1WJ1A

Solution structure of phosphotyrosine interaction domain of mouse numb protein
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
156
structure length
156
Chain Sequence
GSSGSSGASRPHQWQTDEEGVRTGKCSFPVKYLGHVEVDESRGMHICEDAVKRLKATGKKAVKAVLWVSADGLRVVDEKTKDLIVDQTIEKVSFCAPDRNFDRAFSYICRDGTTRRWICHCFMAVKDTGERLSHAVGCAFAACLERKQKRSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Numb protein
publication title Solution structure of phosphotyrosine interaction domain of mouse Numb protein
rcsb
source organism Mus musculus
molecule tags Signaling protein
total genus 24
structure length 156
sequence length 156
ec nomenclature
pdb deposition date 2004-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00640 PID Phosphotyrosine interaction domain (PTB/PID)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1wj1A01
4TYZA 5DHFB 2CRFA 3X23A 4H8SA 1V5PA 2MKRA 2DHIA 4HB4B 3PVUA 4EMOA 1Q67A 2DYQA 3KSYA 1B55A 2DX1A 4GMXB 1GG3A 2CY5A 3ODOA 2QKLA 3AJ4A 5D3WA 1ZC3B 2Q13A 1P6SA 1P3RA 2VKIA 4NSWA 2V76A 3CXBB 1NU2A 4HDOA 3MPXA 1U5EA 2W2XC 1EAZA 3HQCA 3U8ZA 2UVMA 1DYNA 3KRWA 5C16A 1UEFA 4MT7A 5FI0A 1ZC4B 2VSZA 1UPRA 3PP2A 1K5DB 4HAWB 2DYNA 4HATB 3SO6A 1DDWA 2R0DA 5C79A 3KZ1A 3LJUX 4XWXA 1FHXA 3D8FA 4A6KA 1E5WA 3P6AA 2K00A 3ODWA 1WG7A 2ADZA 3N7CA 1DBHA 1KZ7A 2N0YA 2YT0A 4HB3B 1NTYA 2E2XA 2Z0PA 5FI1A 1U2BA 4HAYB 4WJ7A 3TO1A 4IFSA 4ZRKA 2IFSA 2DX5A 3PZDA 1BWNA 1GC6A 4HAZB 3FM8C 2I5CA 3SNHA 1BAKA 2P0HA 2DKPA 2HTHB 1XR0B 2Z0QA 1MIXA 2H7EA 1EF1A 3ULBA 1XCGA 1I7AA 1TXDA 2RNRB 5DH9B 4EKUA 3ULCA 1ZM0A 4GMVA 5D3YA 4HAXB 1FOEA 1XD4A 4A5KA 1W1DA 2L1CA 1DDMA 1P5TA 1I2HA 1BTNA 4DX90 1FGYA 1K5GB 2D4QA 3O96A 2J0MA 1XODA 4L6EA 1WGQA 3GYOA 1RRPB 2YSZA 3OANA 2HE7A 2D9WA 3PVWA 3D8DA 5L81A 3KRXA 1H4RA 1X11A 4CYEA 4WVFB 2BCJA 1GC7A 5HE3A 1MKEA 1WI1A 3FEHA 4F7HA 4YL8A 1QQGA 5LOPB 2P8VA 5EFXA 2L2IA 4TKNA 1OQNA 3QWMA 3TW1A 1X1GA 2RSGA 4KVGB 5C5BA 5JP4A 2K2JA 2DLWA 3U7DA 3TVVA 3TFMA 2D9XA 2D9VA 3VIAA 2Y8GA 5DI9B 3GYPA 2KUPA 2OTXA 1LW3A 4GXBA 1TQZA 2IYBA 4MK0A 2M38A 4K2OA 3HK0A 4KHOA 4ZRJA 1AWEA 3A8PA 4HHVA 2MDXA 2OQBA 1Y19B 1MK7B 3ZDTA 2GCLA 3QIJA 3D8EA 2NZ8B 5DIFB 2DTCA 1PLSA 4PQ0A 2W2WA 2J0JA 5KQ1A 2UZSA 2GJYA 2J0KA 4NY0A 3G9WA 1EVHA 4P7IA 2D11A 1IRSA 1SGHA 5C5BB 2I1JA 2M14A 2KCJA 1UNRA 4GN1A 1XKEA 2YT1A 1UNPA 4YONA 3ML4A 4DXAB 2I5FA 2ROVA 2N23A 3RCPA 2EMSA 3FSSA 2MWNB 1SHCA 3HW2B 2X18A 1FB8A 2K2UA 2DFKA 3PEGA 5JHHA 3P7ZA 2D2QA 2FJLA 4Y94A 4DBBA 5CLQB 1M7EA 2GS0A 1U27A 2ELAA 1V89A 2LG1A 2YRYA 2KGXB 2AL6A 3F5RA 1NTVA 1X86A 2EJ8A 5J3QA 5KCVA 1ZSQA 1FHWA 2GCJA 5CLLB 1MK9B 4HB2B 2LULA 2LOZA 2J59M 3TCAA 4DX8A 1N3HA 1Y5OA 2COFA 4PNKA 4IAPA 1FAOA 4MY6A 2YVCA 1FHOA 1MIZB 1MAIA 1ZVRA 1DDVA 4ZRIA 4KHBB 4WSFA 3AU4A 4HAUB 5D27A 5DHAB 1DROA 4Z2NA 2ROZB 4K2PA 3PSCA 1WVHA 1X05A 5JLJB 4KHAA 2R09A 2W2XD 1U5FA 3DXCA 1X1FA 2YS1A 1FGZA 1PFJA 4HAVB 2DHKA 3KY9A 4K81A 3UZTA 4EJNA 4CHMA 1KZGA 4A6FA 1H10A 3DXEA 4HDQA 2NMBA 4C0AA 1U5GA 