1WJ1A

Solution structure of phosphotyrosine interaction domain of mouse numb protein
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
156
structure length
156
Chain Sequence
GSSGSSGASRPHQWQTDEEGVRTGKCSFPVKYLGHVEVDESRGMHICEDAVKRLKATGKKAVKAVLWVSADGLRVVDEKTKDLIVDQTIEKVSFCAPDRNFDRAFSYICRDGTTRRWICHCFMAVKDTGERLSHAVGCAFAACLERKQKRSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of phosphotyrosine interaction domain of mouse Numb protein
rcsb
source organism Mus musculus
molecule tags Signaling protein
molecule keywords Numb protein
total genus 24
structure length 156
sequence length 156
ec nomenclature
pdb deposition date 2004-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00640 PID Phosphotyrosine interaction domain (PTB/PID)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1wj1A01
2DKQA 1V5UA 3F5RA 5KQ4A 5C5BB 2EC1A 1V61A 2VKIA 2M14A 1M7EA 3ML4A 2L2IA 4TYZA 1AQCA 1TJ6A 2GCJA 4HAVB 3FEHA 1W1DA 2V76A 1EF1A 1OMWA 2RVBB 3AU5A 1ISNA 5JLJB 1RJ2A 2NZ8B 1NI2A 3KSYA 3HK0A 3PVUA 4K17A 1K5GB 4C0AA 1GG3A 3X23A 3TVVA 2COAA 4YONA 1FGZA 2BCJA 1Y19B 3AJ4A 3QWMA 4XWXA 2YVCA 2LG1A 3BJIA 1U2BA 2UVMA 1J19A 1V88A 2KCJA 1EAZA 3PVLA 3U8ZA 2K2JA 2RUKB 3VIAA 4CYEA 5FI0A 2COCA 2DN6A 4MY6A 2W2WA 4A6HA 1K5DB 3QIJA 2Z0QA 2DYNA 1PFJA 1KZGA 3ULCA 1X1FA 1FOEA 1EVHA 1OQNA 3A8QA 2MWNB 4P7IA 1X86A 1H4RA 2H7EA 2E2XA 4DX8A 2P0HA 5LONB 2GS0A 3D8DA 4F7UP 4D0NB 3VOQA 4HB2B 1QC6A 4HB4B 5D3XA 1DROA 2D2QA 1DDVA 5DIFB 2UZRA 2CY5A 3KRXA 1FHOA 5GOWB 2QKLA 3ODXA 2Q13A 4Y94A 3P7ZA 2DHKA 2QKMA 5EFXA 3PZDA 3PSCA 4H8SA 1GC6A 2LOXA 1UPRA 2YS5A 2D9XA 1U5EA 3SV1A 3U7DA 2W2XC 4F7GA 2CODA 1MAIA 1MK9B 4DXAB 3FSSA 3WA0A 3ULBA 2ZPYA 1J0WA 2Y7BA 5HE1A 4IFSA 2LULA 3ODOA 4HAUB 1W1GA 3HW2B 1B55A 3HQCA 4GN1A 4K2PA 2PZ1A 1AWEA 1XCGA 4MK0A 4CHMA 1BTKA 1H10A 2J59M 5HE3A 2ROVA 5J3YA 1KI1B 3MDBC 1PMSA 1DYNA 2KUPA 2EMSA 1V5PA 2G35A 1NTVA 2I1KA 4F7HA 2AL6A 4YL8A 2DKPA 5HE0A 2D9VA 4HHVA 1FGYA 1M7RA 2HE7A 3NSUA 5C79A 2KGXB 1TQZA 3BINA 5L81A 2X18A 2YT0A 3TO1A 4HATB 3CIKA 3SYXA 4HAWB 1LB1A 1XR0B 2Z0OA 3SUZA 2Y8FA 1I7AA 5KCVA 2RLOA 4EJNA 2DA0A 3TW1A 1V5MA 2EMTA 5J3QA 1E5WA 2Z0PA 2P8VA 2FJLA 2CRFA 4DX90 1ZC4B 4Z2MB 4KHBB 4WSFA 3M1IB 4HDOA 5D27A 2RNRB 3FM8C 5C5BA 3V5WA 3A8PA 1BAKA 3CXBB 3P6AA 3MPXA 2OTXA 1W1HA 5DI9B 1QQGA 2MDXA 2HTHB 2RGNB 1UNPA 1MKEA 2MFQA 5DHAB 2LKOA 1RRPB 2YSZA 2D9WA 1EGXA 1ZSQA 2ADZA 4K2OA 3ZVRA 1LW3A 5DHFB 4HB3B 2P0DA 1DBHA 2RSGA 2GJYA 2YS3A 4GMXB 1P5TA 1GC7A 2R09A 1SHCA 3OANA 4ZRIA 1V89A 1OY2A 5JHGA 5D3YA 5C6RA 1BWNA 4A6KA 2CAYA 1X1GA 2ELAA 3QBVB 4PNKA 5D3VA 2ELBA 3A98B 3AU4A 4A6FB 4GZUA 2N0YA 1PLSA 4HDQA 2D4QA 1WJMA 2DHJA 1FHWA 5JP4A 3WYFB 2R0DA 2COFA 1MIZB 2DLWA 1IRSA 2Y8GA 4K81A 3DXEA 3G9WA 5HE2A 2YT1A 1WI1A 4NY0A 4IAPA 4WVFB 2AEHA 5LOPB 4NSWA 1ZC3B 2YRYA 1X11A 1U29A 2DYQA 4MT7A 1WGUA 4B6HA 2L1CA 4KAXB 1FHXA 2IFSA 2VRWB 1XX0A 1U27A 4EKUA 4HAZB 4Z2NA 3GYPA 2I1JA 1UNQA 4KHOA 5KQ1A 3KRWA 3PG7A 4TKNA 1MIXA 