZ B;  2M38 A;  3TW1 A;  3V5W A;  3UZT A;  5J3Q A;  1BAK A;  1OQN A;  3ODX A;  2LKO A;  3F5R A;  1UPQ A;  4Z2M B;  3A8P A;  1XR0 B;  3VOQ A;  2MKR A;  1OY2 A;  5D3Y A;  2OQB A;  4DX8 A;  1FHO A;  1J0W A;  1H4R A;  4YL8 A;  1XX0 A;  3KRX A;  2LYD A;  2VKI A;  3SO6 A;  1MKE A;  1X11 A;  1P5T A;  1UEF A;  5C5B B;  1DYN A;  3ODW A;  2RGN B;  4HB2 B;  3ULB A;  2J0K A;  4HDQ A;  2YT1 A;  4KHO A;  2Z0O A;  1H10 A;  3ULC A;  2LOZ A;  2ELA A;  2H7E A;  4HAY B;  3HW2 B;  2GS0 A;  3PG7 A;  4DBB A;  4GN1 A;  1NI2 A;  3PZD A;  3RCP A;  2YS3 A;  1ZC3 B;  5HE1 A;  2RNR B;  4GPT B;  1WG7 A;  1EF1 A;  1XD4 A;  4A5K A;  3KY9 A;  1BTK A;  2D9V A;  1J19 A;  5DH9 B;  2LG1 A;  1V5M A;  3FSS A;  3T06 A;  1ZSQ A;  2Y8F A;  2L2I A;  2G35 A;  4A6K A;  5EFX A;  2XQN M;  1EVH A;  5KCV A;  3PVU A;  2HTH B;  3D8E A;  5JP4 A;  5GOW B;  4CHJ A;  5HE0 A;  1NTV A;  1MIX A;  1AQC A;  3SYX A;  5HE2 A;  3PSC A;  2V76 A;  2EC1 A;  4HAU B;  3N7C A;  5D3V A;  2MFQ A;  4PQ0 A;  3ZDT A;  1X05 A;  2M14 A;  4HHV A;  1MK7 B;  2I5F A;  4Z2N A;  3LJU X;  1U5G A;  5CLL B;  1WJ1 A;  3D8F A;  2EMT A;  2P0D A;  3TFM A;  1U29 A;  1M7E A;  4ZRJ A;  1XKE A;  4C0A A;  1MAI A;  1MPH A;  2D9Y A;  2D4Q A;  1EGX A;  3U7D A;  2RVB B;  4MY6 A;  3MDB C;  5J3T A;  1Y19 B;  1DRO A;  2IFS A;  3BJI A;  1BWN A;  4KHB B;  1U5E A;  4F7U P;  4CHM A;  5JLJ B;  4A6F A;  1TXD A;  4DX9 0;  4GMX B;  4HAZ B;  2BCJ A;  1K5G B;  4HB0 B;  4EKU A;  4K2P A;  1I7A A;  1W1G A;  2COF A;  3QBV B;  1GC6 A;  2ELB A;  1WGQ A;  1FHW A;  1QQG A;  1FOE A;  4HB4 B;  4F7G A;  2I1J A;  3GYO A;  1V5P A;  3G9W A;  2CAY A;  5J3Y A;  2YF0 A;  2Y8G A;  1SHC A;  3PVL A;  2COA A;  1KZG A;  4NSW A;  3HK0 A;  1FAO A;  1K5D B;  2K2J A;  2RUK B;  1E5W A;  2N23 A;  1IRS A;  2P0F A;  3TO1 A;  2I1K A;  1UPR A;  1UNP A;  3NSU A;  4KVG B;  1DBH A;  5JHH A;  3MPX A;  2R09 A;  2DN6 A;  4TKN A;  1KZ7 A;  5KQ1 A;  5LON B;  3D8D A;  4H8S A;  2AEH A;  1ZVR A;  3PEG A;  5C6R A;  4A6F B;  3OAN A;  1U27 A;  