3WA0A 2QKMA 1QC6A 3PG7A 2COAA 5JHGA 1UPQA 4F7GA 1PMSA 2DA0A 1KI1B 1WGUA 1WJMA 2G35A 3AU5A 2D9YA 2CY4A 2DHJA 3T06A 3DXDA 3WYFB 5HE0A 2RUKB 2Y8FA 4D0NB 1V5MA 1V88A 2COCA 2UZRA 1WJ1A 2P0DA 3A8QA 3SYXA 1W1HA 2DN6A 2I1KA 2ELBA 3A98B 4K17A 3SV1A 1J19A 1OMWA 2RGNB 4GPTB 4Z2MB 4A6HA 3M1IB 2D10A 3MDBC 5HE2A 2JP2A 5C6RA 4GZUA 5D3XA 2YS5A 1XX0A 3ZVRA 2RLOA 3CIKA 2D9ZA 3VOQA 2RVBB 1LB1A 3F0WA 4A6FB 1V5UA 2EMTA 2P0FA 4B6HA 1U5DA 5J3YA 3BJIA 2Y7BA 1U29A 2ZPYA 4HB0B 2AEHA 1BTKA 2LYDA 4KAXB 1W1GA 5GOWB 3PVLA 2H7DA 2VRWB 5LONB 3SUZA 2PZ1A 2LKOA 1EGXA 1TJ6A 2YF0A 1Z87A 2CAYA 4BBKA 2YS3A 2EC1A 1ISNA 1V61A 2XQNM 3QBVB 1RJ2A 2CODA 3NSUA 4F7UP 1J0WA 3BINA 2MFQA 5KQ4A 3IVFA 3ODXA 5D3VA 1M7RA 5J3TA 1MPHA 5HE1A 2Z0OA 1AQCA 1OY2A 2DKQA 1UNQA 4IOYX 3V5WA 4CHJA 1NI2A 2LOXA
chains in the Genus database with same CATH superfamily
4TYZA 5DHFB 2CRFA 3X23A 4H8SA 1V5PA 2MKRA 2DHIA 3DCXA 4HB4B 3PVUA 4EMOA 1Q67A 2DYQA 3KSYA 1B55A 2DX1A 2FJUB 4GMXB 1GG3A 2CY5A 3ODOA 2QKLA 3AJ4A 5D3WA 1ZC3B 2Q13A 5M4YB 1P6SA 1P3RA 2VKIA 4NSWA 2V76A 3CXBB 1NU2A 4HDOA 3MPXA 1U5EA 2W2XC 1EAZA 3HQCA 3U8ZA 2UVMA 1DYNA 3KRWA 5C16A 1UEFA 5I2MA 2K8EA 4MT7A 5FI0A 1ZC4B 2VSZA 1UPRA 3PP2A 1K5DB 4HAWB 2DYNA 4HATB 3SO6A 1DDWA 2ZKMX 2R0DA 5C79A 3KZ1A 2KUQA 3LJUX 4XWXA 1FHXA 3D8FA 4A6KA 1E5WA 3P6AA 2K00A 3ODWA 1WG7A 2ADZA 3N7CA 1DBHA 1KZ7A 2N0YA 2YT0A 4HB3B 1NTYA 2E2XA 2Z0PA 5FI1A 1U2BA 4HAYB 4WJ7A 3TO1A 4IFSA 4ZRKA 2IFSA 2DX5A 3PZDA 1BWNA 1GC6A 4L1RA 4HAZB 3FM8C 2I5CA 3SNHA 1BAKA 2P0HA 2DKPA 2HTHB 1XR0B 2Z0QA 1MIXA 2H7EA 1EF1A 4QXAB 3ULBA 1XCGA 5I2SA 1I7AA 1TXDA 2RNRB 5DH9B 4EKUA 3ULCA 1ZM0A 4GMVA 5D3YA 4HAXB 1T77A 1FOEA 1XD4A 4A5KA 1W1DA 2L1CA 1DDMA 1P5TA 1I2HA 4OT1A 1BTNA 4DX90 1FGYA 1K5GB 2D4QA 3A58A 3O96A 2J0MA 1XODA 4L6EA 1WGQA 3GYOA 1RRPB 2YSZA 3OANA 3B77A 2HE7A 2D9WA 3PVWA 3D8DA 5L81A 2Z13A 3KRXA 1H4RA 1X11A 4CYEA 4WVFB 2BCJA 1GC7A 4QJ3B 5HE3A 1MKEA 1WI1A 3FEHA 4F7HA 4YL8A 4HSIA 1QQGA 5LOPB 2P8VA 5EFXA 2L2IA 4TKNA 1OQNA 3QWMA 3TW1A 1X1GA 5LG4B 3NWAA 3OHMB 2RSGA 4KVGB 5C5BA 5JP4A 2K2JA 2DLWA 3U7DA 3TVVA 3TFMA 2D9XA 2D9VA 2KIEA 3VIAA 2Y8GA 5DI9B 3GYPA 2KUPA 2OTXA 1LW3A 4GXBA 1TQZA 2IYBA 4MK0A 2M38A 3NWFA 4K2OA 3HK0A 4KHOA 4ZRJA 1AWEA 3A8PA 4HHVA 2RRFA 2MDXA 2OQBA 3FVCA 1Y19B 1MK7B 3ZDTA 2GCLA 3QIJA 3D8EA 2NZ8B 5DIFB 2DTCA 1PLSA 4PQ0A 2W2WA 2J0JA 5KQ1A 2UZSA 2GJYA 2J0KA 4NY0A 3G9WA 1EVHA 4CSQA 4KHBA 4P7IA 2D11A 1IRSA 1SGHA 5C5BB 2I1JA 2M14A 2KCJA 1UNRA 4GN1A 1XKEA 2YT1A 1UNPA 4YONA 3ML4A 4DXAB 2I5FA 2ROVA 2N23A 3RCPA 2EMSA 3FSSA 2MWNB 1SHCA 3HW2B 2X18A 1FB8A 2K2UA 2DFKA 3PEGA 5JHHA 3U12A 3P7ZA 2D2QA 2FJLA 4OSNA 4Y94A 4DBBA 5CLQB 1M7EA 2GS0A 3HIEA 1U27A 2ELAA 1V89A 2LG1A 2YRYA 2KGXB 2AL6A 3F5RA 1NTVA 1X86A 2EJ8A 5J3QA 5KCVA 1ZSQA 1FHWA 4DIXA 2GCJA 5CLLB 1MK9B 4HB2B 2LULA 2LOZA 2J59M 3TCAA 4DX8A 1N3HA 1Y5OA 2COFA 4PNKA 4IAPA 1FAOA 4MY6A 2YVCA 1FHOA 1MIZB 1MAIA 2K49A 1ZVRA 4D6WA 1DDVA 4GOUA 4ZRIA 4KHBB 4WSFA 3AU4A 4HAUB 5D27A 2KR0A 