1V89A

Solution structure of the pleckstrin homology domain of human kiaa0053 protein
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
118
structure length
118
Chain Sequence
GSSGSSGPIKMGWLKKQRSIVKNWQQRYFVLRAQQLYYYKDEEDTKPQGCMYLPGCTIKEIATNPEEAGKFVFEIIPASWDQNRMGQDSYVLMASSQAEMEEWVKFLRRVAGSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution Structure of the Pleckstrin Homology Domain of Human KIAA0053 Protein
rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Hypothetical protein KIAA0053
total genus 13
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2003-12-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1v89A00
3ODWA 1SHCA 4GMVA 3PSCA 1LW3A 2V76A 4K17A 4YONA 4HDOA 2J0KA 3UZTA 2CY4A 2KGXB 2J0MA 1UNPA 1KI1B 4IFSA 1X86A 1GC7A 3PEGA 1E5WA 1EVHA 4HAUB 4WJ7A 5C6RA 2DFKA 1KZ7A 3AJ4A 4L6EA 4A5KA 2IFSA 1K5GB 3HW2B 1U5EA 1RRPB 2DN6A 1MK7B 1TJ6A 3PZDA 2UZRA 1WVHA 1TXDA 2K2JA 2GCJA 1H4RA 5J3TA 4DBBA 3FM8C 2D9VA 4ZRKA 1MKEA 2RUKB 1OY2A 2CY5A 1B55A 4F7GA 3P6AA 1BWNA 3M1IB 1WI1A 1UNQA 4K81A 1X11A 4A6FA 3LJUX 5D3WA 1BTKA 3SNHA 1FOEA 1MK9B 2DX5A 2KUPA 2YS1A 4CYEA 4XWXA 2HTHB 3SO6A 1V88A 1SGHA 1DDWA 2AL6A 1XODA 1V89A 2COFA 4YL8A 2OQBA 3U8ZA 3TVVA 3PVWA 1NI2A 5KQ1A 2NZ8B 3D8DA 1DDVA 2COAA 5DIFB 2EMSA 2MDXA 3IVFA 2DX1A 2QKMA 3VIAA 1I2HA 4GN1A 1X1GA 1DBHA 4WVFB 1EGXA 2ELAA 4PNKA 2DHKA 4CHMA 1RJ2A 4KHOA 1U5GA 2UZSA 2M14A 4DX8A 5DHAB 3ULCA 4HB4B 5C79A 2D9XA 1NTVA 2PZ1A 5C5BB 1K5DB 5CLQB 2H7EA 1ZC3B 3A98B 2D10A 3F5RA 4HHVA 1DYNA 1EAZA 1P6SA 1MIXA 3PVLA 1P3RA 5DHFB 4BBKA 1WGQA 1FAOA 3AU4A 4PQ0A 4NSWA 1UNRA 1MPHA 4HAZB 4HDQA 3GYPA 4B6HA 1FHXA 2BCJA 4IAPA 2IYBA 5DH9B 1I7AA 2X18A 2LKOA 2DHIA 4HB3B 2GCLA 2VRWB 2YSZA 2MKRA 4MY6A 4HAXB 4F7UP 2EJ8A 2YVCA 2G35A 5J3QA 1PFJA 3ODOA 5KCVA 2Z0OA 3ZVRA 1LB1A 2M38A 5C5BA 2Y8GA 1J0WA 1PMSA 2Q13A 3KRXA 2YRYA 1UEFA 2Y8FA 4Z2MB 1XCGA 2Y7BA 4IOYX 5DI9B 5FI1A 2D9WA 2GS0A 2NMBA 2CAYA 1FB8A 2RNRB 4EMOA 3V5WA 2CODA 2MFQA 2YS3A 2RSGA 4HAWB 3TO1A 2P0HA 2P8VA 5HE0A 4P7IA 1WGUA 5J3YA 4TKNA 1FGYA 1V5PA 4GXBA 3U7DA 5D27A 4KVGB 2I1KA 4EJNA 3A8PA 1DROA 5JLJB 4GPTB 1QC6A 1ZVRA 3X23A 2LYDA 1M7RA 4H8SA 4HAVB 5FI0A 3FEHA 1WJ1A 5D3XA 2LULA 5CLLB 4ZRIA 3KZ1A 3D8EA 4HATB 2GJYA 2DA0A 4EKUA 1Z87A 5EFXA 3O96A 3ULBA 4GZUA 3SYXA 2I1JA 5D3VA 4HB0B 1MIZB 1U5DA 2RLOA 3ML4A 3TFMA 1UPRA 2E2XA 2Z0PA 3P7ZA 1OQNA 3PG7A 3QIJA 1Q67A 3MPXA 1IRSA 3GYOA 1KZGA 2DLWA 4K2OA 3HK0A 2Z0QA 5LONB 2K2UA 2D4QA 4Z2NA 3PVUA 2JP2A 2R0DA 2DKPA 3WYFB 1V5MA 3RCPA 2LOZA 1U2BA 2DTCA 2N23A 3VOQA 2DYNA 2OTXA 3G9WA 2QKLA 2J59M 3MDBC 4A6FB 2XQNM 3SV1A 5C16A 1ZM0A 2P0DA 2J0JA 4GMXB 1WG7A 1J19A 2VSZA 4A6KA 5KQ4A 1WJMA 2DKQA 1M7EA 4NY0A 3TCAA 4HB2B 2R09A 2CRFA 5JP4A 5D3YA 2EMTA 3N7CA 2HE7A 2ELBA 4KAXB 2RVBB 2H7DA 1BTNA 1W1GA 1W1DA 2ROVA 3ODXA 1NU2A 1EF1A 2D9YA 3WA0A 2AEHA 1H10A 2L1CA 2W2XC 2VKIA 1P5TA 