4MK0 A;  2EMS A;  4EJN A;  4A6H A;  3ZVR A;  3PVW A;  1PLS A;  2JP2 A;  2ADZ A;  2KGX B;  2DTC A;  3O96 A;  2DKQ A;  2GCJ A;  3CXB B;  4HDO A;  1LW3 A;  2KCJ A;  2RLO A;  4KHA A;  2I5C A;  2ROV A;  2UVM A;  3ODO A;  4Y94 A;  2J0M A;  4B6H A;  2NMB A;  4XWX A;  3P6A A;  5D3X A;  1V88 A;  2YSZ A;  4MT7 A;  5D3W A;  2KUP A;  2H7D A;  1UNR A;  4HAT B;  1XCG A;  2HE7 A;  2UZR A;  1FGZ A;  1UNQ A;  3FM8 C;  2DX1 A;  1ZC4 B;  1M7R A;  4HAW B;  2DYN A;  1W1D A;  4NY0 A;  1RRP B;  4IOY X;  2ZPY A;  2PZ1 A;  2GJY A;  5FI0 A;  2CY4 A;  4GMV A;  3SV1 A;  5DI9 B;  1FHX A;  2ROZ B;  1DDM A;  1AWE A;  2K2U A;  2Z0Q A;  4K81 A;  2IYB A;  2DFK A;  2K00 A;  3U8Z A;  2UZS A;  2YS5 A;  3ML4 A;  1TQZ A;  3AJ4 A;  3DXE A;  3TVV A;  5DIF B;  2OTX A; 
#chains in the Genus database with same CATH topology
 2AL6 A;  5I2M A;  3PP2 A;  4L6E A;  1X1G A;  4K2O A;  1GC7 A;  2FJL A;  4WJ7 A;  3KZ1 A;  2VSZ A;  5FI1 A;  1WVH A;  2MDX A;  3NWA A;  4WVF B;  2L1C A;  1TJ6 A;  2CRF A;  2P8V A;  4ZRI A;  5HE3 A;  1QC6 A;  3TCA A;  5C79 A;  3WA0 A;  2YT0 A;  1PFJ A;  1GG3 A;  5JHG A;  5KQ4 A;  3QWM A;  4BBK A;  1V89 A;  1V5U A;  2QKL A;  4D0N B;  1WJM A;  2LOX A;  1DDW A;  1PMS A;  1P6S A;  2P0H A;  4ZRK A;  2R0D A;  1X1F A;  2DHJ A;  3A8Q A;  2LUL A;  2K49 A;  1WGU A;  2KR0 A;  3A98 B;  3P7Z A;  2J59 M;  4CYE A;  2J0J A;  4GZU A;  2DHK A;  2YS1 A;  3F0W A;  3CIK A;  3KRW A;  1LB1 A;  2RSG A;  4HAV B;  3X23 A;  2D10 A;  1Y5O A;  3AU4 A;  3DXC A;  2Z59 A;  5C16 A;  2COD A;  1SGH A;  5LOP B;  1FB8 A;  1DDV A;  2DKP A;  1U5F A;  4IFS A;  2VRW B;  4IAP A;  2D11 A;  2NZ8 B;  5D27 A;  1P3R A;  4KAX B;  3M1I B;  4F7H A;  1W1H A;  2QKM A;  2X18 A;  2GUM A;  4K17 A;  2DHI A;  3WYF B;  2YVC A;  2D2Q A;  4QJ4 B;  4P7I A;  3BIN A;  4PNK A;  2MWN B;  1FGY A;  2D9W A;  3U12 A;  5DHA B;  1B55 A;  3VIA A;  2D9Z A;  1XOD A;  2W2X C;  1I2H A;  2Q13 A;  1ISN A;  1U2B A;  1RJ2 A;  2COC A;  2D9X A;  3KSY A;  3HSA A;  3GYP A;  2W2X D;  5DHF B;  3FEH