1V89A

Solution structure of the pleckstrin homology domain of human kiaa0053 protein
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
118
structure length
118
Chain Sequence
GSSGSSGPIKMGWLKKQRSIVKNWQQRYFVLRAQQLYYYKDEEDTKPQGCMYLPGCTIKEIATNPEEAGKFVFEIIPASWDQNRMGQDSYVLMASSQAEMEEWVKFLRRVAGSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Hypothetical protein KIAA0053
publication title Solution Structure of the Pleckstrin Homology Domain of Human KIAA0053 Protein
rcsb
source organism Homo sapiens
total genus 13
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2003-12-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1v89A00
2EC1A 1PFJA 2M14A 1U5EA 2GCLA 3FEHA 1MKEA 3T06A 2AEHA 3KY9A 4KVGB 3DXCA 3WA0A 3HW2B 1XKEA 2EMSA 2MWNB 1V88A 1WGQA 3PVWA 2JP2A 4HB2B 1U27A 5J3QA 4DBBA 3ODOA 4Z2MB 2RLOA 1Z87A 4EMOA 4KAXB 3WYFB 5FI1A 3BINA 3CIKA 2LOZA 2J0MA 1UEFA 3HK0A 3PEGA 1WG7A 2YRYA 4IAPA 4YONA 2QKLA 5JHGA 5L81A 3U7DA 1UPRA 2D9VA 4K81A 2LYDA 1W1HA 1ZVRA 2IFSA 2COCA 2D9XA 4DX90 2K2UA 1QQGA 3KRXA 4WVFB 3NSUA 2LKOA 3VOQA 3AJ4A 1ZC3B 2CRFA 4XWXA 1BWNA 3PG7A 3P6AA 4H8SA 2CODA 2L1CA 4CHJA 4WJ7A 2K2JA 3PVUA 1K5DB 1N3HA 5C79A 3TW1A 2PZ1A 2DKQA 4A5KA 5HE0A 1WJ1A 1UNPA 1FHWA 2MDXA 2VKIA 1NU2A 1I7AA 1SGHA 3PSCA 4HATB 4A6HA 1FOEA 1SHCA 3ML4A 4BBKA 1RJ2A 3AU4A 3UZTA 3ULCA 1B55A 2DX5A 2NZ8B 1LB1A 2DX1A 1GC6A 3OANA 3QIJA 2RNRB 5HE1A 3X23A 1MIZB 1P5TA 4HAZB 2GCJA 3IVFA 1AWEA 2R0DA 2DHIA 2OQBA 2LULA 3MPXA 5C5BB 4K17A 2AL6A 1U5FA 2HTHB 3QWMA 1X1FA 1TXDA 1V5MA 2DFKA 2M38A 1XX0A 1TJ6A 1UNRA 2YVCA 5D3WA 1FGYA 1W1DA 2RVBB 4NSWA 4YL8A 2N0YA 4KHBB 2FJLA 4A6FA 1GC7A 5JP4A 1ISNA 2DHKA 4HAVB 4IFSA 1EVHA 5CLQB 4GZUA 3U8ZA 2HE7A 2ROZB 1FAOA 1I2HA 4DX8A 2UZRA 1KI1B 1NI2A 1U5DA 3F5RA 4GN1A 4KHAA 3DXEA 5LOPB 2UVMA 2DA0A 3CXBB 4HHVA 1J19A 4Y94A 3TO1A 4HB4B 2Y8FA 2H7DA 2MKRA 4A6FB 2IYBA 1XD4A 4HAXB 2LG1A 2YS3A 2K00A 2W2WA 2G35A 1FGZA 2COFA 1V89A 1MK7B 4MY6A 5CLLB 2EMTA 4IOYX 2DN6A 1XR0B 1U5GA 4HAUB 2ROVA 2DHJA 1V5UA 3M1IB 2ADZA 2EJ8A 3PVLA 4ZRJA 2YT1A 4EKUA 2D4QA 3KRWA 1ZC4B 4HB3B 2RGNB 3GYOA 1MAIA 3SV1A 2ELAA 5D3VA 1V5PA 1OY2A 4K2OA 1PMSA 3A98B 4TYZA 1XCGA 3LJUX 1BTNA 1FB8A 2I5FA 3TCAA 1DDWA 4ZRIA 1Y5OA 5DI9B 3TVVA 2R09A 1IRSA 3RCPA 3ZDTA 2KUPA 2E2XA 5C5BA 2DTCA 2W2XC 2DKPA 3ODXA 2QKMA 4GMVA 4Z2NA 1DDVA 4NY0A 2NMBA 5C6RA 1J0WA 4HDQA 2YS1A 4HB0B 4A6KA 4P7IA 2DYQA 1X05A 2BCJA 3ULBA 1KZ7A 1H10A 2DLWA 5J3TA 1TQZA 3QBVB 3D8DA 1DDMA 2J59M 1LW3A 5DHAB 1EGXA 4C0AA 1V61A 1WVHA 4B6HA 2P0FA 2KCJA 5D27A 1EAZA 2P8VA 1H4RA 1BAKA 2X18A 2Z0QA 2CY4A 3SO6A 3KZ1A 2XQNM 2D9YA 1RRPB 5HE2A 1P3RA 2UZSA 1U2BA 2I5CA 3A8PA 4CHMA 1OQNA 5GOWB 1ZM0A 4D0NB 4HAYB 4F7GA 4F7UP 4EJNA 2VSZA 1X1GA 2L2IA 1MPHA 1W1GA 2GS0A 2Q13A 2YF0A 2CY5A 2Y7BA 3FSSA 5HE3A 2P0HA 4CYEA 2COAA 1E5WA 1X86A 5FI0A 1DROA 3ZVRA 4TKNA 3D8EA 4PQ0A 3N7CA 2OTXA 3PZDA 2LOXA 4WSFA 1WGUA 2KGXB 1Q67A 3P7ZA 2D10A 3SYXA 3V5WA 1FHOA 3FM8C 2GJYA 1KZGA 