3TW1A 2LG1A 3KY9A 3CXBB 1X05A 4HAYB 3A8QA 2W2WA 5L81A 1XD4A 2LOXA 1XKEA 3ZDTA 1XR0B 5HE2A 1Y5OA 4WSFA 1TQZA 4KHAA 3QBVB 3CIKA 4K2PA 1U5FA 1FHOA 3DXDA 1AQCA 2D11A 2I5CA 4MK0A 2UVMA 4KHBB 4ZRJA 4Y94A 2KCJA 2DYQA 4F7HA 5HE1A 4D0NB 4DXAB 1PLSA 2DHJA 5JHGA 3BJIA 1X1FA 5LOPB 1ZSQA 3BINA 2ADZA 2ZPYA 3DXCA 2COCA 2I5FA 1NTYA 1QQGA 2P0FA 2MWNB 3FSSA 1V5UA 2K00A 3D8FA 2YS5A 2D2QA 3T06A 1OMWA 2FJLA 2EC1A 1U29A 2L2IA 3AU5A 1W1HA 1Y19B 3PP2A 2RGNB 4C0AA 2N0YA 1GC6A 1GG3A 3KSYA 1DDMA 3SUZA 1ISNA 2ROZB 4CHJA 1U27A 3OANA 2YT0A 1FGZA 2W2XD 2YT1A 5HE3A 5JHHA 1BAKA 1ZC4B 4TYZA 1XX0A 3KRWA 4MT7A 3QWMA 2YF0A 1UPQA 5GOWB 4DX90 3DXEA 1N3HA 4A6HA 1MAIA 1FHWA 3NSUA 3F0WA 1V61A 1AWEA 3HQCA 2D9ZA
chains in the Genus database with same CATH superfamily
4GNKB 3ODWA 1SHCA 4GMVA 3PSCA 1LW3A 2V76A 4K17A 4YONA 3OHMB 4HDOA 4QJ5B 2J0KA 3UZTA 5LG4B 2CY4A 2KGXB 2J0MA 1UNPA 1KI1B 4IFSA 1X86A 1GC7A 3PEGA 1E5WA 1EVHA 4HAUB 4WJ7A 5C6RA 2DFKA 1KZ7A 3AJ4A 4L6EA 4A5KA 2IFSA 1K5GB 3HW2B 1U5EA 1RRPB 2DN6A 1MK7B 1TJ6A 3PZDA 2UZRA 1WVHA 1TXDA 2K2JA 2GCJA 1H4RA 5J3TA 4DBBA 3FM8C 2D9VA 4ZRKA 1MKEA 3HSAA 2RUKB 1OY2A 2CY5A 1B55A 4F7GA 3P6AA 1BWNA 3M1IB 2Z13A 1WI1A 1UNQA 2ZKMX 4K81A 1X11A 4A6FA 2R2YA 3LJUX 1BTKA 5D3WA 3SNHA 1FOEA 1MK9B 2DX5A 2KUPA 2YS1A 4CYEA 4XWXA 2YT2A 2HTHB 5IRSA 3SO6A 1V88A 2Z4DA 1SGHA 2GUMA 1DDWA 2AL6A 1XODA 1V89A 1ZYIA 2COFA 4YL8A 2OQBA 3U8ZA 3TVVA 3PVWA 1NI2A 5KQ1A 2NZ8B 3D8DA 1DDVA 2COAA 5DIFB 2EMSA 2MDXA 3IVFA 2DX1A 2QKMA 3VIAA 1I2HA 5I2SA 1X1GA 4GN1A 1DBHA 4WVFB 1EGXA 2ELAA 4PNKA 5M4YB 2DHKA 4CHMA 1RJ2A 4KHOA 1U5GA 2UZSA 2M14A 4DX8A 5DHAB 3ULCA 4HB4B 5C79A 3NWDA 2D9XA 4KHBA 1NTVA 2PZ1A 5C5BB 1K5DB 4DIXA 5CLQB 2H7EA 1ZC3B 3A98B 2D10A 3F5RA 4HHVA 4CSQA 1DYNA 1EAZA 1P6SA 1MIXA 3PVLA 1P3RA 5DHFB 4BBKA 1WGQA 1FAOA 3AU4A 4PQ0A 4NSWA 1UNRA 1MPHA 4HAZB 4HDQA 3GYPA 4B6HA 1FHXA 2BCJA 4IAPA 2IYBA 5DH9B 1I7AA 2X18A 2LKOA 2DHIA 4HB3B 2GCLA 2VRWB 2YSZA 2MKRA 4QJ3B 4MY6A 4HAXB 4F7UP 2EJ8A 2YVCA 2G35A 5J3QA 1PFJA 3ODOA 5KCVA 2Z0OA 3ZVRA 1LB1A 2M38A 5C5BA 2Y8GA 1J0WA 1PMSA 2Q13A 3KRXA 2YRYA 1UEFA 2Y8FA 4Z2MB 1XCGA 2Y7BA 4IOYX 5DI9B 5FI1A 2D9WA 2GS0A 2NMBA 4OSNA 2CAYA 1FB8A 2RNRB 4EMOA 4QJ4B 3V5WA 2CODA 2MFQA 2YS3A 2RSGA 4HAWB 3TO1A 2P0HA 2P8VA 5HE0A 4P7IA 1WGUA 5J3YA 4TKNA 1FGYA 1V5PA 4GXBA 3U7DA 5D27A 4KVGB 2I1KA 4EJNA 3A8PA 1DROA 5JLJB 4GPTB 2Z59A 1QC6A 1ZVRA 3X23A 2LYDA 1M7RA 4H8SA 4HAVB 5FI0A 3FEHA 3B77A 1WJ1A 3NW8A 5D3XA 2LULA 5CLLB 4ZRIA 1T77A 3KZ1A 3D8EA 4HATB 2GJYA 2DA0A 2KIEA 4EKUA 1Z87A 5EFXA 3O96A 3ULBA 2KUQA 4GZUA 3SYXA 2I1JA 5D3VA 4HB0B 1MIZB 1U5DA 2RLOA 3ML4A 3TFMA 1UPRA 2E2XA 2Z0PA 3P7ZA 1OQNA 3PG7A 3QIJA 1Q67A 3MPXA 1IRSA 3GYOA 1KZGA 2DLWA 4K2OA 3HK0A 2Z0QA 5LONB 2K2UA 2D4QA 3FVCA 4Z2NA 3PVUA 2KIGA 2JP2A 2R0DA 2DKPA 3WYFB 1V5MA 3RCPA 2LOZA 1U2BA 2DTCA 2N23A 2RRFA 3VOQA 2DYNA 2OTXA 3G9WA 2QKLA 