1MK7B 3D8FA 4GXBA 3RCPA 3PP2A 4PQ0A 1FB8A 4HAXB 3PEGA 3SO6A 4ZRKA 2M38A 1UEFA 2NMBA 4HAYB 1DDWA 1NU2A 5DH9B 1U5DA 3DXCA 3TCAA 4KVGB 2DTCA 2J0KA 2P0FA 1WG7A 2OQBA 3O96A 2IYBA 3ZDTA 1Z87A 1ZM0A 1XD4A 1FAOA 2I5FA 2J0JA 5J3TA 3D8EA 1P6SA 1WGQA 1DDMA 2MKRA 1NTYA 4DBBA 3UZTA 2EJ8A 4BBKA 1P3RA 3T06A 1UPQA 2DFKA 1Y5OA 2VSZA 5CLQB 1X05A 2LYDA 1WVHA 1U5FA 2D11A 2D10A 3KY9A 4HB0B 2DX5A 2XQNM 5C16A 2J0MA 2W2XD 2JP2A 1N3HA 5D3WA 3F0WA 4GPTB 1KZ7A 4IOYX 1I2HA 1UNRA 2D9YA 1XODA 2LOZA 3KZ1A 2K2UA 3IVFA 1Q67A 3SNHA 4A6FA 3PVWA 1ZVRA 5CLLB 1MPHA 3TFMA 1XKEA 5JHHA 3GYOA 4GMVA 4WJ7A 3DXDA 1SGHA 2N23A 2I5CA 1BTNA 2ROZB 4L6EA 2K00A 4ZRJA 2DX1A 2UZSA 2CY4A 4EMOA 1U5GA 5FI1A 1WJ1A 4A5KA 2GCLA 2H7DA 3N7CA 2D9ZA 2YF0A 1TXDA 4CHJA 3LJUX 2DHIA 4KHAA 3ODWA 2YS1A
chains in the Genus database with same CATH superfamily
2DKQA 1V5UA 3F5RA 5KQ4A 5C5BB 2EC1A 1V61A 2VKIA 2M14A 2KIEA 1M7EA 3ML4A 2L2IA 4TYZA 1AQCA 1TJ6A 2GCJA 2NBVA 4HAVB 3FEHA 1W1DA 2V76A 1EF1A 1OMWA 3AU5A 2RVBB 1ISNA 5JLJB 1RJ2A 2NZ8B 1NI2A 3KSYA 3HK0A 2Z59A 3PVUA 4K17A 1K5GB 4C0AA 1GG3A 3X23A 5I2SA 3TVVA 2COAA 4YONA 5I2MA 1FGZA 2BCJA 1Y19B 3AJ4A 3QWMA 4XWXA 2YVCA 2LG1A 3BJIA 1U2BA 2UVMA 1J19A 1V88A 2KCJA 1EAZA 3NW8A 3PVLA 3U8ZA 2K2JA 2RUKB 3VIAA 4CYEA 5FI0A 2COCA 2DN6A 4MY6A 2W2WA 4A6HA 1K5DB 3QIJA 2Z0QA 2DYNA 1PFJA 1KZGA 3ULCA 1X1FA 1FOEA 1EVHA 1OQNA 3A8QA 2MWNB 4P7IA 1X86A 1H4RA 2H7EA 2E2XA 4DX8A 4GOUA 2P0HA 5LONB 2GS0A 3D8DA 4F7UP 4D0NB 3VOQA 2KUQA 4HB2B 1QC6A 4HB4B 5D3XA 1DROA 2D2QA 1DDVA 5DIFB 2UZRA 2CY5A 3KRXA 1FHOA 5GOWB 2QKLA 3ODXA 2Q13A 4Y94A 3DCXA 2Z14A 3P7ZA 2DHKA 2QKMA 5EFXA 3PZDA 2RRFA 3PSCA 4H8SA 1GC6A 2LOXA 1UPRA 2YS5A 2D9XA 1U5EA 3HIEA 3SV1A 3U7DA 2W2XC 4F7GA 4CSQA 2CODA 1MAIA 1MK9B 4DXAB 3FSSA 3WA0A 3ULBA 2ZPYA 1J0WA 2Y7BA 5HE1A 4IFSA 2LULA 3ODOA 4HAUB 1W1GA 3HW2B 1B55A 3HQCA 4GN1A 4K2PA 2PZ1A 1AWEA 1XCGA 4MK0A 4CHMA 1BTKA 1H10A 2J59M 5HE3A 2ROVA 5J3YA 1ZYIA 1KI1B 3MDBC 1PMSA 1DYNA 2KUPA 2EMSA 1V5PA 2G35A 3NWFA 1NTVA 2I1KA 4F7HA 2AL6A 4YL8A 2DKPA 5HE0A 2D9VA 2ZKMX 4HHVA 1FGYA 1M7RA 2HE7A 3NSUA 5C79A 2KGXB 1TQZA 3BINA 5L81A 2X18A 2YT0A 3TO1A 4HATB 3CIKA 3SYXA 4HAWB 1LB1A 1XR0B 2Z0OA 4QJ3B 3SUZA 2Y8FA 1I7AA 5KCVA 2RLOA 4EJNA 2DA0A 5IRSA 3TW1A 1V5MA 2EMTA 5J3QA 1E5WA 2Z0PA 2P8VA 2FJLA 2CRFA 2FJUB 1ZC4B 4DX90 4Z2MB 4D6WA 2GUMA 3OHMB 4KHBB 4WSFA 3M1IB 4HDOA 5D27A 2RNRB 3FM8C 5C5BA 3V5WA 3A8PA 1BAKA 3CXBB 3P6AA 3MPXA 2OTXA 1W1HA 5DI9B 1QQGA 2MDXA 2HTHB 3HSAA 2RGNB 1UNPA 1MKEA 2MFQA 5DHAB 2LKOA 1RRPB 2YSZA 2D9WA 1EGXA 1ZSQA 2ADZA 4K2OA 3ZVRA 1LW3A 1MI1A 5DHFB 4HB3B 2P0DA 1DBHA 2RSGA 2GJYA 2YS3A 4GMXB 1P5TA 1GC7A 2R09A 1SHCA 3OANA 4ZRIA 1V89A 1OY2A 5JHGA 5D3YA 5C6RA 1BWNA 4A6KA 2CAYA 3NWAA 1X1GA 2ELAA 3QBVB 4PNKA 3B77A 5D3VA 2ELBA 3A98B 3AU4A 4A6FB 4GZUA 2N0YA 1PLSA 4HDQA 2D4QA 1WJMA 4KHBA 4QJ5B 2DHJA 1FHWA 5JP4A 3WYFB 2K8EA 2R0DA 2COFA 1MIZB 2DLWA 1IRSA 2Y8GA 3DXEA 4K81A 3G9WA 5HE2A 2YT1A 1WI1A 4NY0A 3U12A 4IAPA 4WVFB 2AEHA 5LOPB 