5DHAB 1DROA 4Z2NA 2ROZB 4K2PA 3PSCA 1WVHA 1X05A 5JLJB 4KHAA 2R09A 2W2XD 1U5FA 3HSAA 3DXCA 1X1FA 2YS1A 1FGZA 1PFJA 4HAVB 2DHKA 3KY9A 4K81A 3UZTA 2GUMA 4EJNA 4CHMA 1KZGA 4A6FA 1H10A 3DXEA 4HDQA 2NMBA 3NW8A 4C0AA 1U5GA 3WA0A 2QKMA 1QC6A 4QJ5B 3PG7A 2COAA 5JHGA 1UPQA 4F7GA 1PMSA 2DA0A 1KI1B 4GNKB 1WGUA 1WJMA 2G35A 3AU5A 5IRSA 2D9YA 2CY4A 2DHJA 3T06A 3DXDA 3WYFB 4QJ4B 5HE0A 2RUKB 2Y8FA 4D0NB 1V5MA 1V88A 2COCA 2UZRA 1WJ1A 2P0DA 3A8QA 3SYXA 1W1HA 2DN6A 2I1KA 2ELBA 3A98B 3NWDA 4K17A 3SV1A 1J19A 1OMWA 2NBVA 2RGNB 4GPTB 4Z2MB 3M1IB 4A6HA 2D10A 3MDBC 5HE2A 2JP2A 5C6RA 4GZUA 5D3XA 2YS5A 1XX0A 3ZVRA 2RLOA 3CIKA 2Z4DA 2D9ZA 3VOQA 2RVBB 1LB1A 3F0WA 4A6FB 1V5UA 2EMTA 2P0FA 4B6HA 1U5DA 5J3YA 3BJIA 2Z59A 2Y7BA 1U29A 2KIGA 2Z14A 2ZPYA 4HB0B 2AEHA 1BTKA 2LYDA 4KAXB 1W1GA 5GOWB 3PVLA 2H7DA 1ZYIA 2VRWB 5LONB 3SUZA 2PZ1A 2LKOA 1EGXA 1TJ6A 2YF0A 1Z87A 2CAYA 2R2YA 4BBKA 2YT2A 2YS3A 2EC1A 1ISNA 1V61A 2XQNM 3QBVB 1RJ2A 2CODA 1MI1A 3NSUA 4F7UP 1J0WA 3BINA 2MFQA 5KQ4A 3IVFA 3ODXA 5D3VA 1M7RA 5J3TA 1MPHA 5HE1A 2Z0OA 1AQCA 1OY2A 2DKQA 1UNQA 4IOYX 3V5WA 4CHJA 1NI2A 2LOXA
chains in the Genus database with same CATH topology
4TYZA 5DHFB 2CRFA 3X23A 4H8SA 1V5PA 2MKRA 2DHIA 4HB4B 3PVUA 4EMOA 1Q67A 2DYQA 3KSYA 1B55A 2DX1A 4GMXB 1GG3A 2CY5A 3ODOA 2QKLA 3AJ4A 5D3WA 1ZC3B 2Q13A 1P6SA 1P3RA 2VKIA 4NSWA 2V76A 3CXBB 1NU2A 4HDOA 3MPXA 1U5EA 2W2XC 1EAZA 3HQCA 3U8ZA 2UVMA 1DYNA 3KRWA 5C16A 1UEFA 4MT7A 5FI0A 1ZC4B 2VSZA 1UPRA 3PP2A 1K5DB 4HAWB 2DYNA 4HATB 3SO6A 1DDWA 2R0DA 5C79A 3KZ1A 3LJUX 4XWXA 1FHXA 3D8FA 4A6KA 1E5WA 3P6AA 2K00A 3ODWA 1WG7A 2ADZA 3N7CA 1DBHA 1KZ7A 2N0YA 2YT0A 4HB3B 1NTYA 2E2XA 2Z0PA 5FI1A 1U2BA 4HAYB 4WJ7A 3TO1A 4IFSA 4ZRKA 2IFSA 2DX5A 3PZDA 1BWNA 1GC6A 4HAZB 3FM8C 2I5CA 3SNHA 1BAKA 2P0HA 2DKPA 2HTHB 1XR0B 2Z0QA 1MIXA 2H7EA 1EF1A 3ULBA 1XCGA 1I7AA 1TXDA 2RNRB 5DH9B 4EKUA 3ULCA 1ZM0A 4GMVA 5D3YA 4HAXB 1FOEA 1XD4A 4A5KA 1W1DA 2L1CA 1DDMA 1P5TA 1I2HA 1BTNA 4DX90 1FGYA 1K5GB 2D4QA 3O96A 2J0MA 1XODA 4L6EA 1WGQA 3GYOA 1RRPB 2YSZA 3OANA 2HE7A 2D9WA 3PVWA 3D8DA 5L81A 3KRXA 1H4RA 1X11A 4CYEA 4WVFB 2BCJA 1GC7A 5HE3A 1MKEA 1WI1A 3FEHA 4F7HA 4YL8A 1QQGA 5LOPB 2P8VA 5EFXA 2L2IA 4TKNA 1OQNA 3QWMA 3TW1A 1X1GA 2RSGA 4KVGB 5C5BA 5JP4A 2K2JA 2DLWA 3U7DA 3TVVA 3TFMA 2D9XA 2D9VA 3VIAA 2Y8GA 5DI9B 3GYPA 2KUPA 2OTXA 1LW3A 4GXBA 1TQZA 2IYBA 4MK0A 2M38A 4K2OA 3HK0A 4KHOA 4ZRJA 1AWEA 3A8PA 4HHVA 2MDXA 2OQBA 1Y19B 1MK7B 3ZDTA 2GCLA 3QIJA 3D8EA 2NZ8B 5DIFB 2DTCA 1PLSA 4PQ0A 2W2WA 2J0JA 5KQ1A 2UZSA 2GJYA 2J0KA 4NY0A 3G9WA 1EVHA 4P7IA 2D11A 1IRSA 1SGHA 5C5BB 2I1JA 2M14A 2KCJA 1UNRA 4GN1A 1XKEA 2YT1A 1UNPA 4YONA 3ML4A 4DXAB 2I5FA 2ROVA 2N23A 3RCPA 2EMSA 3FSSA 2MWNB 1SHCA 3HW2B 2X18A 1FB8A 2K2UA 2DFKA 3PEGA 5JHHA 3P7ZA 2D2QA 2FJLA 4Y94A 4DBBA 5CLQB 1M7EA 2GS0A 1U27A 2ELAA 1V89A 2LG1A 2YRYA 2KGXB 2AL6A 3F5RA 1NTVA 1X86A 2EJ8A 5J3QA 5KCVA 1ZSQA 1FHWA 2GCJA 5CLLB 1MK9B 4HB2B 2LULA 2LOZA 2J59M 3TCAA 4DX8A 1N3HA 1Y5OA 2COFA 4PNKA 4IAPA 