A;  3HQC A;  1BTN A;  3IVF A;  1ZM0 A;  3DXD A;  3B77 A;  3SUZ A;  4TYZ A;  4HB3 B;  4HAX B;  2Z0P A;  4WSF A;  5CLQ B;  2N0Y A;  4DXA B;  5C5B A;  2DYQ A;  2EJ8 A;  1Z87 A;  1NU2 A;  1Q67 A;  2CY5 A;  2Y7B A;  2DLW A;  1WI1 A;  1MK9 B;  2YRY A;  2DA0 A;  1X86 A;  3SNH A;  1NTY A;  2W2W A;  3AU5 A;  5L81 A;  1V61 A;  1KI1 B;  1N3H A;  1U5D A;  3NWD A;  2E2X A;  4YON A;  3QIJ A;  1OMW A;  2GCL A;  4EMO A;  1EAZ A;  2DX5 A;  4GXB A;  1MIZ B;  1ZYI A;  2M38 A;  3TW1 A;  5IRS A;  3V5W A;  3UZT A;  5J3Q A;  1BAK A;  1OQN A;  3ODX A;  2LKO A;  3F5R A;  1UPQ A;  2KIE A;  2ZKM X;  3A8P A;  4Z2M B;  2R2Y A;  1XR0 B;  3VOQ A;  2MKR A;  1OY2 A;  5D3Y A;  4HSI A;  2OQB A;  4DX8 A;  1FHO A;  3OHM B;  1J0W A;  1H4R A;  4YL8 A;  1XX0 A;  3KRX A;  2LYD A;  2VKI A;  3SO6 A;  1MKE A;  1X11 A;  1P5T A;  1UEF A;  5C5B B;  1DYN A;  3ODW A;  2RGN B;  4HB2 B;  3ULB A;  2J0K A;  4HDQ A;  2YT1 A;  4KHO A;  2Z0O A;  1H10 A;  3ULC A;  2LOZ A;  2ELA A;  2H7E A;  4OSN A;  4HAY B;  3HW2 B;  2GS0 A;  3PG7 A;  4DBB A;  4GN1 A;  1NI2 A;  3PZD A;  3RCP A;  2YS3 A;  1ZC3 B;  5HE1 A;  3NWF A;  2RNR B;  4GPT B;  1WG7 A;  1EF1 A;  1XD4 A;  4A5K A;  3KY9 A;  1BTK A;  4CSQ A;  2D9V A;  1J19 A;  5DH9 B;  2LG1 A;  4QJ5 B;  5M4Y B;  1V5M A;  3FSS A;  3T06 A;  1MI1 A;  1ZSQ A;  2KIG A;  2Y8F A;  2L2I A;  2G35 A;  4A6K A;  5EFX A;  2XQN M;  1EVH A;  5KCV A;  3PVU A;  3HIE A;  2HTH B;  3D8E A;  5JP4 A;  2K8E A;  5GOW B;  4CHJ A;  5HE0 A;  1NTV A;  1MIX A;  1AQC A;  3SYX A;  5HE2 A;  3PSC A;  2V76 A;  2EC1 A;  4HAU B;  3N7C A;  4GOU A;  5D3V A;  2MFQ A;  4PQ0 A;  3ZDT A;  1X05 A;  2M14 A;  2Z4D A;  4HHV A;  1MK7 B;  2I5F A;  3NW8 A;  4Z2N A;  3LJU X;  1U5G A;  5CLL B;  1WJ1 A;  2FJU B;  3D8F A;  2EMT A;  2P0D A;  3TFM A;  1U29 A;  1M7E A;  4ZRJ A;  4DIX A;  1XKE A;  4C0A A;  2RRF A;  1MAI A;  1MPH A;  2D9Y A;  2D4Q A;  1EGX A;  3U7D A;  2RVB B;  4MY6 A;  3MDB C;  5J3T A;  1Y19 B;  1DRO A;  2IFS A;  3BJI A;  1BWN A;  4KHB B;  1U5E A;  4F7U