2J59M 3MDBC 4A6FB 2XQNM 3SV1A 4HSIA 5C16A 1ZM0A 2P0DA 2J0JA 4GMXB 1WG7A 1J19A 2VSZA 4L1RA 4A6KA 5KQ4A 4D6WA 1WJMA 2DKQA 1M7EA 2K49A 4NY0A 3U12A 3TCAA 4HB2B 2R09A 2CRFA 5JP4A 5D3YA 2EMTA 3N7CA 2HE7A 2ELBA 4KAXB 2RVBB 2H7DA 1BTNA 1W1GA 1W1DA 2ROVA 4GOUA 3ODXA 1NU2A 1EF1A 2D9YA 3WA0A 2AEHA 2Z14A 1H10A 2L1CA 2W2XC 3NWAA 2VKIA 1P5TA 3TW1A 2LG1A 3KY9A 3DCXA 3CXBB 1X05A 4HAYB 3A8QA 2W2WA 5L81A 1XD4A 2LOXA 3A58A 1XKEA 3ZDTA 1XR0B 5HE2A 1Y5OA 2FJUB 4WSFA 1TQZA 4KHAA 3QBVB 3CIKA 4K2PA 1U5FA 1FHOA 1MI1A 3DXDA 1AQCA 2D11A 2I5CA 5I2MA 4MK0A 3NWFA 2UVMA 4KHBB 4ZRJA 4Y94A 2KCJA 4QXAB 2DYQA 4F7HA 5HE1A 4D0NB 4DXAB 1PLSA 2DHJA 5JHGA 3BJIA 1X1FA 5LOPB 1ZSQA 3BINA 2ADZA 2ZPYA 3DXCA 3HIEA 2COCA 2I5FA 4OT1A 1NTYA 1QQGA 2K8EA 2P0FA 2MWNB 3FSSA 1V5UA 2K00A 3D8FA 2YS5A 2D2QA 3T06A 1OMWA 2FJLA 2EC1A 1U29A 2L2IA 3AU5A 1W1HA 1Y19B 3PP2A 2RGNB 4C0AA 2N0YA 1GC6A 1GG3A 3KSYA 1DDMA 2NBVA 3SUZA 1ISNA 2ROZB 4CHJA 1U27A 3OANA 2YT0A 1FGZA 2W2XD 2YT1A 5HE3A 5JHHA 1BAKA 1ZC4B 4TYZA 1XX0A 3KRWA 2KR0A 4MT7A 3QWMA 2YF0A 1UPQA 5GOWB 4DX90 3DXEA 1N3HA 4A6HA 1MAIA 1FHWA 3NSUA 3F0WA 1V61A 1AWEA 3HQCA 2D9ZA
chains in the Genus database with same CATH topology
3ODWA 1SHCA 4GMVA 3PSCA 1LW3A 2V76A 4K17A 4YONA 4HDOA 2J0KA 3UZTA 2CY4A 2KGXB 2J0MA 1UNPA 1KI1B 4IFSA 1X86A 1GC7A 3PEGA 1E5WA 1EVHA 4HAUB 4WJ7A 5C6RA 2DFKA 1KZ7A 3AJ4A 4L6EA 4A5KA 2IFSA 1K5GB 3HW2B 1U5EA 1RRPB 2DN6A 1MK7B 1TJ6A 3PZDA 2UZRA 1WVHA 1TXDA 2K2JA 2GCJA 1H4RA 5J3TA 4DBBA 3FM8C 2D9VA 4ZRKA 1MKEA 2RUKB 1OY2A 2CY5A 1B55A 4F7GA 3P6AA 1BWNA 3M1IB 1WI1A 1UNQA 4K81A 1X11A 4A6FA 3LJUX 5D3WA 1BTKA 3SNHA 1FOEA 1MK9B 2DX5A 2KUPA 2YS1A 4CYEA 4XWXA 2HTHB 3SO6A 1V88A 1SGHA 1DDWA 2AL6A 1XODA 1V89A 2COFA 4YL8A 2OQBA 3U8ZA 3TVVA 3PVWA 1NI2A 5KQ1A 2NZ8B 3D8DA 1DDVA 2COAA 5DIFB 2EMSA 2MDXA 3IVFA 2DX1A 2QKMA 3VIAA 1I2HA 4GN1A 1X1GA 1DBHA 4WVFB 1EGXA 2ELAA 4PNKA 2DHKA 4CHMA 1RJ2A 4KHOA 1U5GA 2UZSA 2M14A 4DX8A 5DHAB 3ULCA 4HB4B 5C79A 2D9XA 1NTVA 2PZ1A 5C5BB 1K5DB 5CLQB 2H7EA 1ZC3B 3A98B 2D10A 3F5RA 4HHVA 1DYNA 1EAZA 1P6SA 1MIXA 3PVLA 1P3RA 5DHFB 4BBKA 1WGQA 1FAOA 3AU4A 4PQ0A 4NSWA 1UNRA 1MPHA 4HAZB 4HDQA 3GYPA 4B6HA 1FHXA 2BCJA 4IAPA 2IYBA 5DH9B 1I7AA 2X18A 2LKOA 2DHIA 4HB3B 2GCLA 2VRWB 2YSZA 2MKRA 4MY6A 4HAXB 4F7UP 2EJ8A 2YVCA 2G35A 5J3QA 1PFJA 3ODOA 5KCVA 2Z0OA 3ZVRA 1LB1A 2M38A 5C5BA 2Y8GA 1J0WA 1PMSA 2Q13A 3KRXA 2YRYA 1UEFA 2Y8FA 4Z2MB 1XCGA 2Y7BA 4IOYX 5DI9B 5FI1A 2D9WA 2GS0A 2NMBA 2CAYA 1FB8A 2RNRB 4EMOA 3V5WA 2CODA 2MFQA 2YS3A 2RSGA 4HAWB 3TO1A 2P0HA 2P8VA 5HE0A 4P7IA 1WGUA 5J3YA 4TKNA 1FGYA 1V5PA 4GXBA 3U7DA 5D27A 4KVGB 2I1KA 4EJNA 3A8PA 1DROA 5JLJB 4GPTB 1QC6A 1ZVRA 3X23A 2LYDA 1M7RA 4H8SA 4HAVB 5FI0A 3FEHA 1WJ1A 5D3XA 2LULA 5CLLB 4ZRIA 3KZ1A 3D8EA 4HATB 2GJYA 2DA0A 4EKUA 1Z87A 5EFXA 3O96A 3ULBA 4GZUA 3SYXA 2I1JA 5D3VA 4HB0B 1MIZB 1U5DA 2RLOA 3ML4A 3TFMA 1UPRA 2E2XA 