1FAOA 4MY6A 2YVCA 1FHOA 1MIZB 1MAIA 1ZVRA 1DDVA 4ZRIA 4KHBB 4WSFA 3AU4A 4HAUB 5D27A 5DHAB 1DROA 4Z2NA 2ROZB 4K2PA 3PSCA 1WVHA 1X05A 5JLJB 4KHAA 2R09A 2W2XD 1U5FA 3DXCA 1X1FA 2YS1A 1FGZA 1PFJA 4HAVB 2DHKA 3KY9A 4K81A 3UZTA 4EJNA 4CHMA 1KZGA 4A6FA 1H10A 3DXEA 4HDQA 2NMBA 4C0AA 1U5GA 3WA0A 2QKMA 1QC6A 3PG7A 2COAA 5JHGA 1UPQA 4F7GA 1PMSA 2DA0A 1KI1B 1WGUA 1WJMA 2G35A 3AU5A 2D9YA 2CY4A 2DHJA 3T06A 3DXDA 3WYFB 5HE0A 2RUKB 2Y8FA 4D0NB 1V5MA 1V88A 2COCA 2UZRA 1WJ1A 2P0DA 3A8QA 3SYXA 1W1HA 2DN6A 2I1KA 2ELBA 3A98B 4K17A 3SV1A 1J19A 1OMWA 2RGNB 4GPTB 4Z2MB 4A6HA 3M1IB 2D10A 3MDBC 5HE2A 2JP2A 5C6RA 4GZUA 5D3XA 2YS5A 1XX0A 3ZVRA 2RLOA 3CIKA 2D9ZA 3VOQA 2RVBB 1LB1A 3F0WA 4A6FB 1V5UA 2EMTA 2P0FA 4B6HA 1U5DA 5J3YA 3BJIA 2Y7BA 1U29A 2ZPYA 4HB0B 2AEHA 1BTKA 2LYDA 4KAXB 1W1GA 5GOWB 3PVLA 2H7DA 2VRWB 5LONB 3SUZA 2PZ1A 2LKOA 1EGXA 1TJ6A 2YF0A 1Z87A 2CAYA 4BBKA 2YS3A 2EC1A 1ISNA 1V61A 2XQNM 3QBVB 1RJ2A 2CODA 3NSUA 4F7UP 1J0WA 3BINA 2MFQA 5KQ4A 3IVFA 3ODXA 5D3VA 1M7RA 5J3TA 1MPHA 5HE1A 2Z0OA 1AQCA 1OY2A 2DKQA 1UNQA 4IOYX 3V5WA 4CHJA 1NI2A 2LOXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4TYZ A;  5DHF B;  2CRF A;  3X23 A;  4H8S A;  1V5P A;  2MKR A;  2DHI A;  4HB4 B;  3PVU A;  4EMO A;  1Q67 A;  2DYQ A;  3KSY A;  1B55 A;  2DX1 A;  4GMX B;  1GG3 A;  2CY5 A;  3ODO A;  2QKL A;  3AJ4 A;  5D3W A;  1ZC3 B;  2Q13 A;  1P6S A;  1P3R A;  2VKI A;  4NSW A;  2V76 A;  3CXB B;  1NU2 A;  4HDO A;  3MPX A;  1U5E A;  2W2X C;  1EAZ A;  3HQC A;  3U8Z A;  2UVM A;  1DYN A;  3KRW A;  5C16 A;  1UEF A;  4MT7 A;  5FI0 A;  1ZC4 B;  2VSZ A;  1UPR A;  3PP2 A;  1K5D B;  4HAW B;  2DYN A;  4HAT B;  3SO6 A;  1DDW A;  2R0D A;  5C79 A;  3KZ1 A;  3LJU X;  4XWX A;  1FHX A;  3D8F A;  4A6K A;  1E5W A;  3P6A A;  2K00 A;  3ODW A;  1WG7 A;  2ADZ A;  3N7C A;  1DBH A;  1KZ7 A;  2N0Y A;  2YT0 A;  4HB3 B;  1NTY A;  2E2X A;  2Z0P A;  5FI1 A;  1U2B A;  4HAY B;  4WJ7 A;  3TO1 A;  4IFS A;  4ZRK A;  2IFS A;  2DX5 A;  3PZD A;  1BWN A;  1GC6 A;  4HAZ B;  3FM8 C;  2I5C A;  3SNH A;  1BAK A;  2P0H A;  2DKP A;  2HTH B;  1XR0 B;  2Z0Q A;  1MIX A;  2H7E A;  1EF1 A;  3ULB A;  1XCG A;  1I7A A;  1TXD A;  2RNR B;  5DH9 B;  4EKU A;  3ULC A;  1ZM0 A;  4GMV A;  5D3Y A;  4HAX B;  1FOE A;  1XD4 A;  4A5K A;  1W1D A;  2L1C A;  1DDM A;  1P5T A;  1I2H A;  1BTN A;  4DX9 0;  1FGY A;  1K5G B;  2D4Q A;  3O96 A;  2J0M A;  1XOD A;  4L6E A;  1WGQ A;  3GYO A;  1RRP B;  2YSZ A;  3OAN A;  2HE7 A;  2D9W A;  3PVW A;  3D8D A;  5L81 A;  3KRX A;  1H4R A;  1X11 A;  4CYE A;  4WVF B;  2BCJ A;  1GC7 A;  5HE3 A;  1MKE A;  1WI1 A;  3FEH A;  4F7H A;  4YL8 A;  1QQG A;  5LOP B;  2P8V A;  5EFX A;  2L2I A;  4TKN A;  1OQN A;  3QWM A;  3TW1 A;  1X1G A;  2RSG A;  4KVG B;  5C5B A;  5JP4 A;  2K2J A;  2DLW A;  3U7D A;  3TVV A;  3TFM A;  2D9X A;  2D9V A;  3VIA A;  2Y8G A;  5DI9 B;  3GYP A;  2KUP A;  2OTX A;  1LW3 A;  4GXB A;  1TQZ A;  2IYB A;  4MK0 A;  2M38 A;  4K2O A;  3HK0 A;  4KHO A;  