4NSWA 1ZC3B 2YRYA 1X11A 5LG4B 1U29A 2DYQA 4MT7A 4OSNA 1WGUA 4B6HA 2L1CA 4KAXB 1FHXA 2IFSA 2VRWB 1XX0A 1U27A 4EKUA 4HAZB 4Z2NA 3GYPA 2I1JA 1UNQA 4KHOA 5KQ1A 4QJ4B 3KRWA 3PG7A 4TKNA 1MIXA 1MK7B 3D8FA 4GXBA 3RCPA 4OT1A 2Z13A 3PP2A 4PQ0A 1FB8A 4HAXB 3PEGA 3SO6A 4ZRKA 2M38A 1UEFA 2NMBA 4HSIA 2K49A 2R2YA 4HAYB 2KR0A 1DDWA 1NU2A 5DH9B 3FVCA 1U5DA 3DXCA 3TCAA 4DIXA 4KVGB 2DTCA 2J0KA 2P0FA 1WG7A 2OQBA 3O96A 2IYBA 3ZDTA 1Z87A 1ZM0A 1XD4A 2Z4DA 1FAOA 2I5FA 2J0JA 5J3TA 3D8EA 4QXAB 1P6SA 1WGQA 1DDMA 2MKRA 1NTYA 4DBBA 3UZTA 2EJ8A 4GNKB 4BBKA 1P3RA 3T06A 1UPQA 2DFKA 1Y5OA 2VSZA 1T77A 5CLQB 1X05A 2LYDA 1WVHA 1U5FA 2D11A 2D10A 2YT2A 3KY9A 4HB0B 2DX5A 2XQNM 5C16A 5M4YB 2J0MA 2W2XD 2JP2A 1N3HA 5D3WA 2KIGA 3F0WA 4GPTB 1KZ7A 4IOYX 1I2HA 1UNRA 2D9YA 1XODA 2LOZA 3KZ1A 2K2UA 3IVFA 1Q67A 3SNHA 4A6FA 3PVWA 1ZVRA 5CLLB 1MPHA 3TFMA 1XKEA 5JHHA 3GYOA 4GMVA 4L1RA 4WJ7A 3DXDA 1SGHA 3NWDA 2N23A 2I5CA 1BTNA 2ROZB 4L6EA 2K00A 4ZRJA 2DX1A 2UZSA 2CY4A 4EMOA 1U5GA 5FI1A 1WJ1A 4A5KA 2GCLA 2H7DA 3N7CA 3A58A 2D9ZA 2YF0A 1TXDA 4CHJA 3LJUX 2DHIA 4KHAA 3ODWA 2YS1A
chains in the Genus database with same CATH topology
2DKQA 1V5UA 3F5RA 5KQ4A 5C5BB 2EC1A 1V61A 2VKIA 2M14A 1M7EA 3ML4A 2L2IA 4TYZA 1AQCA 1TJ6A 2GCJA 4HAVB 3FEHA 1W1DA 2V76A 1EF1A 1OMWA 2RVBB 3AU5A 1ISNA 5JLJB 1RJ2A 2NZ8B 1NI2A 3KSYA 3HK0A 3PVUA 4K17A 1K5GB 4C0AA 1GG3A 3X23A 3TVVA 2COAA 4YONA 1FGZA 2BCJA 1Y19B 3AJ4A 3QWMA 4XWXA 2YVCA 2LG1A 3BJIA 1U2BA 2UVMA 1J19A 1V88A 2KCJA 1EAZA 3PVLA 3U8ZA 2K2JA 2RUKB 3VIAA 4CYEA 5FI0A 2COCA 2DN6A 4MY6A 2W2WA 4A6HA 1K5DB 3QIJA 2Z0QA 2DYNA 1PFJA 1KZGA 3ULCA 1X1FA 1FOEA 1EVHA 1OQNA 3A8QA 2MWNB 4P7IA 1X86A 1H4RA 2H7EA 2E2XA 4DX8A 2P0HA 5LONB 2GS0A 3D8DA 4F7UP 4D0NB 3VOQA 4HB2B 1QC6A 4HB4B 5D3XA 1DROA 2D2QA 1DDVA 5DIFB 2UZRA 2CY5A 3KRXA 1FHOA 5GOWB 2QKLA 3ODXA 2Q13A 4Y94A 3P7ZA 2DHKA 2QKMA 5EFXA 3PZDA 3PSCA 4H8SA 1GC6A 2LOXA 1UPRA 2YS5A 2D9XA 1U5EA 3SV1A 3U7DA 2W2XC 4F7GA 2CODA 1MAIA 1MK9B 4DXAB 3FSSA 3WA0A 3ULBA 2ZPYA 1J0WA 2Y7BA 5HE1A 4IFSA 2LULA 3ODOA 4HAUB 1W1GA 3HW2B 1B55A 3HQCA 4GN1A 4K2PA 2PZ1A 1AWEA 1XCGA 4MK0A 4CHMA 1BTKA 1H10A 2J59M 5HE3A 2ROVA 5J3YA 1KI1B 3MDBC 1PMSA 1DYNA 2KUPA 2EMSA 1V5PA 2G35A 1NTVA 2I1KA 4F7HA 2AL6A 4YL8A 2DKPA 5HE0A 2D9VA 4HHVA 1FGYA 1M7RA 2HE7A 3NSUA 5C79A 2KGXB 1TQZA 3BINA 5L81A 2X18A 2YT0A 3TO1A 4HATB 3CIKA 3SYXA 4HAWB 1LB1A 1XR0B 2Z0OA 3SUZA 2Y8FA 1I7AA 5KCVA 2RLOA 4EJNA 2DA0A 3TW1A 1V5MA 2EMTA 5J3QA 1E5WA 2Z0PA 2P8VA 2FJLA 2CRFA 4DX90 1ZC4B 4Z2MB 4KHBB 4WSFA 3M1IB 4HDOA 5D27A 2RNRB 3FM8C 5C5BA 3V5WA 3A8PA 1BAKA 3CXBB 3P6AA 3MPXA 2OTXA 1W1HA 5DI9B 1QQGA 2MDXA 2HTHB 2RGNB 1UNPA 1MKEA 2MFQA 5DHAB 2LKOA 1RRPB 2YSZA 2D9WA 1EGXA 1ZSQA 2ADZA 4K2OA 3ZVRA 1LW3A 5DHFB 4HB3B 2P0DA 1DBHA 2RSGA 2GJYA 2YS3A 4GMXB 1P5TA 1GC7A 2R09A 1SHCA 3OANA 4ZRIA 1V89A 1OY2A 5JHGA 5D3YA 5C6RA 1BWNA 4A6KA 2CAYA 1X1GA 2ELAA 3QBVB 4PNKA 5D3VA 2ELBA 3A98B 3AU4A 4A6FB 4GZUA 2N0YA 1PLSA 4HDQA 2D4QA 1WJMA 2DHJA 1FHWA 