5KQ4A 2V76A 2YS5A 3G9WA 5KCVA 4L6EA 1AQCA 2H7EA 4F7HA 5D3YA 4GXBA 4MK0A 2ELBA 3F0WA 1EF1A 4GPTB 3TFMA 4HAWB 1P6SA 2RUKB 3ODWA 2Y8GA 1ZSQA 2ZPYA 2I1JA 4GMXB 5LONB 3AU5A 3BJIA 1NTVA 1WJMA 2Z0OA 1DBHA 5DH9B 5C16A 5D3XA 3HQCA 1PLSA 5J3YA 2DYNA 2D11A 3KSYA 3O96A 4PNKA 5JLJB 2I1KA 2D9ZA 5JHHA 4KHOA 1MK9B 3DXDA 2W2XD 1K5GB 4K2PA 1NTYA 2VRWB 5DIFB 3VIAA 1X11A 2YSZA 1OMWA 3SNHA 2N23A 4ZRKA 1XODA 5DHFB 1UNQA 1MIXA 5KQ1A 2D2QA 1U29A 1Y19B 1DYNA 3GYPA 2J0JA 1QC6A 1WI1A 2RSGA 1M7EA 2D9WA 4DXAB 2J0KA 4HDOA 4MT7A 3SUZA 1BTKA 1UPQA 3A8QA 1M7RA 2MFQA 3PP2A 3MDBC 5EFXA 2CAYA 2P0DA 3D8FA 1FHXA 2YT0A 2Z0PA 1GG3A
chains in the Genus database with same CATH superfamily
2EC1A 1PFJA 2M14A 1U5EA 2GCLA 3FEHA 1MKEA 3T06A 2AEHA 3KY9A 1T77A 4KVGB 3DXCA 3WA0A 3HW2B 1XKEA 2EMSA 2MWNB 1V88A 1WGQA 3PVWA 2JP2A 4HB2B 1U27A 5J3QA 4DBBA 3ODOA 4Z2MB 2RLOA 1Z87A 4EMOA 4KAXB 3WYFB 5FI1A 3BINA 3CIKA 2LOZA 2J0MA 1UEFA 2Z59A 3HK0A 3PEGA 1WG7A 2YRYA 4IAPA 4YONA 2QKLA 5JHGA 5L81A 3U7DA 1UPRA 2D9VA 4K81A 2LYDA 1W1HA 1ZVRA 2IFSA 2COCA 2D9XA 4DX90 2K2UA 1QQGA 3KRXA 4WVFB 3NSUA 2LKOA 3VOQA 3AJ4A 2K49A 3HIEA 1ZC3B 2CRFA 4XWXA 1BWNA 3PG7A 3P6AA 4H8SA 2CODA 1ZYIA 2L1CA 4CHJA 4WJ7A 2K2JA 3PVUA 1K5DB 1N3HA 5C79A 3TW1A 2PZ1A 2DKQA 2KIGA 4A5KA 5HE0A 1WJ1A 1UNPA 1FHWA 2MDXA 3NWFA 2VKIA 1NU2A 1I7AA 1SGHA 3PSCA 4HATB 4A6HA 1FOEA 3U12A 1SHCA 3ML4A 4BBKA 1RJ2A 3AU4A 3UZTA 2K8EA 3ULCA 1B55A 2DX5A 2NZ8B 2NBVA 1LB1A 2DX1A 1GC6A 3OANA 3QIJA 2RNRB 5HE1A 3X23A 1MIZB 1P5TA 4HAZB 2YT2A 2GCJA 3IVFA 1AWEA 2R0DA 2DHIA 2OQBA 2LULA 3MPXA 5C5BB 3B77A 4K17A 2AL6A 1U5FA 2HTHB 3QWMA 1X1FA 1TXDA 1V5MA 2DFKA 2FJUB 2M38A 3DCXA 1XX0A 3NWDA 1TJ6A 1UNRA 2YVCA 5D3WA 1FGYA 1W1DA 2RVBB 4NSWA 4YL8A 2N0YA 4GNKB 4KHBB 2FJLA 4A6FA 1GC7A 5JP4A 1ISNA 2DHKA 4HAVB 4IFSA 1EVHA 5CLQB 4GZUA 3U8ZA 3HSAA 2RRFA 2HE7A 2ROZB 1FAOA 3A58A 1I2HA 4DX8A 5IRSA 2UZRA 1KI1B 1NI2A 1U5DA 3F5RA 4GN1A 4KHAA 3DXEA 5LOPB 2UVMA 2DA0A 3CXBB 4OT1A 4HHVA 1J19A 4Y94A 3TO1A 4HB4B 2Y8FA 2H7DA 2MKRA 4A6FB 2IYBA 1XD4A 4HAXB 4QJ3B 2LG1A 2YS3A 2K00A 2W2WA 2G35A 1FGZA 2COFA 1V89A 1MK7B 4MY6A 5CLLB 2EMTA 4IOYX 2DN6A 1XR0B 1U5GA 4HAUB 2ROVA 2DHJA 1V5UA 3M1IB 2ADZA 2EJ8A 3PVLA 4ZRJA 2YT1A 4EKUA 2D4QA 3KRWA 1ZC4B 4HB3B 2RGNB 3GYOA 1MAIA 3SV1A 4CSQA 2ELAA 4QXAB 3NW8A 2GUMA 5D3VA 1V5PA 1OY2A 4K2OA 1PMSA 3A98B 4TYZA 1XCGA 1BTNA 3LJUX 1FB8A 2I5FA 3TCAA 1DDWA 4ZRIA 1Y5OA 5DI9B 3TVVA 2R09A 1IRSA 3RCPA 3ZDTA 2Z13A 2KUPA 2E2XA 5C5BA 2DTCA 2W2XC 2DKPA 3ODXA 2QKMA 4GMVA 4Z2NA 1DDVA 4NY0A 2NMBA 5C6RA 1J0WA 4L1RA 4HDQA 2YS1A 4HB0B 4A6KA 4P7IA 2DYQA 1X05A 2BCJA 4KHBA 3ULBA 1KZ7A 1H10A 2DLWA 5J3TA 1TQZA 3QBVB 3D8DA 1DDMA 2J59M 1LW3A 5DHAB 1EGXA 4C0AA 1V61A 1WVHA 4B6HA 2P0FA 2KCJA 5D27A 1EAZA 3NWAA 2P8VA 1H4RA 4OSNA 1BAKA 2X18A 2Z0QA 2CY4A 3SO6A 3KZ1A 2XQNM 2D9YA 1RRPB 4GOUA 5HE2A 1P3RA 2UZSA 1U2BA 2I5CA 3A8PA 4CHMA 1OQNA 5GOWB 1ZM0A 4D0NB 4HAYB 4F7GA 4F7UP 2Z14A 4EJNA 2VSZA 1X1GA 2L2IA 1MPHA 