2Z0PA 3P7ZA 1OQNA 3PG7A 3QIJA 1Q67A 3MPXA 1IRSA 3GYOA 1KZGA 2DLWA 4K2OA 3HK0A 2Z0QA 5LONB 2K2UA 2D4QA 4Z2NA 3PVUA 2JP2A 2R0DA 2DKPA 3WYFB 1V5MA 3RCPA 2LOZA 1U2BA 2DTCA 2N23A 3VOQA 2DYNA 2OTXA 3G9WA 2QKLA 2J59M 3MDBC 4A6FB 2XQNM 3SV1A 5C16A 1ZM0A 2P0DA 2J0JA 4GMXB 1WG7A 1J19A 2VSZA 4A6KA 5KQ4A 1WJMA 2DKQA 1M7EA 4NY0A 3TCAA 4HB2B 2R09A 2CRFA 5JP4A 5D3YA 2EMTA 3N7CA 2HE7A 2ELBA 4KAXB 2RVBB 2H7DA 1BTNA 1W1GA 1W1DA 2ROVA 3ODXA 1NU2A 1EF1A 2D9YA 3WA0A 2AEHA 1H10A 2L1CA 2W2XC 2VKIA 1P5TA 3TW1A 2LG1A 3KY9A 3CXBB 1X05A 4HAYB 3A8QA 2W2WA 5L81A 1XD4A 2LOXA 1XKEA 3ZDTA 1XR0B 5HE2A 1Y5OA 4WSFA 1TQZA 4KHAA 3QBVB 3CIKA 4K2PA 1U5FA 1FHOA 3DXDA 1AQCA 2D11A 2I5CA 4MK0A 2UVMA 4KHBB 4ZRJA 4Y94A 2KCJA 2DYQA 4F7HA 5HE1A 4D0NB 4DXAB 1PLSA 2DHJA 5JHGA 3BJIA 1X1FA 5LOPB 1ZSQA 3BINA 2ADZA 2ZPYA 3DXCA 2COCA 2I5FA 1NTYA 1QQGA 2P0FA 2MWNB 3FSSA 1V5UA 2K00A 3D8FA 2YS5A 2D2QA 3T06A 1OMWA 2FJLA 2EC1A 1U29A 2L2IA 3AU5A 1W1HA 1Y19B 3PP2A 2RGNB 4C0AA 2N0YA 1GC6A 1GG3A 3KSYA 1DDMA 3SUZA 1ISNA 2ROZB 4CHJA 1U27A 3OANA 2YT0A 1FGZA 2W2XD 2YT1A 5HE3A 5JHHA 1BAKA 1ZC4B 4TYZA 1XX0A 3KRWA 4MT7A 3QWMA 2YF0A 1UPQA 5GOWB 4DX90 3DXEA 1N3HA 4A6HA 1MAIA 1FHWA 3NSUA 3F0WA 1V61A 1AWEA 3HQCA 2D9ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ODW A;  1SHC A;  4GMV A;  3PSC A;  1LW3 A;  2V76 A;  4K17 A;  4YON A;  4HDO A;  2J0K A;  3UZT A;  2CY4 A;  2KGX B;  2J0M A;  1UNP A;  1KI1 B;  4IFS A;  1X86 A;  1GC7 A;  3PEG A;  1E5W A;  1EVH A;  4HAU B;  4WJ7 A;  5C6R A;  2DFK A;  1KZ7 A;  3AJ4 A;  4L6E A;  4A5K A;  2IFS A;  1K5G B;  3HW2 B;  1U5E A;  1RRP B;  2DN6 A;  1MK7 B;  1TJ6 A;  3PZD A;  2UZR A;  1WVH A;  1TXD A;  2K2J A;  2GCJ A;  1H4R A;  5J3T A;  4DBB A;  3FM8 C;  2D9V A;  4ZRK A;  1MKE A;  2RUK B;  1OY2 A;  2CY5 A;  1B55 A;  4F7G A;  3P6A A;  1BWN A;  3M1I B;  1WI1 A;  1UNQ A;  4K81 A;  1X11 A;  4A6F A;  3LJU X;  5D3W A;  1BTK A;  3SNH A;  1FOE A;  1MK9 B;  2DX5 A;  2KUP A;  2YS1 A;  4CYE A;  4XWX A;  2HTH B;  3SO6 A;  1V88 A;  1SGH A;  1DDW A;  2AL6 A;  1XOD A;  1V89 A;  2COF A;  4YL8 A;  2OQB A;  3U8Z A;  3TVV A;  3PVW A;  1NI2 A;  5KQ1 A;  2NZ8 B;  3D8D A;  1DDV A;  2COA A;  5DIF B;  2EMS A;  2MDX A;  3IVF A;  2DX1 A;  2QKM A;  3VIA A;  1I2H A;  4GN1 A;  1X1G A;  1DBH A;  4WVF B;  1EGX A;  2ELA A;  4PNK A;  2DHK A;  4CHM A;  1RJ2 A;  4KHO A;  1U5G A;  2UZS A;  2M14 A;  4DX8 A;  5DHA B;  3ULC A;  4HB4 B;  5C79 A;  2D9X A;  1NTV A;  2PZ1 A;  5C5B B;  1K5D B;  5CLQ B;  2H7E A;  1ZC3 B;  3A98 B;  2D10 A;  3F5R A;  4HHV A;  1DYN A;  1EAZ A;  1P6S A;  1MIX A;  3PVL A;  1P3R A;  5DHF B;  4BBK A;  1WGQ A;  1FAO A;  3AU4 A;  4PQ0 A;  4NSW A;  1UNR A;  1MPH A;  4HAZ B;  4HDQ A;  3GYP A;  4B6H A;  1FHX A;  2BCJ A;  4IAP A;  2IYB A;  5DH9 B;  1I7A A;  2X18 A;  2LKO A;  2DHI A;  4HB3 B;  2GCL A;  2VRW B;  2YSZ A;  2MKR A;  