5JP4A 3WYFB 2R0DA 2COFA 1MIZB 2DLWA 1IRSA 2Y8GA 4K81A 3DXEA 3G9WA 5HE2A 2YT1A 1WI1A 4NY0A 4IAPA 4WVFB 2AEHA 5LOPB 4NSWA 1ZC3B 2YRYA 1X11A 1U29A 2DYQA 4MT7A 1WGUA 4B6HA 2L1CA 4KAXB 1FHXA 2IFSA 2VRWB 1XX0A 1U27A 4EKUA 4HAZB 4Z2NA 3GYPA 2I1JA 1UNQA 4KHOA 5KQ1A 3KRWA 3PG7A 4TKNA 1MIXA 1MK7B 3D8FA 4GXBA 3RCPA 3PP2A 4PQ0A 1FB8A 4HAXB 3PEGA 3SO6A 4ZRKA 2M38A 1UEFA 2NMBA 4HAYB 1DDWA 1NU2A 5DH9B 1U5DA 3DXCA 3TCAA 4KVGB 2DTCA 2J0KA 2P0FA 1WG7A 2OQBA 3O96A 2IYBA 3ZDTA 1Z87A 1ZM0A 1XD4A 1FAOA 2I5FA 2J0JA 5J3TA 3D8EA 1P6SA 1WGQA 1DDMA 2MKRA 1NTYA 4DBBA 3UZTA 2EJ8A 4BBKA 1P3RA 3T06A 1UPQA 2DFKA 1Y5OA 2VSZA 5CLQB 1X05A 2LYDA 1WVHA 1U5FA 2D11A 2D10A 3KY9A 4HB0B 2DX5A 2XQNM 5C16A 2J0MA 2W2XD 2JP2A 1N3HA 5D3WA 3F0WA 4GPTB 1KZ7A 4IOYX 1I2HA 1UNRA 2D9YA 1XODA 2LOZA 3KZ1A 2K2UA 3IVFA 1Q67A 3SNHA 4A6FA 3PVWA 1ZVRA 5CLLB 1MPHA 3TFMA 1XKEA 5JHHA 3GYOA 4GMVA 4WJ7A 3DXDA 1SGHA 2N23A 2I5CA 1BTNA 2ROZB 4L6EA 2K00A 4ZRJA 2DX1A 2UZSA 2CY4A 4EMOA 1U5GA 5FI1A 1WJ1A 4A5KA 2GCLA 2H7DA 3N7CA 2D9ZA 2YF0A 1TXDA 4CHJA 3LJUX 2DHIA 4KHAA 3ODWA 2YS1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DKQ A;  1V5U A;  3F5R A;  5KQ4 A;  5C5B B;  2EC1 A;  1V61 A;  2VKI A;  2M14 A;  1M7E A;  3ML4 A;  2L2I A;  4TYZ A;  1AQC A;  1TJ6 A;  2GCJ A;  4HAV B;  3FEH A;  1W1D A;  2V76 A;  1EF1 A;  1OMW A;  2RVB B;  3AU5 A;  1ISN A;  5JLJ B;  1RJ2 A;  2NZ8 B;  1NI2 A;  3KSY A;  3HK0 A;  3PVU A;  4K17 A;  1K5G B;  4C0A A;  1GG3 A;  3X23 A;  3TVV A;  2COA A;  4YON A;  1FGZ A;  2BCJ A;  1Y19 B;  3AJ4 A;  3QWM A;  4XWX A;  2YVC A;  2LG1 A;  3BJI A;  1U2B A;  2UVM A;  1J19 A;  1V88 A;  2KCJ A;  1EAZ A;  3PVL A;  3U8Z A;  2K2J A;  2RUK B;  3VIA A;  4CYE A;  5FI0 A;  2COC A;  2DN6 A;  4MY6 A;  2W2W A;  4A6H A;  1K5D B;  3QIJ A;  2Z0Q A;  2DYN A;  1PFJ A;  1KZG A;  3ULC A;  1X1F A;  1FOE A;  1EVH A;  1OQN A;  3A8Q A;  2MWN B;  4P7I A;  1X86 A;  1H4R A;  2H7E A;  2E2X A;  4DX8 A;  2P0H A;  5LON B;  2GS0 A;  3D8D A;  4F7U P;  4D0N B;  3VOQ A;  4HB2 B;  1QC6 A;  4HB4 B;  5D3X A;  1DRO A;  2D2Q A;  1DDV A;  5DIF B;  2UZR A;  2CY5 A;  3KRX A;  1FHO A;  5GOW B;  2QKL A;  3ODX A;  2Q13 A;  4Y94 A;  3P7Z A;  2DHK A;  2QKM A;  5EFX A;  3PZD A;  3PSC A;  4H8S A;  1GC6 A;  2LOX A;  1UPR A;  2YS5 A;  2D9X A;  1U5E A;  3SV1 A;  3U7D A;  2W2X C;  4F7G A;  2COD A;  1MAI A;  1MK9 B;  4DXA B;  3FSS A;  3WA0 A;  3ULB A;  2ZPY A;  1J0W A;  2Y7B A;  5HE1 A;  4IFS A;  2LUL A;  3ODO A;  4HAU B;  1W1G A;  3HW2 B;  1B55 A;  3HQC A;  4GN1 A;  4K2P A;  2PZ1 A;  1AWE A;  1XCG A;  4MK0 A;  4CHM A;  1BTK A;  1H10 A;  2J59 M;  5HE3 A;  2ROV A;  5J3Y A;  1KI1 B;  3MDB C;  1PMS A;  1DYN A;  2KUP A;  2EMS A;  1V5P A;  2G35 A;  1NTV A;  2I1K A;  4F7H A;  2AL6 A;  4YL8 A;  2DKP A;  5HE0 A;  2D9V A;  4HHV A;  1FGY A;  1M7R A;  2HE7 A;  3NSU A;  5C79 A;  2KGX B;  1TQZ A;  3BIN A;  5L81 A;  2X18 A;  2YT0 A;  3TO1 A;  4HAT B;  3CIK A;  3SYX A;  4HAW B;  1LB1 A;  1XR0 