1W1GA 2GS0A 2Q13A 2YF0A 2CY5A 2Y7BA 3FSSA 2KIEA 5HE3A 2P0HA 1MI1A 4CYEA 2COAA 1E5WA 1X86A 5FI0A 1DROA 3ZVRA 4TKNA 3D8EA 4PQ0A 3N7CA 2OTXA 3PZDA 2LOXA 4WSFA 1WGUA 2KGXB 1Q67A 3P7ZA 2D10A 3SYXA 3V5WA 1FHOA 3FM8C 2GJYA 1KZGA 5KQ4A 2V76A 2YS5A 3G9WA 5M4YB 5KCVA 4L6EA 1AQCA 2H7EA 4F7HA 5D3YA 4GXBA 4MK0A 2ELBA 3F0WA 1EF1A 4GPTB 3TFMA 4HAWB 1P6SA 2RUKB 3ODWA 2Y8GA 1ZSQA 2ZPYA 2ZKMX 4QJ5B 2I1JA 4GMXB 5LONB 3AU5A 3BJIA 1NTVA 1WJMA 2Z0OA 4HSIA 1DBHA 5DH9B 5C16A 4QJ4B 5D3XA 3HQCA 1PLSA 5J3YA 2DYNA 2D11A 3KSYA 3O96A 3OHMB 4PNKA 5JLJB 5I2MA 2I1KA 4DIXA 2D9ZA 5JHHA 4KHOA 1MK9B 2R2YA 3DXDA 2W2XD 1K5GB 2KR0A 4K2PA 1NTYA 2VRWB 5DIFB 3VIAA 1X11A 2YSZA 1OMWA 3SNHA 2KUQA 2N23A 4ZRKA 1XODA 5DHFB 1UNQA 1MIXA 5KQ1A 2D2QA 1U29A 1Y19B 1DYNA 3GYPA 2J0JA 1QC6A 1WI1A 2RSGA 1M7EA 2D9WA 4DXAB 2J0KA 2Z4DA 4HDOA 4MT7A 3SUZA 1BTKA 5I2SA 1UPQA 3FVCA 3A8QA 1M7RA 2MFQA 5LG4B 3PP2A 3MDBC 5EFXA 4D6WA 2CAYA 2P0DA 3D8FA 1FHXA 2YT0A 2Z0PA 1GG3A
chains in the Genus database with same CATH topology
2EC1A 1PFJA 2M14A 1U5EA 2GCLA 3FEHA 1MKEA 3T06A 2AEHA 3KY9A 4KVGB 3DXCA 3WA0A 3HW2B 1XKEA 2EMSA 2MWNB 1V88A 1WGQA 3PVWA 2JP2A 4HB2B 1U27A 5J3QA 4DBBA 3ODOA 4Z2MB 2RLOA 1Z87A 4EMOA 4KAXB 3WYFB 5FI1A 3BINA 3CIKA 2LOZA 2J0MA 1UEFA 3HK0A 3PEGA 1WG7A 2YRYA 4IAPA 4YONA 2QKLA 5JHGA 5L81A 3U7DA 1UPRA 2D9VA 4K81A 2LYDA 1W1HA 1ZVRA 2IFSA 2COCA 2D9XA 4DX90 2K2UA 1QQGA 3KRXA 4WVFB 3NSUA 2LKOA 3VOQA 3AJ4A 1ZC3B 2CRFA 4XWXA 1BWNA 3PG7A 3P6AA 4H8SA 2CODA 2L1CA 4CHJA 4WJ7A 2K2JA 3PVUA 1K5DB 1N3HA 5C79A 3TW1A 2PZ1A 2DKQA 4A5KA 5HE0A 1WJ1A 1UNPA 1FHWA 2MDXA 2VKIA 1NU2A 1I7AA 1SGHA 3PSCA 4HATB 4A6HA 1FOEA 1SHCA 3ML4A 4BBKA 1RJ2A 3AU4A 3UZTA 3ULCA 1B55A 2DX5A 2NZ8B 1LB1A 2DX1A 1GC6A 3OANA 3QIJA 2RNRB 5HE1A 3X23A 1MIZB 1P5TA 4HAZB 2GCJA 3IVFA 1AWEA 2R0DA 2DHIA 2OQBA 2LULA 3MPXA 5C5BB 4K17A 2AL6A 1U5FA 2HTHB 3QWMA 1X1FA 1TXDA 1V5MA 2DFKA 2M38A 1XX0A 1TJ6A 1UNRA 2YVCA 5D3WA 1FGYA 1W1DA 2RVBB 4NSWA 4YL8A 2N0YA 4KHBB 2FJLA 4A6FA 1GC7A 5JP4A 1ISNA 2DHKA 4HAVB 4IFSA 1EVHA 5CLQB 4GZUA 3U8ZA 2HE7A 2ROZB 1FAOA 1I2HA 4DX8A 2UZRA 1KI1B 1NI2A 1U5DA 3F5RA 4GN1A 4KHAA 3DXEA 5LOPB 2UVMA 2DA0A 3CXBB 4HHVA 1J19A 4Y94A 3TO1A 4HB4B 2Y8FA 2H7DA 2MKRA 4A6FB 2IYBA 1XD4A 4HAXB 2LG1A 2YS3A 2K00A 2W2WA 2G35A 1FGZA 2COFA 1V89A 1MK7B 4MY6A 5CLLB 2EMTA 4IOYX 2DN6A 1XR0B 1U5GA 4HAUB 2ROVA 2DHJA 1V5UA 3M1IB 2ADZA 2EJ8A 3PVLA 4ZRJA 2YT1A 4EKUA 2D4QA 3KRWA 1ZC4B 4HB3B 2RGNB 3GYOA 1MAIA 3SV1A 2ELAA 5D3VA 1V5PA 1OY2A 4K2OA 1PMSA 3A98B 4TYZA 1XCGA 3LJUX 1BTNA 1FB8A 2I5FA 3TCAA 1DDWA 4ZRIA 1Y5OA 5DI9B 3TVVA 2R09A 1IRSA 3RCPA 3ZDTA 2KUPA 2E2XA 5C5BA 2DTCA 2W2XC 2DKPA 3ODXA 2QKMA 4GMVA 4Z2NA 1DDVA 4NY0A 2NMBA 5C6RA 1J0WA 4HDQA 2YS1A 4HB0B 4A6KA 4P7IA 2DYQA 1X05A 2BCJA 3ULBA 1KZ7A 1H10A 2DLWA 5J3TA 1TQZA 3QBVB 3D8DA 1DDMA 2J59M 1LW3A 5DHAB 1EGXA 4C0AA 1V61A 1WVHA 4B6HA 2P0FA 2KCJA 5D27A 1EAZA 2P8VA 1H4RA 1BAKA 2X18A 2Z0QA 2CY4A 3SO6A 3KZ1A 2XQNM 2D9YA 