1WJ1A

Solution structure of phosphotyrosine interaction domain of mouse numb protein
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
156
structure length
156
Chain Sequence
b'GSSGSSGASRPHQWQTDEEGVRTGKCSFPVKYLGHVEVDESRGMHICEDAVKRLKATGKKAVKAVLWVSADGLRVVDEKTKDLIVDQTIEKVSFCAPDRNFDRAFSYICRDGTTRRWICHCFMAVKDTGERLSHAVGCAFAACLERKQKRSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Numb protein
publication title Solution structure of phosphotyrosine interaction domain of mouse Numb protein
rcsb
source organism Mus musculus
molecule tags Signaling protein
total genus 24
structure length 156
sequence length 156
ec nomenclature
pdb deposition date 2004-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00640 PID Phosphotyrosine interaction domain (PTB/PID)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1wj1A01
2YRYA 4HAWB 1OY2A 5D3XA 1ZSQA 3ML4A 3U7DA 4MY6A 1QQGA 2RVBB 3BINA 5JHHA 5EFXA 2G35A 1BWNA 4BBKA 5LOPB 2D4QA 4YL8A 3ODXA 4EKUA 1FGZA 1NTVA 1BTKA 1Y19B 1K5DB 3LJUX 2DX1A 1I7AA 1U5EA 1WG7A 2L2IA 2MWNB 1M7EA 1WVHA 1KZ7A 1DYNA 2R09A 2K2UA 4XWXA 5HE2A 1FOEA 2Y8FA 4D0NB 1XX0A 2Z0QA 4PNKA 1MK7B 1DDVA 3TW1A 1EVHA 2I5CA 1EGXA 2HTHB 5HE0A 2YSZA 3G9WA 1W1DA 1QC6A 2GCLA 3KRXA 3U8ZA 1MAIA 3PSCA 5DH9B 4TKNA 4KAXB 2M14A 1SGHA 2DHJA 1N3HA 2OTXA 2P0DA 4HB4B 4NSWA 2D10A 3N7CA 3FEHA 2YS5A 1U2BA 3D8EA 1NU2A 3CXBB 1OQNA 4ZRIA 4IFSA 2RGNB 4GXBA 2IYBA 3GYPA 3NSUA 1MIZB 2P8VA 2J0JA 2YT1A 1DROA 1FAOA 2YS1A 2ROVA 2PZ1A 2ROZB 4H8SA 2UZRA 2FJLA 2P0HA 2H7DA 2J0MA 1WGQA 5GOWB 5HE3A 1V88A 4K81A 4HB3B 2RSGA 4DXAB 5J3TA 4C0AA 1X05A 2D9YA 4MK0A 4A6KA 3QBVB 3GYOA 4L6EA 2LKOA 3UZTA 3AU5A 4HDQA 3OANA 3TFMA 2DYNA 3ODOA 2ELBA 5D3WA 1U29A 5HE1A 1WGUA 3AU4A 5KCVA 2DX5A 2CODA 1BTNA 1P5TA 1PLSA 2EC1A 2MFQA 1H10A 1MK9B 1V5MA 3PG7A 4PQ0A 2D2QA 3IVFA 4DX8A 5JP4A 2H7EA 2AL6A 4EMOA 2K2JA 5D27A 1KI1B 3SUZA 5C6RA 3SNHA 3M1IB 1XR0B 3PEGA 4ZRJA 1XKEA 1M7RA 1GC7A 3VOQA 5J3YA 1I2HA 1Q67A 2VSZA 2Z0PA 3KY9A 2COCA 1KZGA 4B6HA 1GC6A 3RCPA 1NTYA 1WI1A 3QWMA 1TJ6A 3QIJA 4K2PA 1X1FA 2QKMA 1PMSA 2D11A 2ZPYA 2LULA 2CRFA 4GMXB 5DIFB 4Y94A 1DBHA 2OQBA 4HHVA 1FHXA 4YONA 5CLLB 2COAA 1AQCA 4KHBB 2EMSA 4Z2NA 2YS3A 2NMBA 3TO1A 5C5BA 2UZSA 2DYQA 2J0KA 3MPXA 4A6FA 4A5KA 1MKEA 2AEHA 2COFA 2ADZA 3A98B 4IAPA 1WJMA 2XQNM 3O96A 2Z0OA 2DKPA 2VRWB 4CHJA 3TCAA 3KRWA 5C5BB 4HAUB 2DKQA 1UNQA 3WA0A 1UPRA 1J19A 1FHWA 2X18A 3A8QA 1H4RA 4GMVA 4F7UP 2LG1A 4K17A 1V89A 5DI9B 1MIXA 5FI1A 3ULBA 2NZ8B 4HDOA 1V5PA 2MKRA 3CIKA 3HK0A 3ZDTA 2I1KA 3HQCA 2Y8GA 3F0WA 1XD4A 4KVGB 1FGYA 1RRPB 3DXDA 1U5GA 5C79A 5DHAB 1P3RA 4WVFB 3F5RA 2D9XA 5D3YA 2GCJA 1U5DA 2GJYA 3PVUA 1W1HA 3DXEA 2E2XA 2I5FA 4P7IA 2J59M 4Z2MB 5C16A 1UNRA 4HAZB 3BJIA 4DBBA 5D3VA 1ZM0A 1E5WA 5JLJB 3P6AA 3D8DA 3SO6A 3A8PA 1ISNA 5J3QA 2M38A 2P0FA 1P6SA 2KCJA 2CY5A 3PVLA 2D9WA 1SHCA 4MT7A 4HATB 4GPTB 4WSFA 3PVWA 3KZ1A 3WYFB 5L81A 5DHFB 4EJNA 2W2WA 5LONB 1FHOA 2YF0A 2VKIA 2N23A 2CY4A 1ZVRA 4A6HA 