B;  2Z0O A;  3SUZ A;  2Y8F A;  1I7A A;  5KCV A;  2RLO A;  4EJN A;  2DA0 A;  3TW1 A;  1V5M A;  2EMT A;  5J3Q A;  1E5W A;  2Z0P A;  2P8V A;  2FJL A;  2CRF A;  4DX9 0;  1ZC4 B;  4Z2M B;  4KHB B;  4WSF A;  3M1I B;  4HDO A;  5D27 A;  2RNR B;  3FM8 C;  5C5B A;  3V5W A;  3A8P A;  1BAK A;  3CXB B;  3P6A A;  3MPX A;  2OTX A;  1W1H A;  5DI9 B;  1QQG A;  2MDX A;  2HTH B;  2RGN B;  1UNP A;  1MKE A;  2MFQ A;  5DHA B;  2LKO A;  1RRP B;  2YSZ A;  2D9W A;  1EGX A;  1ZSQ A;  2ADZ A;  4K2O A;  3ZVR A;  1LW3 A;  5DHF B;  4HB3 B;  2P0D A;  1DBH A;  2RSG A;  2GJY A;  2YS3 A;  4GMX B;  1P5T A;  1GC7 A;  2R09 A;  1SHC A;  3OAN A;  4ZRI A;  1V89 A;  1OY2 A;  5JHG A;  5D3Y A;  5C6R A;  1BWN A;  4A6K A;  2CAY A;  1X1G A;  2ELA A;  3QBV B;  4PNK A;  5D3V A;  2ELB A;  3A98 B;  3AU4 A;  4A6F B;  4GZU A;  2N0Y A;  1PLS A;  4HDQ A;  2D4Q A;  1WJM A;  2DHJ A;  1FHW A;  5JP4 A;  3WYF B;  2R0D A;  2COF A;  1MIZ B;  2DLW A;  1IRS A;  2Y8G A;  4K81 A;  3DXE A;  3G9W A;  5HE2 A;  2YT1 A;  1WI1 A;  4NY0 A;  4IAP A;  4WVF B;  2AEH A;  5LOP B;  4NSW A;  1ZC3 B;  2YRY A;  1X11 A;  1U29 A;  2DYQ A;  4MT7 A;  1WGU A;  4B6H A;  2L1C A;  4KAX B;  1FHX A;  2IFS A;  2VRW B;  1XX0 A;  1U27 A;  4EKU A;  4HAZ B;  4Z2N A;  3GYP A;  2I1J A;  1UNQ A;  4KHO A;  5KQ1 A;  3KRW A;  3PG7 A;  4TKN A;  1MIX A;  1MK7 B;  3D8F A;  4GXB A;  3RCP A;  3PP2 A;  4PQ0 A;  1FB8 A;  4HAX B;  3PEG A;  3SO6 A;  4ZRK A;  2M38 A;  1UEF A;  2NMB A;  4HAY B;  1DDW A;  1NU2 A;  5DH9 B;  1U5D A;  3DXC A;  3TCA A;  4KVG B;  2DTC A;  2J0K A;  2P0F A;  1WG7 A;  2OQB A;  3O96 A;  2IYB A;  3ZDT A;  1Z87 A;  1ZM0 A;  1XD4 A;  1FAO A;  2I5F A;  2J0J A;  5J3T A;  3D8E A;  1P6S A;  1WGQ A;  1DDM A;  2MKR A;  1NTY A;  4DBB A;  3UZT A;  2EJ8 A;  4BBK A;  1P3R A;  3T06 A;  1UPQ A;  2DFK A;  1Y5O A;  2VSZ A;  5CLQ B;  1X05 A;  2LYD A;  1WVH A;  1U5F A;  2D11 A;  2D10 A;  3KY9 A;  4HB0 B;  2DX5 A;  2XQN M;  5C16 A;  2J0M A;  2W2X D;  2JP2 A;  1N3H A;  5D3W A;  3F0W A;  4GPT B;  1KZ7 A;  4IOY X;  1I2H A;  1UNR A;  2D9Y A;  1XOD A;  2LOZ A;  3KZ1 A;  2K2U A;  3IVF A;  1Q67 A;  3SNH A;  4A6F A;  3PVW A;  1ZVR A;  5CLL B;  1MPH A;  3TFM A;  1XKE A;  5JHH A;  3GYO A;  4GMV A;  4WJ7 A;  3DXD A;  1SGH A;  2N23 A;  2I5C A;  1BTN A;  2ROZ B;  4L6E A;  2K00 A;  4ZRJ A;  2DX1 A;  2UZS A;  2CY4 A;  4EMO A;  1U5G A;  5FI1 A;  1WJ1 A;  4A5K A;  2GCL A;  2H7D A;  3N7C A;  2D9Z A;  2YF0 A;  1TXD A;  4CHJ A;  3LJU X;  2DHI A;  4KHA A;  3ODW A;  2YS1 A; 
#chains in the Genus database with same CATH topology