1RRPB 5HE2A 1P3RA 2UZSA 1U2BA 2I5CA 3A8PA 4CHMA 1OQNA 5GOWB 1ZM0A 4D0NB 4HAYB 4F7GA 4F7UP 4EJNA 2VSZA 1X1GA 2L2IA 1MPHA 1W1GA 2GS0A 2Q13A 2YF0A 2CY5A 2Y7BA 3FSSA 5HE3A 2P0HA 4CYEA 2COAA 1E5WA 1X86A 5FI0A 1DROA 3ZVRA 4TKNA 3D8EA 4PQ0A 3N7CA 2OTXA 3PZDA 2LOXA 4WSFA 1WGUA 2KGXB 1Q67A 3P7ZA 2D10A 3SYXA 3V5WA 1FHOA 3FM8C 2GJYA 1KZGA 5KQ4A 2V76A 2YS5A 3G9WA 5KCVA 4L6EA 1AQCA 2H7EA 4F7HA 5D3YA 4GXBA 4MK0A 2ELBA 3F0WA 1EF1A 4GPTB 3TFMA 4HAWB 1P6SA 2RUKB 3ODWA 2Y8GA 1ZSQA 2ZPYA 2I1JA 4GMXB 5LONB 3AU5A 3BJIA 1NTVA 1WJMA 2Z0OA 1DBHA 5DH9B 5C16A 5D3XA 3HQCA 1PLSA 5J3YA 2DYNA 2D11A 3KSYA 3O96A 4PNKA 5JLJB 2I1KA 2D9ZA 5JHHA 4KHOA 1MK9B 3DXDA 2W2XD 1K5GB 4K2PA 1NTYA 2VRWB 5DIFB 3VIAA 1X11A 2YSZA 1OMWA 3SNHA 2N23A 4ZRKA 1XODA 5DHFB 1UNQA 1MIXA 5KQ1A 2D2QA 1U29A 1Y19B 1DYNA 3GYPA 2J0JA 1QC6A 1WI1A 2RSGA 1M7EA 2D9WA 4DXAB 2J0KA 4HDOA 4MT7A 3SUZA 1BTKA 1UPQA 3A8QA 1M7RA 2MFQA 3PP2A 3MDBC 5EFXA 2CAYA 2P0DA 3D8FA 1FHXA 2YT0A 2Z0PA 1GG3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EC1 A;  1PFJ A;  2M14 A;  1U5E A;  2GCL A;  3FEH A;  1MKE A;  3T06 A;  2AEH A;  3KY9 A;  4KVG B;  3DXC A;  3WA0 A;  3HW2 B;  1XKE A;  2EMS A;  2MWN B;  1V88 A;  1WGQ A;  3PVW A;  2JP2 A;  4HB2 B;  1U27 A;  5J3Q A;  4DBB A;  3ODO A;  4Z2M B;  2RLO A;  1Z87 A;  4EMO A;  4KAX B;  3WYF B;  5FI1 A;  3BIN A;  3CIK A;  2LOZ A;  2J0M A;  1UEF A;  3HK0 A;  3PEG A;  1WG7 A;  2YRY A;  4IAP A;  4YON A;  2QKL A;  5JHG A;  5L81 A;  3U7D A;  1UPR A;  2D9V A;  4K81 A;  2LYD A;  1W1H A;  1ZVR A;  2IFS A;  2COC A;  2D9X A;  4DX9 0;  2K2U A;  1QQG A;  3KRX A;  4WVF B;  3NSU A;  2LKO A;  3VOQ A;  3AJ4 A;  1ZC3 B;  2CRF A;  4XWX A;  1BWN A;  3PG7 A;  3P6A A;  4H8S A;  2COD A;  2L1C A;  4CHJ A;  4WJ7 A;  2K2J A;  3PVU A;  1K5D B;  1N3H A;  5C79 A;  3TW1 A;  2PZ1 A;  2DKQ A;  4A5K A;  5HE0 A;  1WJ1 A;  1UNP A;  1FHW A;  2MDX A;  2VKI A;  1NU2 A;  1I7A A;  1SGH A;  3PSC A;  4HAT B;  4A6H A;  1FOE A;  1SHC A;  3ML4 A;  4BBK A;  1RJ2 A;  3AU4 A;  3UZT A;  3ULC A;  1B55 A;  2DX5 A;  2NZ8 B;  1LB1 A;  2DX1 A;  1GC6 A;  3OAN A;  3QIJ A;  2RNR B;  5HE1 A;  3X23 A;  1MIZ B;  1P5T A;  4HAZ B;  2GCJ A;  3IVF A;  1AWE A;  2R0D A;  2DHI A;  2OQB A;  2LUL A;  3MPX A;  5C5B B;  4K17 A;  2AL6 A;  1U5F A;  2HTH B;  3QWM A;  1X1F A;  1TXD A;  1V5M A;  2DFK A;  2M38 A;  1XX0 A;  1TJ6 A;  1UNR A;  2YVC A;  5D3W A;  1FGY A;  1W1D A;  2RVB B;  4NSW A;  4YL8 A;  2N0Y A;  4KHB B;  2FJL A;  4A6F A;  1GC7 A;  5JP4 A;  1ISN A;  2DHK A;  4HAV B;  4IFS A;  1EVH A;  5CLQ B;  4GZU A;  3U8Z A;  2HE7 A;  2ROZ B;  1FAO A;  1I2H A;  4DX8 A;  2UZR A;  1KI1 B;  1NI2 A;  1U5D A;  3F5R A;  4GN1 A;  4KHA A;  3DXE A;  5LOP B;  2UVM A;  2DA0 A;  3CXB B;  4HHV A;  1J19 A;  4Y94 A;  3TO1 A;  4HB4 B;  2Y8F A;  2H7D A;  2MKR A;  4A6F B;  2IYB A;  1XD4 A;  4HAX B;  2LG1 A;  2YS3 A;  2K00 A;  2W2W A;  2G35 A;  1FGZ A;  2COF A;  1V89 A;  1MK7 B;  4MY6 A;  5CLL