P;  4CHM A;  5JLJ B;  4A6F A;  2NBV A;  1TXD A;  4DX9 0;  4GMX B;  4HAZ B;  2BCJ A;  1K5G B;  4HB0 B;  4EKU A;  4K2P A;  1I7A A;  1W1G A;  2KUQ A;  2COF A;  3QBV B;  1GC6 A;  2ELB A;  1WGQ A;  1FHW A;  1QQG A;  1FOE A;  4HB4 B;  4F7G A;  2I1J A;  3GYO A;  1V5P A;  3G9W A;  2CAY A;  2Z13 A;  5J3Y A;  2YF0 A;  2Y8G A;  1SHC A;  3PVL A;  4D6W A;  2Z14 A;  2COA A;  1KZG A;  4NSW A;  3HK0 A;  1FAO A;  1K5D B;  2K2J A;  2RUK B;  1E5W A;  2N23 A;  1IRS A;  2P0F A;  3TO1 A;  2I1K A;  1UPR A;  1UNP A;  3NSU A;  4KVG B;  1DBH A;  5JHH A;  3MPX A;  2R09 A;  2DN6 A;  4TKN A;  4QXA B;  1KZ7 A;  5KQ1 A;  5LON B;  3D8D A;  4H8S A;  2AEH A;  4OT1 A;  1ZVR A;  3PEG A;  5C6R A;  4A6F B;  3OAN A;  1U27 A;  4L1R A;  4MK0 A;  2EMS A;  3DCX A;  4EJN A;  4A6H A;  4KHB A;  3ZVR A;  3PVW A;  1PLS A;  2JP2 A;  2ADZ A;  2KGX B;  2DTC A;  3O96 A;  2DKQ A;  2GCJ A;  3CXB B;  4HDO A;  1LW3 A;  2KCJ A;  2RLO A;  4KHA A;  2I5C A;  2ROV A;  2UVM A;  3ODO A;  4Y94 A;  2YT2 A;  2J0M A;  4B6H A;  2NMB A;  4XWX A;  3P6A A;  5D3X A;  1V88 A;  2YSZ A;  4MT7 A;  5D3W A;  2KUP A;  2H7D A;  1UNR A;  4HAT B;  4QJ3 B;  4GNK B;  1XCG A;  2HE7 A;  2UZR A;  1FGZ A;  1UNQ A;  3FM8 C;  2DX1 A;  1ZC4 B;  1M7R A;  4HAW B;  2DYN A;  3A58 A;  1W1D A;  4NY0 A;  1RRP B;  4IOY X;  2ZPY A;  2PZ1 A;  2GJY A;  5FI0 A;  1T77 A;  2CY4 A;  4GMV A;  3SV1 A;  5LG4 B;  5DI9 B;  1FHX A;  2ROZ B;  1DDM A;  1AWE A;  5I2S A;  2K2U A;  2Z0Q A;  4K81 A;  2IYB A;  2DFK A;  2K00 A;  3FVC A;  3U8Z A;  2UZS A;  2YS5 A;  3ML4 A;  1TQZ A;  3AJ4 A;  3DXE A;  3TVV A;  5DIF B;  2OTX A; 
#chains in the Genus database with same CATH homology
 2AL6 A;  3PP2 A;  4L6E A;  1X1G A;  4K2O A;  1GC7 A;  2FJL A;  4WJ7 A;  3KZ1 A;  2VSZ A;  5FI1 A;  1WVH A;  2MDX A;  4WVF B;  2L1C A;  1TJ6 A;  2CRF A;  2P8V A;  4ZRI A;  5HE3 A;  1QC6 A;  3TCA A;  5C79 A;  3WA0 A;  2YT0 A;  1PFJ A;  1GG3 A;  5JHG A;  5KQ4 A;  3QWM A;  4BBK A;  1V89 A;  1V5U A;  2QKL A;  4D0N B;  1WJM A;  2LOX A;  