2I1JA 4DX90 3PZDA 4IOYX 2UVMA 3PP2A 1RJ2A 1XODA 2D9ZA 2HE7A 1OMWA 2DHIA 2R0DA 4GZUA 1U27A 1TXDA 1PFJA 2KGXB 4WJ7A 4HB2B 4NY0A 1IRSA 1LB1A 4GN1A 1TQZA 2MDXA 4CHMA 1X11A 2K00A 2EMTA 2W2XC 1UNPA 4F7HA 3P7ZA 5CLQB 5KQ4A 3DXCA 4K2OA 4ZRKA 4KHAA 1UPQA 1LW3A 3FM8C 5KQ1A 1Y5OA 3SYXA 1ZC3B 1XCGA 1ZC4B 5JHGA 3X23A 1MPHA 2L1CA 4KHOA 2YVCA 2Q13A 3T06A 4A6FB 1FB8A 3MDBC 1K5GB 1GG3A 2IFSA 2W2XD 1V5UA 2RLOA 4HAVB 2LOXA 1V61A 1DDWA 2DTCA 2QKLA 2CAYA 2BCJA 2DFKA 1X86A 5FI0A 2KUPA 1Z87A 2DN6A 3V5WA 2LOZA 4HB0B 1U5FA 2GS0A 4TYZA 2DA0A 1AWEA 1EF1A 2LYDA 1UEFA 3SV1A 1W1GA 4HAXB 1J0WA 1WJ1A 3ULCA 4CYEA 3KSYA 1BAKA 2JP2A 1B55A 2N0YA 2DHKA 1EAZA 2D9VA 2RUKB 3FSSA 3ZVRA 3AJ4A 1X1GA 3VIAA 4HAYB 2Y7BA 2DLWA 1NI2A 2YT0A 3D8FA 1DDMA 2ELAA 3TVVA 3ODWA 4F7GA 2EJ8A 2V76A 2RNRB 3HW2B
chains in the Genus database with same CATH superfamily
2YRYA 4HAWB 1OY2A 5D3XA 2FJUB 1ZSQA 3ML4A 3U7DA 4MY6A 4QXAB 1QQGA 2RVBB 3BINA 5JHHA 5EFXA 2G35A 1BWNA 2K49A 4BBKA 5LOPB 2Z4DA 2D4QA 4YL8A 3ODXA 4EKUA 1FGZA 1NTVA 1BTKA 4D6WA 1Y19B 1K5DB 3LJUX 4QJ5B 2DX1A 3NWAA 1I7AA 1U5EA 1WG7A 2L2IA 2MWNB 1M7EA 2KUQA 1WVHA 4OSNA 4KHBA 5I2MA 1KZ7A 1DYNA 2R09A 2K2UA 4XWXA 5HE2A 1FOEA 2Y8FA 4D0NB 1XX0A 2Z0QA 4PNKA 1MK7B 1DDVA 3TW1A 1EVHA 2I5CA 1EGXA 2HTHB 5HE0A 2YSZA 3G9WA 1W1DA 1QC6A 2GCLA 3KRXA 3U8ZA 1MAIA 3PSCA 5DH9B 4TKNA 4KAXB 2M14A 1SGHA 2DHJA 1N3HA 5I2SA 2OTXA 2P0DA 4HB4B 4NSWA 2D10A 3FEHA 3N7CA 2YS5A 1U2BA 3D8EA 1NU2A 3CXBB 1OQNA 4ZRIA 4IFSA 2RGNB 4GXBA 4QJ3B 2IYBA 3GYPA 3NSUA 1MIZB 2P8VA 2J0JA 2YT1A 2Z59A 1DROA 1FAOA 2YS1A 2ROVA 2PZ1A 2ROZB 4H8SA 2UZRA 2FJLA 2P0HA 2H7DA 2RRFA 2J0MA 1WGQA 5GOWB 5HE3A 1V88A 4K81A 4HB3B 2RSGA 4DXAB 5J3TA 4C0AA 1X05A 2D9YA 3DCXA 4MK0A 4A6KA 3QBVB 3GYOA 4L6EA 2LKOA 3UZTA 3AU5A 4HDQA 3OANA 3TFMA 2DYNA 3ODOA 2ELBA 5D3WA 1U29A 5HE1A 1WGUA 4OT1A 3AU4A 5KCVA 2DX5A 2K8EA 2CODA 1BTNA 1P5TA 1PLSA 2EC1A 2MFQA 4CSQA 1H10A 1MK9B 1V5MA 3PG7A 4PQ0A 2D2QA 3IVFA 4DX8A 5JP4A 2H7EA 2AL6A 4EMOA 2K2JA 5D27A 1KI1B 3SUZA 5C6RA 3SNHA 3M1IB 3B77A 1XR0B 3PEGA 4L1RA 4ZRJA 1XKEA 5LG4B 1M7RA 1GC7A 3VOQA 5J3YA 1I2HA 1Q67A 2VSZA 2Z0PA 3KY9A 2COCA 1KZGA 4B6HA 1GC6A 3RCPA 1NTYA 1WI1A 3QWMA 1TJ6A 3QIJA 4K2PA 1X1FA 2QKMA 1PMSA 2D11A 2ZPYA 2LULA 2CRFA 4GMXB 5DIFB 3U12A 4Y94A 1DBHA 2OQBA 4HHVA 1FHXA 4YONA 5CLLB 2COAA 1AQCA 4KHBB 2EMSA 3NWFA 4Z2NA 2YS3A 4HSIA 2R2YA 2NMBA 3TO1A 5C5BA 2UZSA 2DYQA 2NBVA 2J0KA 3MPXA 4A6FA 4A5KA 1MKEA 2AEHA 2COFA 2ADZA 3A98B 4IAPA 1WJMA 2XQNM 3O96A 2Z0OA 2DKPA 2VRWB 4CHJA 3TCAA 3KRWA 5C5BB 4HAUB 2DKQA 1UNQA 2KIGA 3WA0A 1UPRA 1J19A 1FHWA 2X18A 3A8QA 1H4RA 4GMVA 4F7UP 2LG1A 4K17A 1V89A 5DI9B 3FVCA 1MIXA 5FI1A 3ULBA 2NZ8B 4HDOA 1V5PA 2MKRA 3CIKA 3HK0A 3ZDTA 2I1KA 3HQCA 2Y8GA 3F0WA 4GOUA 1XD4A 4KVGB 1FGYA 4GNKB 3DXDA 1RRPB 1U5GA 5C79A 2GUMA 5DHAB 1P3RA 4WVFB 3F5RA 2D9XA 5D3YA 2GCJA 1U5DA 2GJYA 3PVUA 1W1HA 3DXEA 2E2XA 2I5FA 4P7IA 4DIXA 2J59M 4Z2MB 5C16A 1UNRA 4HAZB 3BJIA 4DBBA 2Z13A 1ZM0A 1E5WA 5D3VA 5JLJB 3P6AA 