B;  2EMT A;  4IOY X;  2DN6 A;  1XR0 B;  1U5G A;  4HAU B;  2ROV A;  2DHJ A;  1V5U A;  3M1I B;  2ADZ A;  2EJ8 A;  3PVL A;  4ZRJ A;  2YT1 A;  4EKU A;  2D4Q A;  3KRW A;  1ZC4 B;  4HB3 B;  2RGN B;  3GYO A;  1MAI A;  3SV1 A;  2ELA A;  5D3V A;  1V5P A;  1OY2 A;  4K2O A;  1PMS A;  3A98 B;  4TYZ A;  1XCG A;  3LJU X;  1BTN A;  1FB8 A;  2I5F A;  3TCA A;  1DDW A;  4ZRI A;  1Y5O A;  5DI9 B;  3TVV A;  2R09 A;  1IRS A;  3RCP A;  3ZDT A;  2KUP A;  2E2X A;  5C5B A;  2DTC A;  2W2X C;  2DKP A;  3ODX A;  2QKM A;  4GMV A;  4Z2N A;  1DDV A;  4NY0 A;  2NMB A;  5C6R A;  1J0W A;  4HDQ A;  2YS1 A;  4HB0 B;  4A6K A;  4P7I A;  2DYQ A;  1X05 A;  2BCJ A;  3ULB A;  1KZ7 A;  1H10 A;  2DLW A;  5J3T A;  1TQZ A;  3QBV B;  3D8D A;  1DDM A;  2J59 M;  1LW3 A;  5DHA B;  1EGX A;  4C0A A;  1V61 A;  1WVH A;  4B6H A;  2P0F A;  2KCJ A;  5D27 A;  1EAZ A;  2P8V A;  1H4R A;  1BAK A;  2X18 A;  2Z0Q A;  2CY4 A;  3SO6 A;  3KZ1 A;  2XQN M;  2D9Y A;  1RRP B;  5HE2 A;  1P3R A;  2UZS A;  1U2B A;  2I5C A;  3A8P A;  4CHM A;  1OQN A;  5GOW B;  1ZM0 A;  4D0N B;  4HAY B;  4F7G A;  4F7U P;  4EJN A;  2VSZ A;  1X1G A;  2L2I A;  1MPH A;  1W1G A;  2GS0 A;  2Q13 A;  2YF0 A;  2CY5 A;  2Y7B A;  3FSS A;  5HE3 A;  2P0H A;  4CYE A;  2COA A;  1E5W A;  1X86 A;  5FI0 A;  1DRO A;  3ZVR A;  4TKN A;  3D8E A;  4PQ0 A;  3N7C A;  2OTX A;  3PZD A;  2LOX A;  4WSF A;  1WGU A;  2KGX B;  1Q67 A;  3P7Z A;  2D10 A;  3SYX A;  3V5W A;  1FHO A;  3FM8 C;  2GJY A;  1KZG A;  5KQ4 A;  2V76 A;  2YS5 A;  3G9W A;  5KCV A;  4L6E A;  1AQC A;  2H7E A;  4F7H A;  5D3Y A;  4GXB A;  4MK0 A;  2ELB A;  3F0W A;  1EF1 A;  4GPT B;  3TFM A;  4HAW B;  1P6S A;  2RUK B;  3ODW A;  2Y8G A;  1ZSQ A;  2ZPY A;  2I1J A;  4GMX B;  5LON B;  3AU5 A;  3BJI A;  1NTV A;  1WJM A;  2Z0O A;  1DBH A;  5DH9 B;  5C16 A;  5D3X A;  3HQC A;  1PLS A;  5J3Y A;  2DYN A;  2D11 A;  3KSY A;  3O96 A;  4PNK A;  5JLJ B;  2I1K A;  2D9Z A;  5JHH A;  4KHO A;  1MK9 B;  3DXD A;  2W2X D;  1K5G B;  4K2P A;  1NTY A;  2VRW B;  5DIF B;  3VIA A;  1X11 A;  2YSZ A;  1OMW A;  3SNH A;  2N23 A;  4ZRK A;  1XOD A;  5DHF B;  1UNQ A;  1MIX A;  5KQ1 A;  2D2Q A;  1U29 A;  1Y19 B;  1DYN A;  3GYP A;  2J0J A;  1QC6 A;  1WI1 A;  2RSG A;  1M7E A;  2D9W A;  4DXA B;  2J0K A;  4HDO A;  4MT7 A;  3SUZ A;  1BTK A;  1UPQ A;  3A8Q A;  1M7R A;  2MFQ A;  3PP2 A;  3MDB C;  5EFX A;  2CAY A;  2P0D A;  3D8F A;  1FHX A;  2YT0 A;  2Z0P A;  1GG3 A; 
#chains in the Genus database with same CATH topology
 2EC1 A;  1PFJ A;  2M14 A;  1U5E A;  2GCL A;  3FEH A;  1MKE A;  3T06 A;  2AEH A;  3KY9 A;  1T77 A;  4KVG B;  3DXC A;  3WA0 A;  3HW2 B;  1XKE A;  2EMS A;  2MWN B;  1V88 A;  1WGQ A;  3PVW A;  2JP2 A;  4HB2 B;  1U27 A;  5J3Q A;  4DBB A;  3ODO A;  4Z2M B;  2RLO A;  1Z87 A;  4EMO A;  4KAX B;  3WYF B;  5FI1 A;  3BIN A;  3CIK A;  2LOZ A;  2J0M A;  1UEF A;  2Z59 A;  3HK0 A;  3PEG A;  1WG7 A;  2YRY A;  4IAP A;  4YON A;  2QKL A;  5JHG A;  