4ZRJ A;  1AWE A;  3A8P A;  4HHV A;  2MDX A;  2OQB A;  1Y19 B;  1MK7 B;  3ZDT A;  2GCL A;  3QIJ A;  3D8E A;  2NZ8 B;  5DIF B;  2DTC A;  1PLS A;  4PQ0 A;  2W2W A;  2J0J A;  5KQ1 A;  2UZS A;  2GJY A;  2J0K A;  4NY0 A;  3G9W A;  1EVH A;  4P7I A;  2D11 A;  1IRS A;  1SGH A;  5C5B B;  2I1J A;  2M14 A;  2KCJ A;  1UNR A;  4GN1 A;  1XKE A;  2YT1 A;  1UNP A;  4YON A;  3ML4 A;  4DXA B;  2I5F A;  2ROV A;  2N23 A;  3RCP A;  2EMS A;  3FSS A;  2MWN B;  1SHC A;  3HW2 B;  2X18 A;  1FB8 A;  2K2U A;  2DFK A;  3PEG A;  5JHH A;  3P7Z A;  2D2Q A;  2FJL A;  4Y94 A;  4DBB A;  5CLQ B;  1M7E A;  2GS0 A;  1U27 A;  2ELA A;  1V89 A;  2LG1 A;  2YRY A;  2KGX B;  2AL6 A;  3F5R A;  1NTV A;  1X86 A;  2EJ8 A;  5J3Q A;  5KCV A;  1ZSQ A;  1FHW A;  2GCJ A;  5CLL B;  1MK9 B;  4HB2 B;  2LUL A;  2LOZ A;  2J59 M;  3TCA A;  4DX8 A;  1N3H A;  1Y5O A;  2COF A;  4PNK A;  4IAP A;  1FAO A;  4MY6 A;  2YVC A;  1FHO A;  1MIZ B;  1MAI A;  1ZVR A;  1DDV A;  4ZRI A;  4KHB B;  4WSF A;  3AU4 A;  4HAU B;  5D27 A;  5DHA B;  1DRO A;  4Z2N A;  2ROZ B;  4K2P A;  3PSC A;  1WVH A;  1X05 A;  5JLJ B;  4KHA A;  2R09 A;  2W2X D;  1U5F A;  3DXC A;  1X1F A;  2YS1 A;  1FGZ A;  1PFJ A;  4HAV B;  2DHK A;  3KY9 A;  4K81 A;  3UZT A;  4EJN A;  4CHM A;  1KZG A;  4A6F A;  1H10 A;  3DXE A;  4HDQ A;  2NMB A;  4C0A A;  1U5G A;  3WA0 A;  2QKM A;  1QC6 A;  3PG7 A;  2COA A;  5JHG A;  1UPQ A;  4F7G A;  1PMS A;  2DA0 A;  1KI1 B;  1WGU A;  1WJM A;  2G35 A;  3AU5 A;  2D9Y A;  2CY4 A;  2DHJ A;  3T06 A;  3DXD A;  3WYF B;  5HE0 A;  2RUK B;  2Y8F A;  4D0N B;  1V5M A;  1V88 A;  2COC A;  2UZR A;  1WJ1 A;  2P0D A;  3A8Q A;  3SYX A;  1W1H A;  2DN6 A;  2I1K A;  2ELB A;  3A98 B;  4K17 A;  3SV1 A;  1J19 A;  1OMW A;  2RGN B;  4GPT B;  4Z2M B;  4A6H A;  3M1I B;  2D10 A;  3MDB C;  5HE2 A;  2JP2 A;  5C6R A;  4GZU A;  5D3X A;  2YS5 A;  1XX0 A;  3ZVR A;  2RLO A;  3CIK A;  2D9Z A;  3VOQ A;  2RVB B;  1LB1 A;  3F0W A;  4A6F B;  1V5U A;  2EMT A;  2P0F A;  4B6H A;  1U5D A;  5J3Y A;  3BJI A;  2Y7B A;  1U29 A;  2ZPY A;  4HB0 B;  2AEH A;  1BTK A;  2LYD A;  4KAX B;  1W1G A;  5GOW B;  3PVL A;  2H7D A;  2VRW B;  5LON B;  3SUZ A;  2PZ1 A;  2LKO A;  1EGX A;  1TJ6 A;  2YF0 A;  1Z87 A;  2CAY A;  4BBK A;  2YS3 A;  2EC1 A;  1ISN A;  1V61 A;  2XQN M;  3QBV B;  1RJ2 A;  2COD A;  3NSU A;  4F7U P;  1J0W A;  3BIN A;  2MFQ A;  5KQ4 A;  3IVF A;  3ODX A;  5D3V A;  1M7R A;  5J3T A;  1MPH A;  5HE1 A;  2Z0O A;  1AQC A;  1OY2 A;  2DKQ A;  1UNQ A;  4IOY X;  3V5W A;  4CHJ A;  1NI2 A;  2LOX A; 
#chains in the Genus database with same CATH topology