4MY6 A;  4HAX B;  4F7U P;  2EJ8 A;  2YVC A;  2G35 A;  5J3Q A;  1PFJ A;  3ODO A;  5KCV A;  2Z0O A;  3ZVR A;  1LB1 A;  2M38 A;  5C5B A;  2Y8G A;  1J0W A;  1PMS A;  2Q13 A;  3KRX A;  2YRY A;  1UEF A;  2Y8F A;  4Z2M B;  1XCG A;  2Y7B A;  4IOY X;  5DI9 B;  5FI1 A;  2D9W A;  2GS0 A;  2NMB A;  2CAY A;  1FB8 A;  2RNR B;  4EMO A;  3V5W A;  2COD A;  2MFQ A;  2YS3 A;  2RSG A;  4HAW B;  3TO1 A;  2P0H A;  2P8V A;  5HE0 A;  4P7I A;  1WGU A;  5J3Y A;  4TKN A;  1FGY A;  1V5P A;  4GXB A;  3U7D A;  5D27 A;  4KVG B;  2I1K A;  4EJN A;  3A8P A;  1DRO A;  5JLJ B;  4GPT B;  1QC6 A;  1ZVR A;  3X23 A;  2LYD A;  1M7R A;  4H8S A;  4HAV B;  5FI0 A;  3FEH A;  1WJ1 A;  5D3X A;  2LUL A;  5CLL B;  4ZRI A;  3KZ1 A;  3D8E A;  4HAT B;  2GJY A;  2DA0 A;  4EKU A;  1Z87 A;  5EFX A;  3O96 A;  3ULB A;  4GZU A;  3SYX A;  2I1J A;  5D3V A;  4HB0 B;  1MIZ B;  1U5D A;  2RLO A;  3ML4 A;  3TFM A;  1UPR A;  2E2X A;  2Z0P A;  3P7Z A;  1OQN A;  3PG7 A;  3QIJ A;  1Q67 A;  3MPX A;  1IRS A;  3GYO A;  1KZG A;  2DLW A;  4K2O A;  3HK0 A;  2Z0Q A;  5LON B;  2K2U A;  2D4Q A;  4Z2N A;  3PVU A;  2JP2 A;  2R0D A;  2DKP A;  3WYF B;  1V5M A;  3RCP A;  2LOZ A;  1U2B A;  2DTC A;  2N23 A;  3VOQ A;  2DYN A;  2OTX A;  3G9W A;  2QKL A;  2J59 M;  3MDB C;  4A6F B;  2XQN M;  3SV1 A;  5C16 A;  1ZM0 A;  2P0D A;  2J0J A;  4GMX B;  1WG7 A;  1J19 A;  2VSZ A;  4A6K A;  5KQ4 A;  1WJM A;  2DKQ A;  1M7E A;  4NY0 A;  3TCA A;  4HB2 B;  2R09 A;  2CRF A;  5JP4 A;  5D3Y A;  2EMT A;  3N7C A;  2HE7 A;  2ELB A;  4KAX B;  2RVB B;  2H7D A;  1BTN A;  1W1G A;  1W1D A;  2ROV A;  3ODX A;  1NU2 A;  1EF1 A;  2D9Y A;  3WA0 A;  2AEH A;  1H10 A;  2L1C A;  2W2X C;  2VKI A;  1P5T A;  3TW1 A;  2LG1 A;  3KY9 A;  3CXB B;  1X05 A;  4HAY B;  3A8Q A;  2W2W A;  5L81 A;  1XD4 A;  2LOX A;  1XKE A;  3ZDT A;  1XR0 B;  5HE2 A;  1Y5O A;  4WSF A;  1TQZ A;  4KHA A;  3QBV B;  3CIK A;  4K2P A;  1U5F A;  1FHO A;  3DXD A;  1AQC A;  2D11 A;  2I5C A;  4MK0 A;  2UVM A;  4KHB B;  4ZRJ A;  4Y94 A;  2KCJ A;  2DYQ A;  4F7H A;  5HE1 A;  4D0N B;  4DXA B;  1PLS A;  2DHJ A;  5JHG A;  3BJI A;  1X1F A;  5LOP B;  1ZSQ A;  3BIN A;  2ADZ A;  2ZPY A;  3DXC A;  2COC A;  2I5F A;  1NTY A;  1QQG A;  2P0F A;  2MWN B;  3FSS A;  1V5U A;  2K00 A;  3D8F A;  2YS5 A;  2D2Q A;  3T06 A;  1OMW A;  2FJL A;  2EC1 A;  1U29 A;  2L2I A;  3AU5 A;  1W1H A;  1Y19 B;  3PP2 A;  2RGN B;  4C0A A;  2N0Y A;  1GC6 A;  1GG3 A;  3KSY A;  1DDM A;  3SUZ A;  1ISN A;  2ROZ B;  4CHJ A;  1U27 A;  3OAN A;  2YT0 A;  1FGZ A;  2W2X D;  2YT1 A;  5HE3 A;  5JHH A;  1BAK A;  1ZC4 B;  4TYZ A;  1XX0 A;  3KRW A;  4MT7 A;  3QWM A;  2YF0 A;  1UPQ A;  5GOW B;  4DX9 0;  3DXE A;  1N3H A;  4A6H A;  1MAI A;  1FHW A;  3NSU A;  3F0W A;  1V61 A;  1AWE A;  3HQC A;  2D9Z A; 
#chains in the Genus database with same CATH topology