5L81 A;  3U7D A;  1UPR A;  2D9V A;  4K81 A;  2LYD A;  1W1H A;  1ZVR A;  2IFS A;  2COC A;  2D9X A;  4DX9 0;  2K2U A;  1QQG A;  3KRX A;  4WVF B;  3NSU A;  2LKO A;  3VOQ A;  3AJ4 A;  2K49 A;  3HIE A;  1ZC3 B;  2CRF A;  4XWX A;  1BWN A;  3PG7 A;  3P6A A;  4H8S A;  2COD A;  1ZYI A;  2L1C A;  4CHJ A;  4WJ7 A;  2K2J A;  3PVU A;  1K5D B;  1N3H A;  5C79 A;  3TW1 A;  2PZ1 A;  2DKQ A;  2KIG A;  4A5K A;  5HE0 A;  1WJ1 A;  1UNP A;  1FHW A;  2MDX A;  3NWF A;  2VKI A;  1NU2 A;  1I7A A;  1SGH A;  3PSC A;  4HAT B;  4A6H A;  1FOE A;  3U12 A;  1SHC A;  3ML4 A;  4BBK A;  1RJ2 A;  3AU4 A;  3UZT A;  2K8E A;  3ULC A;  1B55 A;  2DX5 A;  2NZ8 B;  2NBV A;  1LB1 A;  2DX1 A;  1GC6 A;  3OAN A;  3QIJ A;  2RNR B;  5HE1 A;  3X23 A;  1MIZ B;  1P5T A;  4HAZ B;  2YT2 A;  2GCJ A;  3IVF A;  1AWE A;  2R0D A;  2DHI A;  2OQB A;  2LUL A;  3MPX A;  5C5B B;  3B77 A;  4K17 A;  2AL6 A;  1U5F A;  2HTH B;  3QWM A;  1X1F A;  1TXD A;  1V5M A;  2DFK A;  2FJU B;  2M38 A;  3DCX A;  1XX0 A;  3NWD A;  1TJ6 A;  1UNR A;  2YVC A;  5D3W A;  1FGY A;  1W1D A;  2RVB B;  4NSW A;  4YL8 A;  2N0Y A;  4GNK B;  4KHB B;  2FJL A;  4A6F A;  1GC7 A;  5JP4 A;  1ISN A;  2DHK A;  4HAV B;  4IFS A;  1EVH A;  5CLQ B;  4GZU A;  3U8Z A;  3HSA A;  2RRF A;  2HE7 A;  2ROZ B;  1FAO A;  3A58 A;  1I2H A;  4DX8 A;  5IRS A;  2UZR A;  1KI1 B;  1NI2 A;  1U5D A;  3F5R A;  4GN1 A;  4KHA A;  3DXE A;  5LOP B;  2UVM A;  2DA0 A;  3CXB B;  4OT1 A;  4HHV A;  1J19 A;  4Y94 A;  3TO1 A;  4HB4 B;  2Y8F A;  2H7D A;  2MKR A;  4A6F B;  2IYB A;  1XD4 A;  4HAX B;  4QJ3 B;  2LG1 A;  2YS3 A;  2K00 A;  2W2W A;  2G35 A;  1FGZ A;  2COF A;  1V89 A;  1MK7 B;  4MY6 A;  5CLL B;  2EMT A;  4IOY X;  2DN6 A;  1XR0 B;  1U5G A;  4HAU B;  2ROV A;  2DHJ A;  1V5U A;  3M1I B;  2ADZ A;  2EJ8 A;  3PVL A;  4ZRJ A;  2YT1 A;  4EKU A;  2D4Q A;  3KRW A;  1ZC4 B;  4HB3 B;  2RGN B;  3GYO A;  1MAI A;  3SV1 A;  4CSQ A;  2ELA A;  4QXA B;  3NW8 A;  2GUM A;  5D3V A;  1V5P A;  1OY2 A;  4K2O A;  1PMS A;  3A98 B;  4TYZ A;  1XCG A;  1BTN A;  3LJU X;  1FB8 A;  2I5F A;  3TCA A;  1DDW A;  4ZRI A;  1Y5O A;  5DI9 B;  3TVV A;  2R09 A;  1IRS A;  3RCP A;  3ZDT A;  2Z13 A;  2KUP A;  2E2X A;  5C5B A;  2DTC A;  2W2X C;  2DKP A;  3ODX A;  2QKM A;  4GMV A;  4Z2N A;  1DDV A;  4NY0 A;  2NMB A;  5C6R A;  1J0W A;  4L1R A;  4HDQ A;  2YS1 A;  4HB0 B;  4A6K A;  4P7I A;  2DYQ A;  1X05 A;  2BCJ A;  4KHB A;  3ULB A;  1KZ7 A;  1H10 A;  2DLW A;  5J3T A;  1TQZ A;  3QBV B;  3D8D A;  1DDM A;  2J59 M;  1LW3 A;  5DHA B;  1EGX A;  4C0A A;  1V61 A;  1WVH A;  4B6H A;  2P0F A;  2KCJ A;  5D27 A;  1EAZ A;  3NWA A;  2P8V A;  1H4R A;  4OSN A;  1BAK A;  2X18 A;  2Z0Q A;  2CY4 A;  3SO6 A;  3KZ1 A;  2XQN M;  2D9Y A;  1RRP B;  4GOU A;  5HE2 A;  1P3R A;  2UZS A;  1U2B A;  2I5C A;  3A8P A;  4CHM A;  1OQN A;  5GOW B;  1ZM0 A;  4D0N B;  4HAY B;  4F7G A;  4F7U P;  2Z14 A;  4EJN A;  2VSZ A;  1X1G A;  2L2I A;  1MPH A;  1W1G A;  2GS0 A;  