 2DKQ A;  1V5U A;  3F5R A;  5KQ4 A;  5C5B B;  2EC1 A;  1V61 A;  2VKI A;  2M14 A;  2KIE A;  1M7E A;  3ML4 A;  2L2I A;  4TYZ A;  1AQC A;  1TJ6 A;  2GCJ A;  2NBV A;  4HAV B;  3FEH A;  1W1D A;  2V76 A;  1EF1 A;  1OMW A;  3AU5 A;  2RVB B;  1ISN A;  5JLJ B;  1RJ2 A;  2NZ8 B;  1NI2 A;  3KSY A;  3HK0 A;  2Z59 A;  3PVU A;  4K17 A;  1K5G B;  4C0A A;  1GG3 A;  3X23 A;  5I2S A;  3TVV A;  2COA A;  4YON A;  5I2M A;  1FGZ A;  2BCJ A;  1Y19 B;  3AJ4 A;  3QWM A;  4XWX A;  2YVC A;  2LG1 A;  3BJI A;  1U2B A;  2UVM A;  1J19 A;  1V88 A;  2KCJ A;  1EAZ A;  3NW8 A;  3PVL A;  3U8Z A;  2K2J A;  2RUK B;  3VIA A;  4CYE A;  5FI0 A;  2COC A;  2DN6 A;  4MY6 A;  2W2W A;  4A6H A;  1K5D B;  3QIJ A;  2Z0Q A;  2DYN A;  1PFJ A;  1KZG A;  3ULC A;  1X1F A;  1FOE A;  1EVH A;  1OQN A;  3A8Q A;  2MWN B;  4P7I A;  1X86 A;  1H4R A;  2H7E A;  2E2X A;  4DX8 A;  4GOU A;  2P0H A;  5LON B;  2GS0 A;  3D8D A;  4F7U P;  4D0N B;  3VOQ A;  2KUQ A;  4HB2 B;  1QC6 A;  4HB4 B;  5D3X A;  1DRO A;  2D2Q A;  1DDV A;  5DIF B;  2UZR A;  2CY5 A;  3KRX A;  1FHO A;  5GOW B;  2QKL A;  3ODX A;  2Q13 A;  4Y94 A;  3DCX A;  2Z14 A;  3P7Z A;  2DHK A;  2QKM A;  5EFX A;  3PZD A;  2RRF A;  3PSC A;  4H8S A;  1GC6 A;  2LOX A;  1UPR A;  2YS5 A;  2D9X A;  1U5E A;  3HIE A;  3SV1 A;  3U7D A;  2W2X C;  4F7G A;  4CSQ A;  2COD A;  1MAI A;  1MK9 B;  4DXA B;  3FSS A;  3WA0 A;  3ULB A;  2ZPY A;  1J0W A;  2Y7B A;  5HE1 A;  4IFS A;  2LUL A;  3ODO A;  4HAU B;  1W1G A;  3HW2 B;  1B55 A;  3HQC A;  4GN1 A;  4K2P A;  2PZ1 A;  1AWE A;  1XCG A;  4MK0 A;  4CHM A;  1BTK A;  1H10 A;  2J59 M;  5HE3 A;  2ROV A;  5J3Y A;  1ZYI A;  1KI1 B;  3MDB C;  1PMS A;  1DYN A;  2KUP A;  2EMS A;  1V5P A;  2G35 A;  3NWF A;  1NTV A;  2I1K A;  4F7H A;  2AL6 A;  4YL8 A;  2DKP A;  5HE0 A;  2D9V A;  2ZKM X;  4HHV A;  1FGY A;  1M7R A;  2HE7 A;  3NSU A;  5C79 A;  2KGX B;  1TQZ A;  3BIN A;  5L81 A;  2X18 A;  2YT0 A;  3TO1 A;  4HAT B;  3CIK A;  3SYX A;  4HAW B;  1LB1 A;  1XR0 B;  2Z0O A;  4QJ3 B;  3SUZ A;  2Y8F A;  1I7A A;  5KCV A;  2RLO A;  4EJN A;  2DA0 A;  5IRS A;  3TW1 A;  1V5M A;  2EMT A;  5J3Q A;  1E5W A;  2Z0P A;  2P8V A;  2FJL A;  2CRF A;  2FJU B;  1ZC4 B;  4DX9 0;  4Z2M B;  4D6W A;  2GUM A;  3OHM B;  4KHB B;  4WSF A;  3M1I B;  4HDO A;  5D27 A;  2RNR B;  3FM8 C;  5C5B A;  3V5W A;  3A8P A;  1BAK A;  3CXB B;  3P6A A;  3MPX A;  2OTX A;  1W1H A;  5DI9 B;  1QQG A;  2MDX A;  2HTH B;  3HSA A;  2RGN B;  1UNP A;  1MKE A;  2MFQ A;  5DHA B;  2LKO A;  1RRP B;  2YSZ A;  2D9W A;  1EGX A;  1ZSQ A;  2ADZ A;  4K2O A;  3ZVR A;  1LW3 A;  1MI1 A;  5DHF B;  4HB3 B;  2P0D A;  1DBH A;  2RSG A;  2GJY A;  2YS3 A;  4GMX B;  1P5T A;  1GC7 A;  2R09 A;  1SHC A;  3OAN A;  4ZRI A;  1V89 A;  1OY2 A;  5JHG A;  5D3Y A;  5C6R A;  1BWN A;  4A6K A;  2CAY A;  3NWA A;  1X1G A;  2ELA A;  3QBV B;  4PNK A;  3B77 A;  5D3V A;  2ELB A;  3A98 B;  3AU4 A;  4A6F B;  4GZU A;  2N0Y A;  1PLS A;  4HDQ A;  2D4Q A;  1WJM A;  4KHB A;  4QJ5 B;  2DHJ A;  1FHW A;  5JP4 A;  3WYF B;  2K8E A;  2R0D A;  2COF A;  1MIZ B;  2DLW A;  1IRS A;  2Y8G A;  3DXE A;  4K81 A;  3G9W A;  5HE2 A;  2YT1 A;  1WI1 A;  4NY0 A;  3U12 A;  4IAP A;  4WVF B;  2AEH A;  5LOP B;  4NSW A;  1ZC3 B;  2YRY A;  1X11 A;  5LG4 B;  1U29 A;  2DYQ A;  4MT7 A;  4OSN A;  1WGU A;  4B6H A;  2L1C A;  4KAX B;  1FHX A;  2IFS A;  2VRW B;  1XX0 A;  1U27 