 4GNK B;  3ODW A;  1SHC A;  4GMV A;  3PSC A;  1LW3 A;  2V76 A;  4K17 A;  4YON A;  3OHM B;  4HDO A;  4QJ5 B;  2J0K A;  3UZT A;  5LG4 B;  2CY4 A;  2KGX B;  2J0M A;  1UNP A;  1KI1 B;  4IFS A;  1X86 A;  1GC7 A;  3PEG A;  1E5W A;  1EVH A;  4HAU B;  4WJ7 A;  5C6R A;  2DFK A;  1KZ7 A;  3AJ4 A;  4L6E A;  4A5K A;  2IFS A;  1K5G B;  3HW2 B;  1U5E A;  1RRP B;  2DN6 A;  1MK7 B;  1TJ6 A;  3PZD A;  2UZR A;  1WVH A;  1TXD A;  2K2J A;  2GCJ A;  1H4R A;  5J3T A;  4DBB A;  3FM8 C;  2D9V A;  4ZRK A;  1MKE A;  3HSA A;  2RUK B;  1OY2 A;  2CY5 A;  1B55 A;  4F7G A;  3P6A A;  1BWN A;  3M1I B;  2Z13 A;  1WI1 A;  1UNQ A;  2ZKM X;  4K81 A;  1X11 A;  4A6F A;  2R2Y A;  3LJU X;  1BTK A;  5D3W A;  3SNH A;  1FOE A;  1MK9 B;  2DX5 A;  2KUP A;  2YS1 A;  4CYE A;  4XWX A;  2YT2 A;  2HTH B;  5IRS A;  3SO6 A;  1V88 A;  2Z4D A;  1SGH A;  2GUM A;  1DDW A;  2AL6 A;  1XOD A;  1V89 A;  1ZYI A;  2COF A;  4YL8 A;  2OQB A;  3U8Z A;  3TVV A;  3PVW A;  1NI2 A;  5KQ1 A;  2NZ8 B;  3D8D A;  1DDV A;  2COA A;  5DIF B;  2EMS A;  2MDX A;  3IVF A;  2DX1 A;  2QKM A;  3VIA A;  1I2H A;  5I2S A;  1X1G A;  4GN1 A;  1DBH A;  4WVF B;  1EGX A;  2ELA A;  4PNK A;  5M4Y B;  2DHK A;  4CHM A;  1RJ2 A;  4KHO A;  1U5G A;  2UZS A;  2M14 A;  4DX8 A;  5DHA B;  3ULC A;  4HB4 B;  5C79 A;  3NWD A;  2D9X A;  4KHB A;  1NTV A;  2PZ1 A;  5C5B B;  1K5D B;  4DIX A;  5CLQ B;  2H7E A;  1ZC3 B;  3A98 B;  2D10 A;  3F5R A;  4HHV A;  4CSQ A;  1DYN A;  1EAZ A;  1P6S A;  1MIX A;  3PVL A;  1P3R A;  5DHF B;  4BBK A;  1WGQ A;  1FAO A;  3AU4 A;  4PQ0 A;  4NSW A;  1UNR A;  1MPH A;  4HAZ B;  4HDQ A;  3GYP A;  4B6H A;  1FHX A;  2BCJ A;  4IAP A;  2IYB A;  5DH9 B;  1I7A A;  2X18 A;  2LKO A;  2DHI A;  4HB3 B;  2GCL A;  2VRW B;  2YSZ A;  2MKR A;  4QJ3 B;  4MY6 A;  4HAX B;  4F7U P;  2EJ8 A;  2YVC A;  2G35 A;  5J3Q A;  1PFJ A;  3ODO A;  5KCV A;  2Z0O A;  3ZVR A;  1LB1 A;  2M38 A;  5C5B A;  2Y8G A;  1J0W A;  1PMS A;  2Q13 A;  3KRX A;  2YRY A;  1UEF A;  2Y8F A;  4Z2M B;  1XCG A;  2Y7B A;  4IOY X;  5DI9 B;  5FI1 A;  2D9W A;  2GS0 A;  2NMB A;  4OSN A;  2CAY A;  1FB8 A;  2RNR B;  4EMO A;  4QJ4 B;  3V5W A;  2COD A;  2MFQ A;  2YS3 A;  2RSG A;  4HAW B;  3TO1 A;  2P0H A;  2P8V A;  5HE0 A;  4P7I A;  1WGU A;  5J3Y A;  4TKN A;  1FGY A;  1V5P A;  4GXB A;  3U7D A;  5D27 A;  4KVG B;  2I1K A;  4EJN A;  3A8P A;  1DRO A;  5JLJ B;  4GPT B;  2Z59 A;  1QC6 A;  1ZVR A;  3X23 A;  2LYD A;  1M7R A;  4H8S A;  4HAV B;  5FI0 A;  3FEH A;  3B77 A;  1WJ1 A;  3NW8 A;  5D3X A;  2LUL A;  5CLL B;  4ZRI A;  1T77 A;  3KZ1 A;  3D8E A;  4HAT B;  2GJY A;  2DA0 A;  2KIE A;  4EKU A;  1Z87 A;  5EFX A;  3O96 A;  3ULB A;  2KUQ A;  4GZU A;  3SYX A;  2I1J A;  5D3V A;  4HB0 B;  1MIZ B;  1U5D A;  2RLO A;  3ML4 A;  3TFM A;  1UPR A;  2E2X A;  2Z0P A;  3P7Z A;  1OQN A;  3PG7 A;  3QIJ A;  1Q67 A;  3MPX A;  1IRS A;  3GYO A;  1KZG A;  2DLW A;  4K2O A;  3HK0 A;  