3D8DA 3SO6A 3A8PA 1T77A 1ISNA 5J3QA 2M38A 2P0FA 1P6SA 2KCJA 2CY5A 3PVLA 2D9WA 1SHCA 4MT7A 4HATB 1MI1A 4GPTB 4WSFA 3PVWA 3KZ1A 3WYFB 5L81A 5DHFB 4EJNA 2W2WA 5LONB 1FHOA 2YF0A 2VKIA 2N23A 2CY4A 1ZVRA 4A6HA 2I1JA 4DX90 3PZDA 4IOYX 2UVMA 3PP2A 1RJ2A 1XODA 2D9ZA 2HE7A 1OMWA 2DHIA 2R0DA 4GZUA 3NWDA 1U27A 1TXDA 1PFJA 2KGXB 4WJ7A 4HB2B 4NY0A 1IRSA 1LB1A 1ZYIA 5IRSA 4GN1A 1TQZA 2MDXA 4CHMA 1X11A 2K00A 2EMTA 2W2XC 1UNPA 5M4YB 4F7HA 3P7ZA 5CLQB 5KQ4A 3DXCA 4K2OA 4ZRKA 4KHAA 1UPQA 1LW3A 3FM8C 5KQ1A 1Y5OA 3SYXA 1ZC3B 1XCGA 1ZC4B 5JHGA 3X23A 1MPHA 2L1CA 4KHOA 2YVCA 2Q13A 3T06A 4A6FB 1FB8A 3MDBC 1K5GB 4QJ4B 1GG3A 2IFSA 2W2XD 1V5UA 2RLOA 4HAVB 2LOXA 1V61A 1DDWA 2DTCA 2QKLA 2CAYA 2BCJA 2DFKA 1X86A 5FI0A 3OHMB 2KUPA 2KIEA 1Z87A 2DN6A 3V5WA 2LOZA 4HB0B 1U5FA 2GS0A 4TYZA 2DA0A 1AWEA 1EF1A 2LYDA 1UEFA 3SV1A 3A58A 1W1GA 4HAXB 3NW8A 1J0WA 1WJ1A 3ULCA 4CYEA 3KSYA 1BAKA 2JP2A 1B55A 2N0YA 2DHKA 1EAZA 2D9VA 2RUKB 2ZKMX 3HSAA 3FSSA 3HIEA 2KR0A 3ZVRA 3AJ4A 1X1GA 3VIAA 4HAYB 2Y7BA 2DLWA 1NI2A 2YT2A 2YT0A 3D8FA 1DDMA 2ELAA 2Z14A 3TVVA 3ODWA 4F7GA 2EJ8A 2V76A 2RNRB 3HW2B
chains in the Genus database with same CATH topology
2YRYA 4HAWB 1OY2A 5D3XA 1ZSQA 3ML4A 3U7DA 4MY6A 1QQGA 2RVBB 3BINA 5JHHA 5EFXA 2G35A 1BWNA 4BBKA 5LOPB 2D4QA 4YL8A 3ODXA 4EKUA 1FGZA 1NTVA 1BTKA 1Y19B 1K5DB 3LJUX 2DX1A 1I7AA 1U5EA 1WG7A 2L2IA 2MWNB 1M7EA 1WVHA 1KZ7A 1DYNA 2R09A 2K2UA 4XWXA 5HE2A 1FOEA 2Y8FA 4D0NB 1XX0A 2Z0QA 4PNKA 1MK7B 1DDVA 3TW1A 1EVHA 2I5CA 1EGXA 2HTHB 5HE0A 2YSZA 3G9WA 1W1DA 1QC6A 2GCLA 3KRXA 3U8ZA 1MAIA 3PSCA 5DH9B 4TKNA 4KAXB 2M14A 1SGHA 2DHJA 1N3HA 2OTXA 2P0DA 4HB4B 4NSWA 2D10A 3N7CA 3FEHA 2YS5A 1U2BA 3D8EA 1NU2A 3CXBB 1OQNA 4ZRIA 4IFSA 2RGNB 4GXBA 2IYBA 3GYPA 3NSUA 1MIZB 2P8VA 2J0JA 2YT1A 1DROA 1FAOA 2YS1A 2ROVA 2PZ1A 2ROZB 4H8SA 2UZRA 2FJLA 2P0HA 2H7DA 2J0MA 1WGQA 5GOWB 5HE3A 1V88A 4K81A 4HB3B 2RSGA 4DXAB 5J3TA 4C0AA 1X05A 2D9YA 4MK0A 4A6KA 3QBVB 3GYOA 4L6EA 2LKOA 3UZTA 3AU5A 4HDQA 3OANA 3TFMA 2DYNA 3ODOA 2ELBA 5D3WA 1U29A 5HE1A 1WGUA 3AU4A 5KCVA 2DX5A 2CODA 1BTNA 1P5TA 1PLSA 2EC1A 2MFQA 1H10A 1MK9B 1V5MA 3PG7A 4PQ0A 2D2QA 3IVFA 4DX8A 5JP4A 2H7EA 2AL6A 4EMOA 2K2JA 5D27A 1KI1B 3SUZA 5C6RA 3SNHA 3M1IB 1XR0B 3PEGA 4ZRJA 1XKEA 1M7RA 1GC7A 3VOQA 5J3YA 1I2HA 1Q67A 2VSZA 2Z0PA 3KY9A 2COCA 1KZGA 4B6HA 1GC6A 3RCPA 1NTYA 1WI1A 3QWMA 1TJ6A 3QIJA 4K2PA 1X1FA 2QKMA 1PMSA 2D11A 2ZPYA 2LULA 2CRFA 4GMXB 5DIFB 4Y94A 1DBHA 2OQBA 4HHVA 1FHXA 4YONA 5CLLB 2COAA 1AQCA 4KHBB 2EMSA 4Z2NA 2YS3A 2NMBA 3TO1A 5C5BA 2UZSA 2DYQA 2J0KA 3MPXA 4A6FA 4A5KA 1MKEA 2AEHA 2COFA 2ADZA 3A98B 4IAPA 1WJMA 2XQNM 3O96A 2Z0OA 2DKPA 2VRWB 4CHJA 3TCAA 3KRWA 5C5BB 4HAUB 2DKQA 1UNQA 3WA0A 1UPRA 1J19A 1FHWA 2X18A 3A8QA 1H4RA 4GMVA 4F7UP 2LG1A 4K17A 1V89A 5DI9B 1MIXA 5FI1A 3ULBA 2NZ8B 4HDOA 1V5PA 2MKRA 3CIKA 3HK0A 3ZDTA 2I1KA 3HQCA 2Y8GA 3F0WA 1XD4A 4KVGB 1FGYA 1RRPB 3DXDA 1U5GA 5C79A 5DHAB 1P3RA 4WVFB 3F5RA 2D9XA 5D3YA 2GCJA 1U5DA 2GJYA 3PVUA 1W1HA 3DXEA 2E2XA 