2Q13 A;  2YF0 A;  2CY5 A;  2Y7B A;  3FSS A;  2KIE A;  5HE3 A;  2P0H A;  1MI1 A;  4CYE A;  2COA A;  1E5W A;  1X86 A;  5FI0 A;  1DRO A;  3ZVR A;  4TKN A;  3D8E A;  4PQ0 A;  3N7C A;  2OTX A;  3PZD A;  2LOX A;  4WSF A;  1WGU A;  2KGX B;  1Q67 A;  3P7Z A;  2D10 A;  3SYX A;  3V5W A;  1FHO A;  3FM8 C;  2GJY A;  1KZG A;  5KQ4 A;  2V76 A;  2YS5 A;  3G9W A;  5M4Y B;  5KCV A;  4L6E A;  1AQC A;  2H7E A;  4F7H A;  5D3Y A;  4GXB A;  4MK0 A;  2ELB A;  3F0W A;  1EF1 A;  4GPT B;  3TFM A;  4HAW B;  1P6S A;  2RUK B;  3ODW A;  2Y8G A;  1ZSQ A;  2ZPY A;  2ZKM X;  4QJ5 B;  2I1J A;  4GMX B;  5LON B;  3AU5 A;  3BJI A;  1NTV A;  1WJM A;  2Z0O A;  4HSI A;  1DBH A;  5DH9 B;  5C16 A;  4QJ4 B;  5D3X A;  3HQC A;  1PLS A;  5J3Y A;  2DYN A;  2D11 A;  3KSY A;  3O96 A;  3OHM B;  4PNK A;  5JLJ B;  5I2M A;  2I1K A;  4DIX A;  2D9Z A;  5JHH A;  4KHO A;  1MK9 B;  2R2Y A;  3DXD A;  2W2X D;  1K5G B;  2KR0 A;  4K2P A;  1NTY A;  2VRW B;  5DIF B;  3VIA A;  1X11 A;  2YSZ A;  1OMW A;  3SNH A;  2KUQ A;  2N23 A;  4ZRK A;  1XOD A;  5DHF B;  1UNQ A;  1MIX A;  5KQ1 A;  2D2Q A;  1U29 A;  1Y19 B;  1DYN A;  3GYP A;  2J0J A;  1QC6 A;  1WI1 A;  2RSG A;  1M7E A;  2D9W A;  4DXA B;  2J0K A;  2Z4D A;  4HDO A;  4MT7 A;  3SUZ A;  1BTK A;  5I2S A;  1UPQ A;  3FVC A;  3A8Q A;  1M7R A;  2MFQ A;  5LG4 B;  3PP2 A;  3MDB C;  5EFX A;  4D6W A;  2CAY A;  2P0D A;  3D8F A;  1FHX A;  2YT0 A;  2Z0P A;  1GG3 A; 
#chains in the Genus database with same CATH homology
 2EC1 A;  1PFJ A;  2M14 A;  1U5E A;  2GCL A;  3FEH A;  1MKE A;  3T06 A;  2AEH A;  3KY9 A;  4KVG B;  3DXC A;  3WA0 A;  3HW2 B;  1XKE A;  2EMS A;  2MWN B;  1V88 A;  1WGQ A;  3PVW A;  2JP2 A;  4HB2 B;  1U27 A;  5J3Q A;  4DBB A;  3ODO A;  4Z2M B;  2RLO A;  1Z87 A;  4EMO A;  4KAX B;  3WYF B;  5FI1 A;  3BIN A;  3CIK A;  2LOZ A;  2J0M A;  1UEF A;  3HK0 A;  3PEG A;  1WG7 A;  2YRY A;  4IAP A;  4YON A;  2QKL A;  5JHG A;  5L81 A;  3U7D A;  1UPR A;  2D9V A;  4K81 A;  2LYD A;  1W1H A;  1ZVR A;  2IFS A;  2COC A;  2D9X A;  4DX9 0;  2K2U A;  1QQG A;  3KRX A;  4WVF B;  3NSU A;  2LKO A;  3VOQ A;  3AJ4 A;  1ZC3 B;  2CRF A;  4XWX A;  1BWN A;  3PG7 A;  3P6A A;  4H8S A;  2COD A;  2L1C A;  4CHJ A;  4WJ7 A;  2K2J A;  3PVU A;  1K5D B;  1N3H A;  5C79 A;  3TW1 A;  2PZ1 A;  2DKQ A;  4A5K A;  5HE0 A;  1WJ1 A;  1UNP A;  1FHW A;  2MDX A;  2VKI A;  1NU2 A;  1I7A A;  1SGH A;  3PSC A;  4HAT B;  4A6H A;  1FOE A;  1SHC A;  3ML4 A;  4BBK A;  1RJ2 A;  3AU4 A;  3UZT A;  3ULC A;  1B55 A;  2DX5 A;  2NZ8 B;  1LB1 A;  2DX1 A;  1GC6 A;  3OAN A;  3QIJ A;  2RNR B;  5HE1 A;  3X23 A;  1MIZ B;  1P5T A;  4HAZ B;  2GCJ A;  3IVF A;  1AWE A;  2R0D A;  2DHI A;  2OQB A;  2LUL A;  3MPX A;  5C5B B;  4K17 A;  2AL6 A;  1U5F A;  2HTH B;  3QWM A;  1X1F A;  1TXD A;  1V5M A;  2DFK A;  2M38 A;  1XX0 A;  1TJ6 A;  1UNR A;  2YVC A;  5D3W A;  1FGY A;  1W1D A;  2RVB B;  4NSW A;  4YL8 A;  2N0Y A;  4KHB B;  2FJL A;  4A6F A;  1GC7 