A;  4EKU A;  4HAZ B;  4Z2N A;  3GYP A;  2I1J A;  1UNQ A;  4KHO A;  5KQ1 A;  4QJ4 B;  3KRW A;  3PG7 A;  4TKN A;  1MIX A;  1MK7 B;  3D8F A;  4GXB A;  3RCP A;  4OT1 A;  2Z13 A;  3PP2 A;  4PQ0 A;  1FB8 A;  4HAX B;  3PEG A;  3SO6 A;  4ZRK A;  2M38 A;  1UEF A;  2NMB A;  4HSI A;  2K49 A;  2R2Y A;  4HAY B;  2KR0 A;  1DDW A;  1NU2 A;  5DH9 B;  3FVC A;  1U5D A;  3DXC A;  3TCA A;  4DIX A;  4KVG B;  2DTC A;  2J0K A;  2P0F A;  1WG7 A;  2OQB A;  3O96 A;  2IYB A;  3ZDT A;  1Z87 A;  1ZM0 A;  1XD4 A;  2Z4D A;  1FAO A;  2I5F A;  2J0J A;  5J3T A;  3D8E A;  4QXA B;  1P6S A;  1WGQ A;  1DDM A;  2MKR A;  1NTY A;  4DBB A;  3UZT A;  2EJ8 A;  4GNK B;  4BBK A;  1P3R A;  3T06 A;  1UPQ A;  2DFK A;  1Y5O A;  2VSZ A;  1T77 A;  5CLQ B;  1X05 A;  2LYD A;  1WVH A;  1U5F A;  2D11 A;  2D10 A;  2YT2 A;  3KY9 A;  4HB0 B;  2DX5 A;  2XQN M;  5C16 A;  5M4Y B;  2J0M A;  2W2X D;  2JP2 A;  1N3H A;  5D3W A;  2KIG A;  3F0W A;  4GPT B;  1KZ7 A;  4IOY X;  1I2H A;  1UNR A;  2D9Y A;  1XOD A;  2LOZ A;  3KZ1 A;  2K2U A;  3IVF A;  1Q67 A;  3SNH A;  4A6F A;  3PVW A;  1ZVR A;  5CLL B;  1MPH A;  3TFM A;  1XKE A;  5JHH A;  3GYO A;  4GMV A;  4L1R A;  4WJ7 A;  3DXD A;  1SGH A;  3NWD A;  2N23 A;  2I5C A;  1BTN A;  2ROZ B;  4L6E A;  2K00 A;  4ZRJ A;  2DX1 A;  2UZS A;  2CY4 A;  4EMO A;  1U5G A;  5FI1 A;  1WJ1 A;  4A5K A;  2GCL A;  2H7D A;  3N7C A;  3A58 A;  2D9Z A;  2YF0 A;  1TXD A;  4CHJ A;  3LJU X;  2DHI A;  4KHA A;  3ODW A;  2YS1 A; 
#chains in the Genus database with same CATH homology
 2DKQ A;  1V5U A;  3F5R A;  5KQ4 A;  5C5B B;  2EC1 A;  1V61 A;  2VKI A;  2M14 A;  1M7E A;  3ML4 A;  2L2I A;  4TYZ A;  1AQC A;  1TJ6 A;  2GCJ A;  4HAV B;  3FEH A;  1W1D A;  2V76 A;  1EF1 A;  1OMW A;  2RVB B;  3AU5 A;  1ISN A;  5JLJ B;  1RJ2 A;  2NZ8 B;  1NI2 A;  3KSY A;  3HK0 A;  3PVU A;  4K17 A;  1K5G B;  4C0A A;  1GG3 A;  3X23 A;  3TVV A;  2COA A;  4YON A;  1FGZ A;  2BCJ A;  1Y19 B;  3AJ4 A;  3QWM A;  4XWX A;  2YVC A;  2LG1 A;  3BJI A;  1U2B A;  2UVM A;  1J19 A;  1V88 A;  2KCJ A;  1EAZ A;  3PVL A;  3U8Z A;  2K2J A;  2RUK B;  3VIA A;  4CYE A;  5FI0 A;  2COC A;  2DN6 A;  4MY6 A;  2W2W A;  4A6H A;  1K5D B;  3QIJ A;  2Z0Q A;  2DYN A;  1PFJ A;  1KZG A;  3ULC A;  1X1F A;  1FOE A;  1EVH A;  1OQN A;  3A8Q A;  2MWN B;  4P7I A;  1X86 A;  1H4R A;  2H7E A;  2E2X A;  4DX8 A;  2P0H A;  5LON B;  2GS0 A;  3D8D A;  4F7U P;  4D0N B;  3VOQ A;  4HB2 B;  1QC6 A;  4HB4 B;  5D3X A;  1DRO A;  2D2Q A;  1DDV A;  5DIF B;  2UZR A;  2CY5 A;  3KRX A;  1FHO A;  5GOW B;  2QKL A;  3ODX A;  2Q13 A;  4Y94 A;  3P7Z A;  2DHK A;  2QKM A;  5EFX A;  3PZD A;  3PSC A;  4H8S A;  1GC6 A;  2LOX A;  1UPR A;  2YS5 A;  2D9X A;  1U5E A;  3SV1 A;  3U7D A;  2W2X C;  4F7G A;  2COD A;  1MAI A;  1MK9 B;  4DXA B;  3FSS A;  3WA0 A;  3ULB A;  2ZPY A;  1J0W A;  2Y7B A;  5HE1 A;  4IFS A;  2LUL A;  3ODO A;  4HAU B;  1W1G A;  3HW2 B;  1B55 A;  3HQC A;  4GN1 A;  4K2P A;  2PZ1 A;  1AWE A;  1XCG A;  4MK0 