2I5FA 4P7IA 2J59M 4Z2MB 5C16A 1UNRA 4HAZB 3BJIA 4DBBA 5D3VA 1ZM0A 1E5WA 5JLJB 3P6AA 3D8DA 3SO6A 3A8PA 1ISNA 5J3QA 2M38A 2P0FA 1P6SA 2KCJA 2CY5A 3PVLA 2D9WA 1SHCA 4MT7A 4HATB 4GPTB 4WSFA 3PVWA 3KZ1A 3WYFB 5L81A 5DHFB 4EJNA 2W2WA 5LONB 1FHOA 2YF0A 2VKIA 2N23A 2CY4A 1ZVRA 4A6HA 2I1JA 4DX90 3PZDA 4IOYX 2UVMA 3PP2A 1RJ2A 1XODA 2D9ZA 2HE7A 1OMWA 2DHIA 2R0DA 4GZUA 1U27A 1TXDA 1PFJA 2KGXB 4WJ7A 4HB2B 4NY0A 1IRSA 1LB1A 4GN1A 1TQZA 2MDXA 4CHMA 1X11A 2K00A 2EMTA 2W2XC 1UNPA 4F7HA 3P7ZA 5CLQB 5KQ4A 3DXCA 4K2OA 4ZRKA 4KHAA 1UPQA 1LW3A 3FM8C 5KQ1A 1Y5OA 3SYXA 1ZC3B 1XCGA 1ZC4B 5JHGA 3X23A 1MPHA 2L1CA 4KHOA 2YVCA 2Q13A 3T06A 4A6FB 1FB8A 3MDBC 1K5GB 1GG3A 2IFSA 2W2XD 1V5UA 2RLOA 4HAVB 2LOXA 1V61A 1DDWA 2DTCA 2QKLA 2CAYA 2BCJA 2DFKA 1X86A 5FI0A 2KUPA 1Z87A 2DN6A 3V5WA 2LOZA 4HB0B 1U5FA 2GS0A 4TYZA 2DA0A 1AWEA 1EF1A 2LYDA 1UEFA 3SV1A 1W1GA 4HAXB 1J0WA 1WJ1A 3ULCA 4CYEA 3KSYA 1BAKA 2JP2A 1B55A 2N0YA 2DHKA 1EAZA 2D9VA 2RUKB 3FSSA 3ZVRA 3AJ4A 1X1GA 3VIAA 4HAYB 2Y7BA 2DLWA 1NI2A 2YT0A 3D8FA 1DDMA 2ELAA 3TVVA 3ODWA 4F7GA 2EJ8A 2V76A 2RNRB 3HW2B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YRY A;  4HAW B;  1OY2 A;  5D3X A;  1ZSQ A;  3ML4 A;  3U7D A;  4MY6 A;  1QQG A;  2RVB B;  3BIN A;  5JHH A;  5EFX A;  2G35 A;  1BWN A;  4BBK A;  5LOP B;  2D4Q A;  4YL8 A;  3ODX A;  4EKU A;  1FGZ A;  1NTV A;  1BTK A;  1Y19 B;  1K5D B;  3LJU X;  2DX1 A;  1I7A A;  1U5E A;  1WG7 A;  2L2I A;  2MWN B;  1M7E A;  1WVH A;  1KZ7 A;  1DYN A;  2R09 A;  2K2U A;  4XWX A;  5HE2 A;  1FOE A;  2Y8F A;  4D0N B;  1XX0 A;  2Z0Q A;  4PNK A;  1MK7 B;  1DDV A;  3TW1 A;  1EVH A;  2I5C A;  1EGX A;  2HTH B;  5HE0 A;  2YSZ A;  3G9W A;  1W1D A;  1QC6 A;  2GCL A;  3KRX A;  3U8Z A;  1MAI A;  3PSC A;  5DH9 B;  4TKN A;  4KAX B;  2M14 A;  1SGH A;  2DHJ A;  1N3H A;  2OTX A;  2P0D A;  4HB4 B;  4NSW A;  2D10 A;  3N7C A;  3FEH A;  2YS5 A;  1U2B A;  3D8E A;  1NU2 A;  3CXB B;  1OQN A;  4ZRI A;  4IFS A;  2RGN B;  4GXB A;  2IYB A;  3GYP A;  3NSU A;  1MIZ B;  2P8V A;  2J0J A;  2YT1 A;  1DRO A;  1FAO A;  2YS1 A;  2ROV A;  2PZ1 A;  2ROZ B;  4H8S A;  2UZR A;  2FJL A;  2P0H A;  2H7D A;  2J0M A;  1WGQ A;  5GOW B;  5HE3 A;  1V88 A;  4K81 A;  4HB3 B;  2RSG A;  4DXA B;  5J3T A;  4C0A A;  1X05 A;  2D9Y A;  4MK0 A;  4A6K A;  3QBV B;  3GYO A;  4L6E A;  2LKO A;  3UZT A;  3AU5 A;  4HDQ A;  3OAN A;  3TFM A;  2DYN A;  3ODO A;  2ELB A;  5D3W A;  1U29 A;  5HE1 A;  1WGU A;  3AU4 A;  5KCV A;  2DX5 A;  2COD A;  1BTN A;  1P5T A;  1PLS A;  2EC1 A;  2MFQ A;  1H10 A;  1MK9 B;  1V5M A;  3PG7 A;  4PQ0 A;  2D2Q A;  3IVF A;  4DX8 A;  5JP4 A;  2H7E A;  2AL6 A;  4EMO A;  2K2J A;  5D27 A;  1KI1 B;  3SUZ A;  5C6R A;  3SNH A;  3M1I B;  1XR0 B;  3PEG A;  4ZRJ A;  1XKE A;  1M7R A;  1GC7 A;  3VOQ A;  5J3Y A;  1I2H A;  1Q67 A;  2VSZ A;  2Z0P A;  3KY9 A;  2COC A;  1KZG A;  4B6H A;  1GC6 A;  3RCP A;  1NTY A;  1WI1 A;  3QWM A;  1TJ6 A;  3QIJ A;  4K2P A;  1X1F A;  2QKM A;  1PMS A;  