A;  5JP4 A;  1ISN A;  2DHK A;  4HAV B;  4IFS A;  1EVH A;  5CLQ B;  4GZU A;  3U8Z A;  2HE7 A;  2ROZ B;  1FAO A;  1I2H A;  4DX8 A;  2UZR A;  1KI1 B;  1NI2 A;  1U5D A;  3F5R A;  4GN1 A;  4KHA A;  3DXE A;  5LOP B;  2UVM A;  2DA0 A;  3CXB B;  4HHV A;  1J19 A;  4Y94 A;  3TO1 A;  4HB4 B;  2Y8F A;  2H7D A;  2MKR A;  4A6F B;  2IYB A;  1XD4 A;  4HAX B;  2LG1 A;  2YS3 A;  2K00 A;  2W2W A;  2G35 A;  1FGZ A;  2COF A;  1V89 A;  1MK7 B;  4MY6 A;  5CLL B;  2EMT A;  4IOY X;  2DN6 A;  1XR0 B;  1U5G A;  4HAU B;  2ROV A;  2DHJ A;  1V5U A;  3M1I B;  2ADZ A;  2EJ8 A;  3PVL A;  4ZRJ A;  2YT1 A;  4EKU A;  2D4Q A;  3KRW A;  1ZC4 B;  4HB3 B;  2RGN B;  3GYO A;  1MAI A;  3SV1 A;  2ELA A;  5D3V A;  1V5P A;  1OY2 A;  4K2O A;  1PMS A;  3A98 B;  4TYZ A;  1XCG A;  3LJU X;  1BTN A;  1FB8 A;  2I5F A;  3TCA A;  1DDW A;  4ZRI A;  1Y5O A;  5DI9 B;  3TVV A;  2R09 A;  1IRS A;  3RCP A;  3ZDT A;  2KUP A;  2E2X A;  5C5B A;  2DTC A;  2W2X C;  2DKP A;  3ODX A;  2QKM A;  4GMV A;  4Z2N A;  1DDV A;  4NY0 A;  2NMB A;  5C6R A;  1J0W A;  4HDQ A;  2YS1 A;  4HB0 B;  4A6K A;  4P7I A;  2DYQ A;  1X05 A;  2BCJ A;  3ULB A;  1KZ7 A;  1H10 A;  2DLW A;  5J3T A;  1TQZ A;  3QBV B;  3D8D A;  1DDM A;  2J59 M;  1LW3 A;  5DHA B;  1EGX A;  4C0A A;  1V61 A;  1WVH A;  4B6H A;  2P0F A;  2KCJ A;  5D27 A;  1EAZ A;  2P8V A;  1H4R A;  1BAK A;  2X18 A;  2Z0Q A;  2CY4 A;  3SO6 A;  3KZ1 A;  2XQN M;  2D9Y A;  1RRP B;  5HE2 A;  1P3R A;  2UZS A;  1U2B A;  2I5C A;  3A8P A;  4CHM A;  1OQN A;  5GOW B;  1ZM0 A;  4D0N B;  4HAY B;  4F7G A;  4F7U P;  4EJN A;  2VSZ A;  1X1G A;  2L2I A;  1MPH A;  1W1G A;  2GS0 A;  2Q13 A;  2YF0 A;  2CY5 A;  2Y7B A;  3FSS A;  5HE3 A;  2P0H A;  4CYE A;  2COA A;  1E5W A;  1X86 A;  5FI0 A;  1DRO A;  3ZVR A;  4TKN A;  3D8E A;  4PQ0 A;  3N7C A;  2OTX A;  3PZD A;  2LOX A;  4WSF A;  1WGU A;  2KGX B;  1Q67 A;  3P7Z A;  2D10 A;  3SYX A;  3V5W A;  1FHO A;  3FM8 C;  2GJY A;  1KZG A;  5KQ4 A;  2V76 A;  2YS5 A;  3G9W A;  5KCV A;  4L6E A;  1AQC A;  2H7E A;  4F7H A;  5D3Y A;  4GXB A;  4MK0 A;  2ELB A;  3F0W A;  1EF1 A;  4GPT B;  3TFM A;  4HAW B;  1P6S A;  2RUK B;  3ODW A;  2Y8G A;  1ZSQ A;  2ZPY A;  2I1J A;  4GMX B;  5LON B;  3AU5 A;  3BJI A;  1NTV A;  1WJM A;  2Z0O A;  1DBH A;  5DH9 B;  5C16 A;  5D3X A;  3HQC A;  1PLS A;  5J3Y A;  2DYN A;  2D11 A;  3KSY A;  3O96 A;  4PNK A;  5JLJ B;  2I1K A;  2D9Z A;  5JHH A;  4KHO A;  1MK9 B;  3DXD A;  2W2X D;  1K5G B;  4K2P A;  1NTY A;  2VRW B;  5DIF B;  3VIA A;  1X11 A;  2YSZ A;  1OMW A;  3SNH A;  2N23 A;  4ZRK A;  1XOD A;  5DHF B;  1UNQ A;  1MIX A;  5KQ1 A;  2D2Q A;  1U29 A;  1Y19 B;  1DYN A;  3GYP A;  2J0J A;  1QC6 A;  1WI1 A;  2RSG A;  1M7E A;  2D9W A;  4DXA B;  2J0K A;  4HDO A;  4MT7 A;  3SUZ A;  1BTK A;  1UPQ A;  3A8Q A;  1M7R A;  2MFQ A;  3PP2 A;  3MDB C;  5EFX A;  2CAY A;  2P0D A;  3D8F A;  1FHX A;  2YT0 A;  2Z0P A;  1GG3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...