2Z0Q A;  5LON B;  2K2U A;  2D4Q A;  3FVC A;  4Z2N A;  3PVU A;  2KIG A;  2JP2 A;  2R0D A;  2DKP A;  3WYF B;  1V5M A;  3RCP A;  2LOZ A;  1U2B A;  2DTC A;  2N23 A;  2RRF A;  3VOQ A;  2DYN A;  2OTX A;  3G9W A;  2QKL A;  2J59 M;  3MDB C;  4A6F B;  2XQN M;  3SV1 A;  4HSI A;  5C16 A;  1ZM0 A;  2P0D A;  2J0J A;  4GMX B;  1WG7 A;  1J19 A;  2VSZ A;  4L1R A;  4A6K A;  5KQ4 A;  4D6W A;  1WJM A;  2DKQ A;  1M7E A;  2K49 A;  4NY0 A;  3U12 A;  3TCA A;  4HB2 B;  2R09 A;  2CRF A;  5JP4 A;  5D3Y A;  2EMT A;  3N7C A;  2HE7 A;  2ELB A;  4KAX B;  2RVB B;  2H7D A;  1BTN A;  1W1G A;  1W1D A;  2ROV A;  4GOU A;  3ODX A;  1NU2 A;  1EF1 A;  2D9Y A;  3WA0 A;  2AEH A;  2Z14 A;  1H10 A;  2L1C A;  2W2X C;  3NWA A;  2VKI A;  1P5T A;  3TW1 A;  2LG1 A;  3KY9 A;  3DCX A;  3CXB B;  1X05 A;  4HAY B;  3A8Q A;  2W2W A;  5L81 A;  1XD4 A;  2LOX A;  3A58 A;  1XKE A;  3ZDT A;  1XR0 B;  5HE2 A;  1Y5O A;  2FJU B;  4WSF A;  1TQZ A;  4KHA A;  3QBV B;  3CIK A;  4K2P A;  1U5F A;  1FHO A;  1MI1 A;  3DXD A;  1AQC A;  2D11 A;  2I5C A;  5I2M A;  4MK0 A;  3NWF A;  2UVM A;  4KHB B;  4ZRJ A;  4Y94 A;  2KCJ A;  4QXA B;  2DYQ A;  4F7H A;  5HE1 A;  4D0N B;  4DXA B;  1PLS A;  2DHJ A;  5JHG A;  3BJI A;  1X1F A;  5LOP B;  1ZSQ A;  3BIN A;  2ADZ A;  2ZPY A;  3DXC A;  3HIE A;  2COC A;  2I5F A;  4OT1 A;  1NTY A;  1QQG A;  2K8E A;  2P0F A;  2MWN B;  3FSS A;  1V5U A;  2K00 A;  3D8F A;  2YS5 A;  2D2Q A;  3T06 A;  1OMW A;  2FJL A;  2EC1 A;  1U29 A;  2L2I A;  3AU5 A;  1W1H A;  1Y19 B;  3PP2 A;  2RGN B;  4C0A A;  2N0Y A;  1GC6 A;  1GG3 A;  3KSY A;  1DDM A;  2NBV A;  3SUZ A;  1ISN A;  2ROZ B;  4CHJ A;  1U27 A;  3OAN A;  2YT0 A;  1FGZ A;  2W2X D;  2YT1 A;  5HE3 A;  5JHH A;  1BAK A;  1ZC4 B;  4TYZ A;  1XX0 A;  3KRW A;  2KR0 A;  4MT7 A;  3QWM A;  2YF0 A;  1UPQ A;  5GOW B;  4DX9 0;  3DXE A;  1N3H A;  4A6H A;  1MAI A;  1FHW A;  3NSU A;  3F0W A;  1V61 A;  1AWE A;  3HQC A;  2D9Z A; 
#chains in the Genus database with same CATH homology
 3ODW A;  1SHC A;  4GMV A;  3PSC A;  1LW3 A;  2V76 A;  4K17 A;  4YON A;  4HDO A;  2J0K A;  3UZT A;  2CY4 A;  2KGX B;  2J0M A;  1UNP A;  1KI1 B;  4IFS A;  1X86 A;  1GC7 A;  3PEG A;  1E5W A;  1EVH A;  4HAU B;  4WJ7 A;  5C6R A;  2DFK A;  1KZ7 A;  3AJ4 A;  4L6E A;  4A5K A;  2IFS A;  1K5G B;  3HW2 B;  1U5E A;  1RRP B;  2DN6 A;  1MK7 B;  1TJ6 A;  3PZD A;  2UZR A;  1WVH A;  1TXD A;  2K2J A;  2GCJ A;  1H4R A;  5J3T A;  4DBB A;  3FM8 C;  2D9V A;  4ZRK A;  1MKE A;  2RUK B;  1OY2 A;  2CY5 A;  1B55 A;  4F7G A;  3P6A A;  1BWN A;  3M1I B;  1WI1 A;  1UNQ A;  4K81 A;  1X11 A;  4A6F A;  3LJU X;  5D3W A;  1BTK A;  3SNH A;  1FOE A;  1MK9 B;  2DX5 A;  2KUP A;  2YS1 A;  4CYE A;  4XWX A;  2HTH B;  3SO6 A;  1V88 A;  1SGH A;  1DDW A;  2AL6 A;  1XOD A;  1V89 A;  2COF A;  4YL8 A;  2OQB A;  3U8Z A;  3TVV A;  3PVW A;  1NI2 A;  5KQ1 A;  2NZ8 