A;  4CHM A;  1BTK A;  1H10 A;  2J59 M;  5HE3 A;  2ROV A;  5J3Y A;  1KI1 B;  3MDB C;  1PMS A;  1DYN A;  2KUP A;  2EMS A;  1V5P A;  2G35 A;  1NTV A;  2I1K A;  4F7H A;  2AL6 A;  4YL8 A;  2DKP A;  5HE0 A;  2D9V A;  4HHV A;  1FGY A;  1M7R A;  2HE7 A;  3NSU A;  5C79 A;  2KGX B;  1TQZ A;  3BIN A;  5L81 A;  2X18 A;  2YT0 A;  3TO1 A;  4HAT B;  3CIK A;  3SYX A;  4HAW B;  1LB1 A;  1XR0 B;  2Z0O A;  3SUZ A;  2Y8F A;  1I7A A;  5KCV A;  2RLO A;  4EJN A;  2DA0 A;  3TW1 A;  1V5M A;  2EMT A;  5J3Q A;  1E5W A;  2Z0P A;  2P8V A;  2FJL A;  2CRF A;  4DX9 0;  1ZC4 B;  4Z2M B;  4KHB B;  4WSF A;  3M1I B;  4HDO A;  5D27 A;  2RNR B;  3FM8 C;  5C5B A;  3V5W A;  3A8P A;  1BAK A;  3CXB B;  3P6A A;  3MPX A;  2OTX A;  1W1H A;  5DI9 B;  1QQG A;  2MDX A;  2HTH B;  2RGN B;  1UNP A;  1MKE A;  2MFQ A;  5DHA B;  2LKO A;  1RRP B;  2YSZ A;  2D9W A;  1EGX A;  1ZSQ A;  2ADZ A;  4K2O A;  3ZVR A;  1LW3 A;  5DHF B;  4HB3 B;  2P0D A;  1DBH A;  2RSG A;  2GJY A;  2YS3 A;  4GMX B;  1P5T A;  1GC7 A;  2R09 A;  1SHC A;  3OAN A;  4ZRI A;  1V89 A;  1OY2 A;  5JHG A;  5D3Y A;  5C6R A;  1BWN A;  4A6K A;  2CAY A;  1X1G A;  2ELA A;  3QBV B;  4PNK A;  5D3V A;  2ELB A;  3A98 B;  3AU4 A;  4A6F B;  4GZU A;  2N0Y A;  1PLS A;  4HDQ A;  2D4Q A;  1WJM A;  2DHJ A;  1FHW A;  5JP4 A;  3WYF B;  2R0D A;  2COF A;  1MIZ B;  2DLW A;  1IRS A;  2Y8G A;  4K81 A;  3DXE A;  3G9W A;  5HE2 A;  2YT1 A;  1WI1 A;  4NY0 A;  4IAP A;  4WVF B;  2AEH A;  5LOP B;  4NSW A;  1ZC3 B;  2YRY A;  1X11 A;  1U29 A;  2DYQ A;  4MT7 A;  1WGU A;  4B6H A;  2L1C A;  4KAX B;  1FHX A;  2IFS A;  2VRW B;  1XX0 A;  1U27 A;  4EKU A;  4HAZ B;  4Z2N A;  3GYP A;  2I1J A;  1UNQ A;  4KHO A;  5KQ1 A;  3KRW A;  3PG7 A;  4TKN A;  1MIX A;  1MK7 B;  3D8F A;  4GXB A;  3RCP A;  3PP2 A;  4PQ0 A;  1FB8 A;  4HAX B;  3PEG A;  3SO6 A;  4ZRK A;  2M38 A;  1UEF A;  2NMB A;  4HAY B;  1DDW A;  1NU2 A;  5DH9 B;  1U5D A;  3DXC A;  3TCA A;  4KVG B;  2DTC A;  2J0K A;  2P0F A;  1WG7 A;  2OQB A;  3O96 A;  2IYB A;  3ZDT A;  1Z87 A;  1ZM0 A;  1XD4 A;  1FAO A;  2I5F A;  2J0J A;  5J3T A;  3D8E A;  1P6S A;  1WGQ A;  1DDM A;  2MKR A;  1NTY A;  4DBB A;  3UZT A;  2EJ8 A;  4BBK A;  1P3R A;  3T06 A;  1UPQ A;  2DFK A;  1Y5O A;  2VSZ A;  5CLQ B;  1X05 A;  2LYD A;  1WVH A;  1U5F A;  2D11 A;  2D10 A;  3KY9 A;  4HB0 B;  2DX5 A;  2XQN M;  5C16 A;  2J0M A;  2W2X D;  2JP2 A;  1N3H A;  5D3W A;  3F0W A;  4GPT B;  1KZ7 A;  4IOY X;  1I2H A;  1UNR A;  2D9Y A;  1XOD A;  2LOZ A;  3KZ1 A;  2K2U A;  3IVF A;  1Q67 A;  3SNH A;  4A6F A;  3PVW A;  1ZVR A;  5CLL B;  1MPH A;  3TFM A;  1XKE A;  5JHH A;  3GYO A;  4GMV A;  4WJ7 A;  3DXD A;  1SGH A;  2N23 A;  2I5C A;  1BTN A;  2ROZ B;  4L6E A;  2K00 A;  4ZRJ A;  2DX1 A;  2UZS A;  2CY4 A;  4EMO A;  1U5G A;  5FI1 A;  1WJ1 A;  4A5K A;  2GCL A;  2H7D A;  3N7C A;  2D9Z A;  2YF0 A;  1TXD A;  4CHJ A;  3LJU X;  2DHI A;  4KHA A;  3ODW A;  2YS1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...