1DDW A;  1PMS A;  1P6S A;  2P0H A;  4ZRK A;  2R0D A;  1X1F A;  2DHJ A;  3A8Q A;  2LUL A;  1WGU A;  3A98 B;  3P7Z A;  2J59 M;  4CYE A;  2J0J A;  4GZU A;  2DHK A;  2YS1 A;  3F0W A;  3CIK A;  3KRW A;  1LB1 A;  2RSG A;  4HAV B;  3X23 A;  2D10 A;  1Y5O A;  3AU4 A;  3DXC A;  5C16 A;  2COD A;  1SGH A;  5LOP B;  1FB8 A;  1DDV A;  2DKP A;  1U5F A;  4IFS A;  2VRW B;  4IAP A;  2D11 A;  2NZ8 B;  5D27 A;  1P3R A;  4KAX B;  3M1I B;  4F7H A;  1W1H A;  2QKM A;  2X18 A;  4K17 A;  2DHI A;  3WYF B;  2YVC A;  2D2Q A;  4P7I A;  3BIN A;  4PNK A;  2MWN B;  1FGY A;  2D9W A;  5DHA B;  1B55 A;  3VIA A;  2D9Z A;  1XOD A;  2W2X C;  1I2H A;  2Q13 A;  1ISN A;  1U2B A;  1RJ2 A;  2COC A;  2D9X A;  3KSY A;  3GYP A;  2W2X D;  5DHF B;  3FEH A;  3HQC A;  1BTN A;  3IVF A;  1ZM0 A;  3DXD A;  3SUZ A;  4TYZ A;  4HB3 B;  4HAX B;  2Z0P A;  4WSF A;  5CLQ B;  2N0Y A;  4DXA B;  5C5B A;  2DYQ A;  2EJ8 A;  1Z87 A;  1NU2 A;  1Q67 A;  2CY5 A;  2Y7B A;  2DLW A;  1WI1 A;  1MK9 B;  2YRY A;  2DA0 A;  1X86 A;  3SNH A;  1NTY A;  2W2W A;  3AU5 A;  5L81 A;  1V61 A;  1KI1 B;  1N3H A;  1U5D A;  2E2X A;  4YON A;  3QIJ A;  1OMW A;  2GCL A;  4EMO A;  1EAZ A;  2DX5 A;  4GXB A;  1MIZ B;  2M38 A;  3TW1 A;  3V5W A;  3UZT A;  5J3Q A;  1BAK A;  1OQN A;  3ODX A;  2LKO A;  3F5R A;  1UPQ A;  4Z2M B;  3A8P A;  1XR0 B;  3VOQ A;  2MKR A;  1OY2 A;  5D3Y A;  2OQB A;  4DX8 A;  1FHO A;  1J0W A;  1H4R A;  4YL8 A;  1XX0 A;  3KRX A;  2LYD A;  2VKI A;  3SO6 A;  1MKE A;  1X11 A;  1P5T A;  1UEF A;  5C5B B;  1DYN A;  3ODW A;  2RGN B;  4HB2 B;  3ULB A;  2J0K A;  4HDQ A;  2YT1 A;  4KHO A;  2Z0O A;  1H10 A;  3ULC A;  2LOZ A;  2ELA A;  2H7E A;  4HAY B;  3HW2 B;  2GS0 A;  3PG7 A;  4DBB A;  4GN1 A;  1NI2 A;  3PZD A;  3RCP A;  2YS3 A;  1ZC3 B;  5HE1 A;  2RNR B;  4GPT B;  1WG7 A;  1EF1 A;  1XD4 A;  4A5K A;  3KY9 A;  1BTK A;  2D9V A;  1J19 A;  5DH9 B;  2LG1 A;  1V5M A;  3FSS A;  3T06 A;  1ZSQ A;  2Y8F A;  2L2I A;  2G35 A;  4A6K A;  5EFX A;  2XQN M;  1EVH A;  5KCV A;  3PVU A;  2HTH B;  