2D11 A;  2ZPY A;  2LUL A;  2CRF A;  4GMX B;  5DIF B;  4Y94 A;  1DBH A;  2OQB A;  4HHV A;  1FHX A;  4YON A;  5CLL B;  2COA A;  1AQC A;  4KHB B;  2EMS A;  4Z2N A;  2YS3 A;  2NMB A;  3TO1 A;  5C5B A;  2UZS A;  2DYQ A;  2J0K A;  3MPX A;  4A6F A;  4A5K A;  1MKE A;  2AEH A;  2COF A;  2ADZ A;  3A98 B;  4IAP A;  1WJM A;  2XQN M;  3O96 A;  2Z0O A;  2DKP A;  2VRW B;  4CHJ A;  3TCA A;  3KRW A;  5C5B B;  4HAU B;  2DKQ A;  1UNQ A;  3WA0 A;  1UPR A;  1J19 A;  1FHW A;  2X18 A;  3A8Q A;  1H4R A;  4GMV A;  4F7U P;  2LG1 A;  4K17 A;  1V89 A;  5DI9 B;  1MIX A;  5FI1 A;  3ULB A;  2NZ8 B;  4HDO A;  1V5P A;  2MKR A;  3CIK A;  3HK0 A;  3ZDT A;  2I1K A;  3HQC A;  2Y8G A;  3F0W A;  1XD4 A;  4KVG B;  1FGY A;  1RRP B;  3DXD A;  1U5G A;  5C79 A;  5DHA B;  1P3R A;  4WVF B;  3F5R A;  2D9X A;  5D3Y A;  2GCJ A;  1U5D A;  2GJY A;  3PVU A;  1W1H A;  3DXE A;  2E2X A;  2I5F A;  4P7I A;  2J59 M;  4Z2M B;  5C16 A;  1UNR A;  4HAZ B;  3BJI A;  4DBB A;  5D3V A;  1ZM0 A;  1E5W A;  5JLJ B;  3P6A A;  3D8D A;  3SO6 A;  3A8P A;  1ISN A;  5J3Q A;  2M38 A;  2P0F A;  1P6S A;  2KCJ A;  2CY5 A;  3PVL A;  2D9W A;  1SHC A;  4MT7 A;  4HAT B;  4GPT B;  4WSF A;  3PVW A;  3KZ1 A;  3WYF B;  5L81 A;  5DHF B;  4EJN A;  2W2W A;  5LON B;  1FHO A;  2YF0 A;  2VKI A;  2N23 A;  2CY4 A;  1ZVR A;  4A6H A;  2I1J A;  4DX9 0;  3PZD A;  4IOY X;  2UVM A;  3PP2 A;  1RJ2 A;  1XOD A;  2D9Z A;  2HE7 A;  1OMW A;  2DHI A;  2R0D A;  4GZU A;  1U27 A;  1TXD A;  1PFJ A;  2KGX B;  4WJ7 A;  4HB2 B;  4NY0 A;  1IRS A;  1LB1 A;  4GN1 A;  1TQZ A;  2MDX A;  4CHM A;  1X11 A;  2K00 A;  2EMT A;  2W2X C;  1UNP A;  4F7H A;  3P7Z A;  5CLQ B;  5KQ4 A;  3DXC A;  4K2O A;  4ZRK A;  4KHA A;  1UPQ A;  1LW3 A;  3FM8 C;  5KQ1 A;  1Y5O A;  3SYX A;  1ZC3 B;  1XCG A;  1ZC4 B;  5JHG A;  3X23 A;  1MPH A;  2L1C A;  4KHO A;  2YVC A;  2Q13 A;  3T06 A;  4A6F B;  1FB8 A;  3MDB C;  1K5G B;  1GG3 A;  2IFS A;  2W2X D;  1V5U A;  2RLO A;  4HAV B;  2LOX A;  1V61 A;  1DDW A;  2DTC A;  2QKL A;  2CAY A;  2BCJ A;  2DFK A;  1X86 A;  5FI0 A;  2KUP A;  1Z87 A;  2DN6 A;  3V5W A;  2LOZ A;  4HB0 B;  1U5F A;  2GS0 A;  4TYZ A;  2DA0 A;  1AWE A;  1EF1 A;  2LYD A;  1UEF A;  3SV1 A;  1W1G A;  4HAX B;  1J0W A;  1WJ1 A;  3ULC A;  4CYE A;  3KSY A;  1BAK A;  2JP2 A;  1B55 A;  2N0Y A;  2DHK A;  1EAZ A;  2D9V A;  2RUK B;  3FSS A;  3ZVR A;  3AJ4 A;  1X1G A;  3VIA A;  4HAY B;  2Y7B A;  2DLW A;  1NI2 A;  2YT0 A;  3D8F A;  1DDM A;  2ELA A;  3TVV A;  3ODW A;  4F7G A;  2EJ8 A;  2V76 A;  2RNR B;  3HW2 B; 
#chains in the Genus database with same CATH topology