 4TYZ A;  5DHF B;  2CRF A;  3X23 A;  4H8S A;  1V5P A;  2MKR A;  2DHI A;  3DCX A;  4HB4 B;  3PVU A;  4EMO A;  1Q67 A;  2DYQ A;  3KSY A;  1B55 A;  2DX1 A;  2FJU B;  4GMX B;  1GG3 A;  2CY5 A;  3ODO A;  2QKL A;  3AJ4 A;  5D3W A;  1ZC3 B;  2Q13 A;  5M4Y B;  1P6S A;  1P3R A;  2VKI A;  4NSW A;  2V76 A;  3CXB B;  1NU2 A;  4HDO A;  3MPX A;  1U5E A;  2W2X C;  1EAZ A;  3HQC A;  3U8Z A;  2UVM A;  1DYN A;  3KRW A;  5C16 A;  1UEF A;  5I2M A;  2K8E A;  4MT7 A;  5FI0 A;  1ZC4 B;  2VSZ A;  1UPR A;  3PP2 A;  1K5D B;  4HAW B;  2DYN A;  4HAT B;  3SO6 A;  1DDW A;  2ZKM X;  2R0D A;  5C79 A;  3KZ1 A;  2KUQ A;  3LJU X;  4XWX A;  1FHX A;  3D8F A;  4A6K A;  1E5W A;  3P6A A;  2K00 A;  3ODW A;  1WG7 A;  2ADZ A;  3N7C A;  1DBH A;  1KZ7 A;  2N0Y A;  2YT0 A;  4HB3 B;  1NTY A;  2E2X A;  2Z0P A;  5FI1 A;  1U2B A;  4HAY B;  4WJ7 A;  3TO1 A;  4IFS A;  4ZRK A;  2IFS A;  2DX5 A;  3PZD A;  1BWN A;  1GC6 A;  4L1R A;  4HAZ B;  3FM8 C;  2I5C A;  3SNH A;  1BAK A;  2P0H A;  2DKP A;  2HTH B;  1XR0 B;  2Z0Q A;  1MIX A;  2H7E A;  1EF1 A;  4QXA B;  3ULB A;  1XCG A;  5I2S A;  1I7A A;  1TXD A;  2RNR B;  5DH9 B;  4EKU A;  3ULC A;  1ZM0 A;  4GMV A;  5D3Y A;  4HAX B;  1T77 A;  1FOE A;  1XD4 A;  4A5K A;  1W1D A;  2L1C A;  1DDM A;  1P5T A;  1I2H A;  4OT1 A;  1BTN A;  4DX9 0;  1FGY A;  1K5G B;  2D4Q A;  3A58 A;  3O96 A;  2J0M A;  1XOD A;  4L6E A;  1WGQ A;  3GYO A;  1RRP B;  2YSZ A;  3OAN A;  3B77 A;  2HE7 A;  2D9W A;  3PVW A;  3D8D A;  5L81 A;  2Z13 A;  3KRX A;  1H4R A;  1X11 A;  4CYE A;  4WVF B;  2BCJ A;  1GC7 A;  4QJ3 B;  5HE3 A;  1MKE A;  1WI1 A;  3FEH A;  4F7H A;  4YL8 A;  4HSI A;  1QQG A;  5LOP B;  2P8V A;  5EFX A;  2L2I A;  4TKN A;  1OQN A;  3QWM A;  3TW1 A;  1X1G A;  5LG4 B;  3NWA A;  3OHM B;  2RSG A;  4KVG B;  5C5B A;  5JP4 A;  2K2J A;  2DLW A;  3U7D A;  3TVV A;  3TFM A;  2D9X A;  2D9V A;  2KIE A;  3VIA A;  2Y8G A;  5DI9 B;  3GYP A;  2KUP A;  2OTX A;  1LW3 A;  4GXB A;  1TQZ A;  2IYB A;  4MK0 A;  2M38 A;  3NWF A;  4K2O A;  3HK0 A;  4KHO A;  4ZRJ A;  1AWE A;  3A8P A;  4HHV A;  2RRF A;  2MDX A;  2OQB A;  3FVC A;  1Y19 B;  1MK7 B;  3ZDT A;  2GCL A;  3QIJ A;  3D8E A;  2NZ8 B;  5DIF B;  2DTC A;  1PLS A;  4PQ0 A;  2W2W A;  2J0J A;  5KQ1 A;  2UZS A;  2GJY A;  2J0K A;  4NY0 A;  3G9W A;  1EVH A;  4CSQ A;  4KHB A;  4P7I A;  2D11 A;  1IRS A;  1SGH A;  5C5B B;  2I1J A;  2M14 A;  2KCJ A;  1UNR A;  4GN1 A;  1XKE A;  2YT1 A;  1UNP A;  4YON A;  3ML4 A;  4DXA B;  2I5F A;  2ROV A;  2N23 A;  3RCP A;  2EMS A;  3FSS A;  2MWN B;  1SHC A;  3HW2 B;  2X18 A;  1FB8 A;  2K2U A;  2DFK A;  3PEG A;  5JHH A;  3U12 A;  3P7Z A;  2D2Q A;  2FJL A;  4OSN A;  4Y94 A;  4DBB A;  5CLQ B;  1M7E A;  2GS0 A;  3HIE A;  1U27 A;  2ELA A;  1V89 A;  2LG1 A;  2YRY A;  2KGX B;  2AL6 A;  3F5R A;  1NTV A;  1X86 A;  2EJ8 A;  5J3Q A;  5KCV A;  1ZSQ A;  1FHW A;  4DIX A;  2GCJ A;  5CLL B;  1MK9 B;  4HB2 B;  2LUL A;  2LOZ A;  2J59 M;  3TCA A;  4DX8 A;  1N3H A;  1Y5O A;  2COF A;  4PNK A;  4IAP A;  1FAO A;  4MY6 A;  2YVC A;  1FHO A;  1MIZ B;  1MAI A;  2K49 A;  1ZVR A;  4D6W A;  1DDV A;  4GOU A;  4ZRI A;  4KHB B;  4WSF A;  3AU4 A;  4HAU B;  5D27 A;  2KR0 A;  5DHA B;  1DRO A;  4Z2N A;  2ROZ B;  4K2P A;  3PSC A;  1WVH A;  1X05 A;  5JLJ B;  4KHA A;  2R09 A;  2W2X D;  1U5F A;  3HSA A;  3DXC A;  1X1F A;  2YS1 A;  1FGZ A;  1PFJ A;  4HAV B;  