3D8E A;  5JP4 A;  5GOW B;  4CHJ A;  5HE0 A;  1NTV A;  1MIX A;  1AQC A;  3SYX A;  5HE2 A;  3PSC A;  2V76 A;  2EC1 A;  4HAU B;  3N7C A;  5D3V A;  2MFQ A;  4PQ0 A;  3ZDT A;  1X05 A;  2M14 A;  4HHV A;  1MK7 B;  2I5F A;  4Z2N A;  3LJU X;  1U5G A;  5CLL B;  1WJ1 A;  3D8F A;  2EMT A;  2P0D A;  3TFM A;  1U29 A;  1M7E A;  4ZRJ A;  1XKE A;  4C0A A;  1MAI A;  1MPH A;  2D9Y A;  2D4Q A;  1EGX A;  3U7D A;  2RVB B;  4MY6 A;  3MDB C;  5J3T A;  1Y19 B;  1DRO A;  2IFS A;  3BJI A;  1BWN A;  4KHB B;  1U5E A;  4F7U P;  4CHM A;  5JLJ B;  4A6F A;  1TXD A;  4DX9 0;  4GMX B;  4HAZ B;  2BCJ A;  1K5G B;  4HB0 B;  4EKU A;  4K2P A;  1I7A A;  1W1G A;  2COF A;  3QBV B;  1GC6 A;  2ELB A;  1WGQ A;  1FHW A;  1QQG A;  1FOE A;  4HB4 B;  4F7G A;  2I1J A;  3GYO A;  1V5P A;  3G9W A;  2CAY A;  5J3Y A;  2YF0 A;  2Y8G A;  1SHC A;  3PVL A;  2COA A;  1KZG A;  4NSW A;  3HK0 A;  1FAO A;  1K5D B;  2K2J A;  2RUK B;  1E5W A;  2N23 A;  1IRS A;  2P0F A;  3TO1 A;  2I1K A;  1UPR A;  1UNP A;  3NSU A;  4KVG B;  1DBH A;  5JHH A;  3MPX A;  2R09 A;  2DN6 A;  4TKN A;  1KZ7 A;  5KQ1 A;  5LON B;  3D8D A;  4H8S A;  2AEH A;  1ZVR A;  3PEG A;  5C6R A;  4A6F B;  3OAN A;  1U27 A;  4MK0 A;  2EMS A;  4EJN A;  4A6H A;  3ZVR A;  3PVW A;  1PLS A;  2JP2 A;  2ADZ A;  2KGX B;  2DTC A;  3O96 A;  2DKQ A;  2GCJ A;  3CXB B;  4HDO A;  1LW3 A;  2KCJ A;  2RLO A;  4KHA A;  2I5C A;  2ROV A;  2UVM A;  3ODO A;  4Y94 A;  2J0M A;  4B6H A;  2NMB A;  4XWX A;  3P6A A;  5D3X A;  1V88 A;  2YSZ A;  4MT7 A;  5D3W A;  2KUP A;  2H7D A;  1UNR A;  4HAT B;  1XCG A;  2HE7 A;  2UZR A;  1FGZ A;  1UNQ A;  3FM8 C;  2DX1 A;  1ZC4 B;  1M7R A;  4HAW B;  2DYN A;  1W1D A;  4NY0 A;  1RRP B;  4IOY X;  2ZPY A;  2PZ1 A;  2GJY A;  5FI0 A;  2CY4 A;  4GMV A;  3SV1 A;  5DI9 B;  1FHX A;  2ROZ B;  1DDM A;  1AWE A;  2K2U A;  2Z0Q A;  4K81 A;  2IYB A;  2DFK A;  2K00 A;  3U8Z A;  2UZS A;  2YS5 A;  3ML4 A;  1TQZ A;  3AJ4 A;  3DXE A;  3TVV A;  5DIF B;  2OTX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...