 2YRY A;  4HAW B;  1OY2 A;  5D3X A;  2FJU B;  1ZSQ A;  3ML4 A;  3U7D A;  4MY6 A;  4QXA B;  1QQG A;  2RVB B;  3BIN A;  5JHH A;  5EFX A;  2G35 A;  1BWN A;  2K49 A;  4BBK A;  5LOP B;  2Z4D A;  2D4Q A;  4YL8 A;  3ODX A;  4EKU A;  1FGZ A;  1NTV A;  1BTK A;  4D6W A;  1Y19 B;  1K5D B;  3LJU X;  4QJ5 B;  2DX1 A;  3NWA A;  1I7A A;  1U5E A;  1WG7 A;  2L2I A;  2MWN B;  1M7E A;  2KUQ A;  1WVH A;  4OSN A;  4KHB A;  5I2M A;  1KZ7 A;  1DYN A;  2R09 A;  2K2U A;  4XWX A;  5HE2 A;  1FOE A;  2Y8F A;  4D0N B;  1XX0 A;  2Z0Q A;  4PNK A;  1MK7 B;  1DDV A;  3TW1 A;  1EVH A;  2I5C A;  1EGX A;  2HTH B;  5HE0 A;  2YSZ A;  3G9W A;  1W1D A;  1QC6 A;  2GCL A;  3KRX A;  3U8Z A;  1MAI A;  3PSC A;  5DH9 B;  4TKN A;  4KAX B;  2M14 A;  1SGH A;  2DHJ A;  1N3H A;  5I2S A;  2OTX A;  2P0D A;  4HB4 B;  4NSW A;  2D10 A;  3FEH A;  3N7C A;  2YS5 A;  1U2B A;  3D8E A;  1NU2 A;  3CXB B;  1OQN A;  4ZRI A;  4IFS A;  2RGN B;  4GXB A;  4QJ3 B;  2IYB A;  3GYP A;  3NSU A;  1MIZ B;  2P8V A;  2J0J A;  2YT1 A;  2Z59 A;  1DRO A;  1FAO A;  2YS1 A;  2ROV A;  2PZ1 A;  2ROZ B;  4H8S A;  2UZR A;  2FJL A;  2P0H A;  2H7D A;  2RRF A;  2J0M A;  1WGQ A;  5GOW B;  5HE3 A;  1V88 A;  4K81 A;  4HB3 B;  2RSG A;  4DXA B;  5J3T A;  4C0A A;  1X05 A;  2D9Y A;  3DCX A;  4MK0 A;  4A6K A;  3QBV B;  3GYO A;  4L6E A;  2LKO A;  3UZT A;  3AU5 A;  4HDQ A;  3OAN A;  3TFM A;  2DYN A;  3ODO A;  2ELB A;  5D3W A;  1U29 A;  5HE1 A;  1WGU A;  4OT1 A;  3AU4 A;  5KCV A;  2DX5 A;  2K8E A;  2COD A;  1BTN A;  1P5T A;  1PLS A;  2EC1 A;  2MFQ A;  4CSQ A;  1H10 A;  1MK9 B;  1V5M A;  3PG7 A;  4PQ0 A;  2D2Q A;  3IVF A;  4DX8 A;  5JP4 A;  2H7E A;  2AL6 A;  4EMO A;  2K2J A;  5D27 A;  1KI1 B;  3SUZ A;  5C6R A;  3SNH A;  3M1I B;  3B77 A;  1XR0 B;  3PEG A;  4L1R A;  4ZRJ A;  1XKE A;  5LG4 B;  1M7R A;  1GC7 A;  3VOQ A;  5J3Y A;  1I2H A;  1Q67 A;  2VSZ A;  2Z0P A;  3KY9 A;  2COC A;  1KZG A;  4B6H A;  1GC6 A;  3RCP A;  1NTY A;  1WI1 A;  3QWM A;  1TJ6 A;  3QIJ A;  4K2P A;  1X1F A;  2QKM A;  1PMS A;  2D11 A;  2ZPY A;  2LUL A;  2CRF A;  4GMX B;  5DIF B;  3U12 A;  4Y94 A;  1DBH A;  2OQB A;  4HHV A;  1FHX A;  4YON A;  5CLL B;  2COA A;  1AQC A;  4KHB B;  2EMS A;  3NWF A;  4Z2N A;  2YS3 A;  4HSI A;  2R2Y A;  2NMB A;  3TO1 A;  5C5B A;  2UZS A;  2DYQ A;  2NBV A;  2J0K A;  3MPX A;  4A6F A;  4A5K A;  1MKE A;  2AEH A;  2COF A;  2ADZ A;  3A98 B;  4IAP A;  1WJM A;  2XQN M;  3O96 A;  2Z0O A;  2DKP A;  2VRW B;  4CHJ A;  3TCA A;  3KRW A;  5C5B B;  4HAU B;  2DKQ A;  1UNQ A;  2KIG A;  3WA0 A;  1UPR A;  1J19 A;  1FHW A;  2X18 A;  3A8Q A;  1H4R A;  4GMV A;  4F7U P;  2LG1 A;  4K17 A;  1V89 A;  5DI9 B;  3FVC A;  1MIX A;  5FI1 A;  3ULB A;  2NZ8 B;  4HDO A;  1V5P A;  2MKR A;  3CIK A;  3HK0 A;  3ZDT A;  2I1K A;  3HQC A;  2Y8G A;  3F0W A;  4GOU A;  1XD4 A;  4KVG B;  1FGY A;  4GNK B;  3DXD A;  1RRP B;  1U5G A;  5C79 A;  2GUM A;  5DHA B;  1P3R A;  4WVF B;  3F5R A;  2D9X A;  5D3Y A;  2GCJ A;  1U5D A;  2GJY A;  3PVU A;  1W1H A;  3DXE A;  2E2X A;  2I5F A;  4P7I A;  4DIX A;  2J59 M;  4Z2M B;  5C16 A;  1UNR A;  4HAZ B;  3BJI A;  4DBB A;  2Z13 A;  1ZM0 A;  1E5W A;  5D3V A;  5JLJ B;  3P6A A;  3D8D A;  3SO6 A;  3A8P A;  1T77 A;  1ISN A;  5J3Q A;  2M38 A;  2P0F A;  1P6S A;  2KCJ A;  2CY5 A;  3PVL A;  2D9W A;  1SHC A;  4MT7 A;  4HAT B;  1MI1 A;  4GPT B;  4WSF A;  3PVW A;  