2DHK A;  3KY9 A;  4K81 A;  3UZT A;  2GUM A;  4EJN A;  4CHM A;  1KZG A;  4A6F A;  1H10 A;  3DXE A;  4HDQ A;  2NMB A;  3NW8 A;  4C0A A;  1U5G A;  3WA0 A;  2QKM A;  1QC6 A;  4QJ5 B;  3PG7 A;  2COA A;  5JHG A;  1UPQ A;  4F7G A;  1PMS A;  2DA0 A;  1KI1 B;  4GNK B;  1WGU A;  1WJM A;  2G35 A;  3AU5 A;  5IRS A;  2D9Y A;  2CY4 A;  2DHJ A;  3T06 A;  3DXD A;  3WYF B;  4QJ4 B;  5HE0 A;  2RUK B;  2Y8F A;  4D0N B;  1V5M A;  1V88 A;  2COC A;  2UZR A;  1WJ1 A;  2P0D A;  3A8Q A;  3SYX A;  1W1H A;  2DN6 A;  2I1K A;  2ELB A;  3A98 B;  3NWD A;  4K17 A;  3SV1 A;  1J19 A;  1OMW A;  2NBV A;  2RGN B;  4GPT B;  4Z2M B;  3M1I B;  4A6H A;  2D10 A;  3MDB C;  5HE2 A;  2JP2 A;  5C6R A;  4GZU A;  5D3X A;  2YS5 A;  1XX0 A;  3ZVR A;  2RLO A;  3CIK A;  2Z4D A;  2D9Z A;  3VOQ A;  2RVB B;  1LB1 A;  3F0W A;  4A6F B;  1V5U A;  2EMT A;  2P0F A;  4B6H A;  1U5D A;  5J3Y A;  3BJI A;  2Z59 A;  2Y7B A;  1U29 A;  2KIG A;  2Z14 A;  2ZPY A;  4HB0 B;  2AEH A;  1BTK A;  2LYD A;  4KAX B;  1W1G A;  5GOW B;  3PVL A;  2H7D A;  1ZYI A;  2VRW B;  5LON B;  3SUZ A;  2PZ1 A;  2LKO A;  1EGX A;  1TJ6 A;  2YF0 A;  1Z87 A;  2CAY A;  2R2Y A;  4BBK A;  2YT2 A;  2YS3 A;  2EC1 A;  1ISN A;  1V61 A;  2XQN M;  3QBV B;  1RJ2 A;  2COD A;  1MI1 A;  3NSU A;  4F7U P;  1J0W A;  3BIN A;  2MFQ A;  5KQ4 A;  3IVF A;  3ODX A;  5D3V A;  1M7R A;  5J3T A;  1MPH A;  5HE1 A;  2Z0O A;  1AQC A;  1OY2 A;  2DKQ A;  1UNQ A;  4IOY X;  3V5W A;  4CHJ A;  1NI2 A;  2LOX A; 
#chains in the Genus database with same CATH homology
 4TYZ A;  5DHF B;  2CRF A;  3X23 A;  4H8S A;  1V5P A;  2MKR A;  2DHI A;  4HB4 B;  3PVU A;  4EMO A;  1Q67 A;  2DYQ A;  3KSY A;  1B55 A;  2DX1 A;  4GMX B;  1GG3 A;  2CY5 A;  3ODO A;  2QKL A;  3AJ4 A;  5D3W A;  1ZC3 B;  2Q13 A;  1P6S A;  1P3R A;  2VKI A;  4NSW A;  2V76 A;  3CXB B;  1NU2 A;  4HDO A;  3MPX A;  1U5E A;  2W2X C;  1EAZ A;  3HQC A;  3U8Z A;  2UVM A;  1DYN A;  3KRW A;  5C16 A;  1UEF A;  4MT7 A;  5FI0 A;  1ZC4 B;  2VSZ A;  1UPR A;  3PP2 A;  1K5D B;  4HAW B;  2DYN A;  4HAT B;  3SO6 A;  1DDW A;  2R0D A;  5C79 A;  3KZ1 A;  3LJU X;  4XWX A;  1FHX A;  3D8F A;  4A6K A;  1E5W A;  3P6A A;  2K00 A;  3ODW A;  1WG7 A;  2ADZ A;  3N7C A;  1DBH A;  1KZ7 A;  2N0Y A;  2YT0 A;  4HB3 B;  1NTY A;  2E2X A;  2Z0P A;  5FI1 A;  1U2B A;  4HAY B;  4WJ7 A;  3TO1 A;  4IFS A;  4ZRK A;  2IFS A;  2DX5 A;  3PZD A;  1BWN A;  1GC6 A;  4HAZ B;  3FM8 C;  2I5C A;  3SNH A;  1BAK A;  2P0H A;  2DKP A;  2HTH B;  1XR0 B;  2Z0Q A;  1MIX A;  2H7E A;  1EF1 A;  3ULB A;  1XCG A;  1I7A A;  1TXD A;  2RNR B;  5DH9 B;  4EKU A;  3ULC A;  1ZM0 A;  4GMV A;  5D3Y A;  4HAX B;  1FOE A;  1XD4 A;  4A5K A;  1W1D A;  2L1C A;  1DDM A;  1P5T A;  1I2H A;  1BTN A;  4DX9 0;  1FGY A;  1K5G B;  2D4Q A;  3O96 A;  2J0M A;  1XOD A;  4L6E A;  1WGQ A;  3GYO A;  1RRP B;  2YSZ A;  3OAN A;  2HE7 A;  2D9W A;  3PVW A;  3D8D A;  5L81 A;  3KRX A;  1H4R A;  1X11 A;  4CYE A;  4WVF B;  2BCJ A;  1GC7 A;  5HE3 A;  