3KZ1 A;  3WYF B;  5L81 A;  5DHF B;  4EJN A;  2W2W A;  5LON B;  1FHO A;  2YF0 A;  2VKI A;  2N23 A;  2CY4 A;  1ZVR A;  4A6H A;  2I1J A;  4DX9 0;  3PZD A;  4IOY X;  2UVM A;  3PP2 A;  1RJ2 A;  1XOD A;  2D9Z A;  2HE7 A;  1OMW A;  2DHI A;  2R0D A;  4GZU A;  3NWD A;  1U27 A;  1TXD A;  1PFJ A;  2KGX B;  4WJ7 A;  4HB2 B;  4NY0 A;  1IRS A;  1LB1 A;  1ZYI A;  5IRS A;  4GN1 A;  1TQZ A;  2MDX A;  4CHM A;  1X11 A;  2K00 A;  2EMT A;  2W2X C;  1UNP A;  5M4Y B;  4F7H A;  3P7Z A;  5CLQ B;  5KQ4 A;  3DXC A;  4K2O A;  4ZRK A;  4KHA A;  1UPQ A;  1LW3 A;  3FM8 C;  5KQ1 A;  1Y5O A;  3SYX A;  1ZC3 B;  1XCG A;  1ZC4 B;  5JHG A;  3X23 A;  1MPH A;  2L1C A;  4KHO A;  2YVC A;  2Q13 A;  3T06 A;  4A6F B;  1FB8 A;  3MDB C;  1K5G B;  4QJ4 B;  1GG3 A;  2IFS A;  2W2X D;  1V5U A;  2RLO A;  4HAV B;  2LOX A;  1V61 A;  1DDW A;  2DTC A;  2QKL A;  2CAY A;  2BCJ A;  2DFK A;  1X86 A;  5FI0 A;  3OHM B;  2KUP A;  2KIE A;  1Z87 A;  2DN6 A;  3V5W A;  2LOZ A;  4HB0 B;  1U5F A;  2GS0 A;  4TYZ A;  2DA0 A;  1AWE A;  1EF1 A;  2LYD A;  1UEF A;  3SV1 A;  3A58 A;  1W1G A;  4HAX B;  3NW8 A;  1J0W A;  1WJ1 A;  3ULC A;  4CYE A;  3KSY A;  1BAK A;  2JP2 A;  1B55 A;  2N0Y A;  2DHK A;  1EAZ A;  2D9V A;  2RUK B;  2ZKM X;  3HSA A;  3FSS A;  3HIE A;  2KR0 A;  3ZVR A;  3AJ4 A;  1X1G A;  3VIA A;  4HAY B;  2Y7B A;  2DLW A;  1NI2 A;  2YT2 A;  2YT0 A;  3D8F A;  1DDM A;  2ELA A;  2Z14 A;  3TVV A;  3ODW A;  4F7G A;  2EJ8 A;  2V76 A;  2RNR B;  3HW2 B; 
#chains in the Genus database with same CATH homology
 2YRY A;  4HAW B;  1OY2 A;  5D3X A;  1ZSQ A;  3ML4 A;  3U7D A;  4MY6 A;  1QQG A;  2RVB B;  3BIN A;  5JHH A;  5EFX A;  2G35 A;  1BWN A;  4BBK A;  5LOP B;  2D4Q A;  4YL8 A;  3ODX A;  4EKU A;  1FGZ A;  1NTV A;  1BTK A;  1Y19 B;  1K5D B;  3LJU X;  2DX1 A;  1I7A A;  1U5E A;  1WG7 A;  2L2I A;  2MWN B;  1M7E A;  1WVH A;  1KZ7 A;  1DYN A;  2R09 A;  2K2U A;  4XWX A;  5HE2 A;  1FOE A;  2Y8F A;  4D0N B;  1XX0 A;  2Z0Q A;  4PNK A;  1MK7 B;  1DDV A;  3TW1 A;  1EVH A;  2I5C A;  1EGX A;  2HTH B;  5HE0 A;  2YSZ A;  3G9W A;  1W1D A;  1QC6 A;  2GCL A;  3KRX A;  3U8Z A;  1MAI A;  3PSC A;  5DH9 B;  4TKN A;  4KAX B;  2M14 A;  1SGH A;  2DHJ A;  1N3H A;  2OTX A;  2P0D A;  4HB4 B;  4NSW A;  2D10 A;  3N7C A;  3FEH A;  2YS5 A;  1U2B A;  3D8E A;  1NU2 A;  3CXB B;  1OQN A;  4ZRI A;  4IFS A;  2RGN B;  4GXB A;  2IYB A;  3GYP A;  3NSU A;  1MIZ B;  2P8V A;  2J0J A;  2YT1 A;  1DRO A;  1FAO A;  2YS1 A;  2ROV A;  2PZ1 A;  2ROZ B;  4H8S A;  2UZR A;  2FJL A;  2P0H A;  2H7D A;  2J0M A;  1WGQ A;  5GOW B;  5HE3 A;  1V88 A;  4K81 A;  4HB3 B;  2RSG A;  4DXA B;  5J3T A;  4C0A A;  1X05 A;  2D9Y A;  4MK0 A;  4A6K A;  3QBV B;  3GYO A;  4L6E A;  2LKO A;  3UZT A;  3AU5 A;  4HDQ A;  3OAN A;  3TFM A;  2DYN A;  3ODO A;  2ELB A;  5D3W A;  1U29 A;  5HE1 A;  1WGU A;  3AU4 A;  5KCV A;  2DX5 A;  2COD A;  1BTN A;  1P5T A;  1PLS A;  2EC1 A;  2MFQ A;  1H10 A;  1MK9 B;  1V5M A;  3PG7 A;  4PQ0 A;  2D2Q A;  3IVF A;  4DX8 A;  5JP4 A;  2H7E A;  2AL6 A;  4EMO A;  2K2J A;  5D27 A;  1KI1 B;  3SUZ A;  5C6R A;  3SNH A;  3M1I B;  1XR0 B;  3PEG A;  4ZRJ A;  1XKE A;  1M7R A;  1GC7 A;  3VOQ A;  5J3Y A;  1I2H A;  1Q67 A;  2VSZ A;  2Z0P A;  3KY9 A;  2COC A;  1KZG A;  4B6H A;  1GC6 A;  3RCP A;  1NTY A;  1WI1 A;  3QWM A;  1TJ6 A;  3QIJ A;  4K2P A;  1X1F A;  2QKM A;  1PMS A;  2D11 A;  2ZPY A;  2LUL A;  2CRF A;  4GMX B;  5DIF B;  4Y94 A;  1DBH A;  2OQB A;  4HHV A;  1FHX A;  4YON A;  5CLL B;  2COA A;  1AQC A;  4KHB B;  2EMS A;  4Z2N A;  2YS3 A;  2NMB A;  3TO1 A;  5C5B A;  2UZS A;  2DYQ A;  2J0K A;  3MPX A;  4A6F A;  4A5K A;  1MKE A;  2AEH A;  2COF A;  2ADZ A;  3A98 B;  4IAP A;  1WJM A;  2XQN M;  3O96 A;  2Z0O A;  2DKP A;  2VRW B;  4CHJ A;  3TCA A;  3KRW A;  5C5B B;  4HAU B;  2DKQ A;  1UNQ A;  3WA0 A;  1UPR A;  1J19 A;  1FHW A;  2X18 A;  3A8Q A;  1H4R A;  4GMV A;  4F7U P;  2LG1 A;  4K17 A;  1V89 A;  5DI9 B;  1MIX A;  5FI1 A;  3ULB A;  2NZ8 B;  4HDO A;  1V5P A;  2MKR A;  3CIK A;  3HK0 A;  3ZDT A;  2I1K A;  3HQC A;  2Y8G A;  3F0W A;  1XD4 A;  4KVG B;  1FGY A;  1RRP B;  3DXD A;  1U5G A;  5C79 A;  5DHA B;  1P3R A;  4WVF B;  3F5R A;  2D9X A;  5D3Y A;  2GCJ A;  1U5D A;  2GJY A;  3PVU A;  1W1H A;  3DXE A;  2E2X A;  2I5F A;  4P7I A;  2J59 M;  4Z2M B;  5C16 A;  1UNR A;  4HAZ B;  3BJI A;  4DBB A;  5D3V A;  1ZM0 A;  1E5W A;  5JLJ B;  3P6A A;  3D8D A;  3SO6 A;  3A8P A;  1ISN A;  5J3Q A;  2M38 A;  2P0F A;  1P6S A;  2KCJ A;  2CY5 A;  3PVL A;  2D9W A;  1SHC A;  4MT7 A;  4HAT B;  4GPT B;  4WSF A;  3PVW A;  3KZ1 A;  3WYF B;  5L81 A;  5DHF B;  4EJN A;  2W2W A;  5LON B;  1FHO A;  2YF0 A;  2VKI A;  2N23 A;  2CY4 A;  1ZVR A;  4A6H A;  2I1J A;  4DX9 0;  3PZD A;  4IOY X;  2UVM A;  3PP2 A;  1RJ2 A;  1XOD A;  2D9Z A;  2HE7 A;  1OMW A;  2DHI A;  2R0D A;  4GZU A;  1U27 A;  1TXD A;  1PFJ A;  2KGX B;  4WJ7 A;  4HB2 B;  4NY0 A;  1IRS A;  1LB1 A;  4GN1 A;  1TQZ A;  2MDX A;  4CHM A;  1X11 A;  2K00 A;  2EMT A;  2W2X C;  1UNP A;  4F7H A;  3P7Z A;  5CLQ B;  5KQ4 A;  3DXC A;  4K2O A;  4ZRK A;  4KHA A;  1UPQ A;  1LW3 A;  3FM8 C;  5KQ1 A;  1Y5O A;  3SYX A;  1ZC3 B;  1XCG A;  1ZC4 B;  5JHG A;  3X23 A;  1MPH A;  2L1C A;  4KHO A;  2YVC A;  2Q13 A;  3T06 A;  4A6F B;  1FB8 A;  3MDB C;  1K5G B;  1GG3 A;  2IFS A;  2W2X D;  1V5U A;  2RLO A;  4HAV B;  2LOX A;  1V61 A;  1DDW A;  2DTC A;  2QKL A;  2CAY A;  2BCJ A;  2DFK A;  1X86 A;  5FI0 A;  2KUP A;  1Z87 A;  2DN6 A;  3V5W A;  2LOZ A;  4HB0 B;  1U5F A;  2GS0 A;  4TYZ A;  2DA0 A;  1AWE A;  1EF1 A;  2LYD A;  1UEF A;  3SV1 A;  1W1G A;  4HAX B;  1J0W A;  1WJ1 A;  3ULC A;  4CYE A;  3KSY A;  1BAK A;  2JP2 A;  1B55 A;  2N0Y A;  2DHK A;  1EAZ A;  2D9V A;  2RUK B;  3FSS A;  3ZVR A;  3AJ4 A;  1X1G A;  3VIA A;  4HAY B;  2Y7B A;  2DLW A;  1NI2 A;  2YT0 A;  3D8F A;  1DDM A;  2ELA A;  3TVV A;  3ODW A;  4F7G A;  2EJ8 A;  2V76 A;  2RNR B;  3HW2 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...