1MKE A;  1WI1 A;  3FEH A;  4F7H A;  4YL8 A;  1QQG A;  5LOP B;  2P8V A;  5EFX A;  2L2I A;  4TKN A;  1OQN A;  3QWM A;  3TW1 A;  1X1G A;  2RSG A;  4KVG B;  5C5B A;  5JP4 A;  2K2J A;  2DLW A;  3U7D A;  3TVV A;  3TFM A;  2D9X A;  2D9V A;  3VIA A;  2Y8G A;  5DI9 B;  3GYP A;  2KUP A;  2OTX A;  1LW3 A;  4GXB A;  1TQZ A;  2IYB A;  4MK0 A;  2M38 A;  4K2O A;  3HK0 A;  4KHO A;  4ZRJ A;  1AWE A;  3A8P A;  4HHV A;  2MDX A;  2OQB A;  1Y19 B;  1MK7 B;  3ZDT A;  2GCL A;  3QIJ A;  3D8E A;  2NZ8 B;  5DIF B;  2DTC A;  1PLS A;  4PQ0 A;  2W2W A;  2J0J A;  5KQ1 A;  2UZS A;  2GJY A;  2J0K A;  4NY0 A;  3G9W A;  1EVH A;  4P7I A;  2D11 A;  1IRS A;  1SGH A;  5C5B B;  2I1J A;  2M14 A;  2KCJ A;  1UNR A;  4GN1 A;  1XKE A;  2YT1 A;  1UNP A;  4YON A;  3ML4 A;  4DXA B;  2I5F A;  2ROV A;  2N23 A;  3RCP A;  2EMS A;  3FSS A;  2MWN B;  1SHC A;  3HW2 B;  2X18 A;  1FB8 A;  2K2U A;  2DFK A;  3PEG A;  5JHH A;  3P7Z A;  2D2Q A;  2FJL A;  4Y94 A;  4DBB A;  5CLQ B;  1M7E A;  2GS0 A;  1U27 A;  2ELA A;  1V89 A;  2LG1 A;  2YRY A;  2KGX B;  2AL6 A;  3F5R A;  1NTV A;  1X86 A;  2EJ8 A;  5J3Q A;  5KCV A;  1ZSQ A;  1FHW A;  2GCJ A;  5CLL B;  1MK9 B;  4HB2 B;  2LUL A;  2LOZ A;  2J59 M;  3TCA A;  4DX8 A;  1N3H A;  1Y5O A;  2COF A;  4PNK A;  4IAP A;  1FAO A;  4MY6 A;  2YVC A;  1FHO A;  1MIZ B;  1MAI A;  1ZVR A;  1DDV A;  4ZRI A;  4KHB B;  4WSF A;  3AU4 A;  4HAU B;  5D27 A;  5DHA B;  1DRO A;  4Z2N A;  2ROZ B;  4K2P A;  3PSC A;  1WVH A;  1X05 A;  5JLJ B;  4KHA A;  2R09 A;  2W2X D;  1U5F A;  3DXC A;  1X1F A;  2YS1 A;  1FGZ A;  1PFJ A;  4HAV B;  2DHK A;  3KY9 A;  4K81 A;  3UZT A;  4EJN A;  4CHM A;  1KZG A;  4A6F A;  1H10 A;  3DXE A;  4HDQ A;  2NMB A;  4C0A A;  1U5G A;  3WA0 A;  2QKM A;  1QC6 A;  3PG7 A;  2COA A;  5JHG A;  1UPQ A;  4F7G A;  1PMS A;  2DA0 A;  1KI1 B;  1WGU A;  1WJM A;  2G35 A;  3AU5 A;  2D9Y A;  2CY4 A;  2DHJ A;  3T06 A;  3DXD A;  3WYF B;  5HE0 A;  2RUK B;  2Y8F A;  4D0N B;  1V5M A;  1V88 A;  2COC A;  2UZR A;  1WJ1 A;  2P0D A;  3A8Q A;  3SYX A;  1W1H A;  2DN6 A;  2I1K A;  2ELB A;  3A98 B;  4K17 A;  3SV1 A;  1J19 A;  1OMW A;  2RGN B;  4GPT B;  4Z2M B;  4A6H A;  3M1I B;  2D10 A;  3MDB C;  5HE2 A;  2JP2 A;  5C6R A;  4GZU A;  5D3X A;  2YS5 A;  1XX0 A;  3ZVR A;  2RLO A;  3CIK A;  2D9Z A;  3VOQ A;  2RVB B;  1LB1 A;  3F0W A;  4A6F B;  1V5U A;  2EMT A;  2P0F A;  4B6H A;  1U5D A;  5J3Y A;  3BJI A;  2Y7B A;  1U29 A;  2ZPY A;  4HB0 B;  2AEH A;  1BTK A;  2LYD A;  4KAX B;  1W1G A;  5GOW B;  3PVL A;  2H7D A;  2VRW B;  5LON B;  3SUZ A;  2PZ1 A;  2LKO A;  1EGX A;  1TJ6 A;  2YF0 A;  1Z87 A;  2CAY A;  4BBK A;  2YS3 A;  2EC1 A;  1ISN A;  1V61 A;  2XQN M;  3QBV B;  1RJ2 A;  2COD A;  3NSU A;  4F7U P;  1J0W A;  3BIN A;  2MFQ A;  5KQ4 A;  3IVF A;  3ODX A;  5D3V A;  1M7R A;  5J3T A;  1MPH A;  5HE1 A;  2Z0O A;  1AQC A;  1OY2 A;  2DKQ A;  1UNQ A;  4IOY X;  3V5W A;  4CHJ A;  1NI2 A;  2LOX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...