B;  3D8D A;  1DDV A;  2COA A;  5DIF B;  2EMS A;  2MDX A;  3IVF A;  2DX1 A;  2QKM A;  3VIA A;  1I2H A;  4GN1 A;  1X1G A;  1DBH A;  4WVF B;  1EGX A;  2ELA A;  4PNK A;  2DHK A;  4CHM A;  1RJ2 A;  4KHO A;  1U5G A;  2UZS A;  2M14 A;  4DX8 A;  5DHA B;  3ULC A;  4HB4 B;  5C79 A;  2D9X A;  1NTV A;  2PZ1 A;  5C5B B;  1K5D B;  5CLQ B;  2H7E A;  1ZC3 B;  3A98 B;  2D10 A;  3F5R A;  4HHV A;  1DYN A;  1EAZ A;  1P6S A;  1MIX A;  3PVL A;  1P3R A;  5DHF B;  4BBK A;  1WGQ A;  1FAO A;  3AU4 A;  4PQ0 A;  4NSW A;  1UNR A;  1MPH A;  4HAZ B;  4HDQ A;  3GYP A;  4B6H A;  1FHX A;  2BCJ A;  4IAP A;  2IYB A;  5DH9 B;  1I7A A;  2X18 A;  2LKO A;  2DHI A;  4HB3 B;  2GCL A;  2VRW B;  2YSZ A;  2MKR A;  4MY6 A;  4HAX B;  4F7U P;  2EJ8 A;  2YVC A;  2G35 A;  5J3Q A;  1PFJ A;  3ODO A;  5KCV A;  2Z0O A;  3ZVR A;  1LB1 A;  2M38 A;  5C5B A;  2Y8G A;  1J0W A;  1PMS A;  2Q13 A;  3KRX A;  2YRY A;  1UEF A;  2Y8F A;  4Z2M B;  1XCG A;  2Y7B A;  4IOY X;  5DI9 B;  5FI1 A;  2D9W A;  2GS0 A;  2NMB A;  2CAY A;  1FB8 A;  2RNR B;  4EMO A;  3V5W A;  2COD A;  2MFQ A;  2YS3 A;  2RSG A;  4HAW B;  3TO1 A;  2P0H A;  2P8V A;  5HE0 A;  4P7I A;  1WGU A;  5J3Y A;  4TKN A;  1FGY A;  1V5P A;  4GXB A;  3U7D A;  5D27 A;  4KVG B;  2I1K A;  4EJN A;  3A8P A;  1DRO A;  5JLJ B;  4GPT B;  1QC6 A;  1ZVR A;  3X23 A;  2LYD A;  1M7R A;  4H8S A;  4HAV B;  5FI0 A;  3FEH A;  1WJ1 A;  5D3X A;  2LUL A;  5CLL B;  4ZRI A;  3KZ1 A;  3D8E A;  4HAT B;  2GJY A;  2DA0 A;  4EKU A;  1Z87 A;  5EFX A;  3O96 A;  3ULB A;  4GZU A;  3SYX A;  2I1J A;  5D3V A;  4HB0 B;  1MIZ B;  1U5D A;  2RLO A;  3ML4 A;  3TFM A;  1UPR A;  2E2X A;  2Z0P A;  3P7Z A;  1OQN A;  3PG7 A;  3QIJ A;  1Q67 A;  3MPX A;  1IRS A;  3GYO A;  1KZG A;  2DLW A;  4K2O A;  3HK0 A;  2Z0Q A;  5LON B;  2K2U A;  2D4Q A;  4Z2N A;  3PVU A;  2JP2 A;  2R0D A;  2DKP A;  3WYF B;  1V5M A;  3RCP A;  2LOZ A;  1U2B A;  2DTC A;  2N23 A;  3VOQ A;  2DYN A;  2OTX A;  3G9W A;  2QKL A;  2J59 M;  3MDB C;  4A6F B;  2XQN M;  3SV1 A;  5C16 A;  1ZM0 A;  2P0D A;  2J0J A;  4GMX B;  1WG7 A;  1J19 A;  2VSZ A;  4A6K A;  5KQ4 A;  1WJM A;  2DKQ A;  1M7E A;  4NY0 A;  3TCA A;  4HB2 B;  2R09 A;  2CRF A;  5JP4 A;  5D3Y A;  2EMT A;  3N7C A;  2HE7 A;  2ELB A;  4KAX B;  2RVB B;  2H7D A;  1BTN A;  1W1G A;  1W1D A;  2ROV A;  3ODX A;  1NU2 A;  1EF1 A;  2D9Y A;  3WA0 A;  2AEH A;  1H10 A;  2L1C A;  2W2X C;  2VKI A;  1P5T A;  3TW1 A;  2LG1 A;  3KY9 A;  3CXB B;  1X05 A;  4HAY B;  3A8Q A;  2W2W A;  5L81 A;  1XD4 A;  2LOX A;  1XKE A;  3ZDT A;  1XR0 B;  5HE2 A;  1Y5O A;  4WSF A;  1TQZ A;  4KHA A;  3QBV B;  3CIK A;  4K2P A;  1U5F A;  1FHO A;  3DXD A;  1AQC A;  2D11 A;  2I5C A;  4MK0 A;  2UVM A;  4KHB B;  4ZRJ A;  4Y94 A;  2KCJ A;  2DYQ A;  4F7H A;  5HE1 A;  4D0N B;  4DXA B;  1PLS A;  2DHJ A;  5JHG A;  3BJI A;  1X1F A;  5LOP B;  1ZSQ A;  3BIN A;  2ADZ A;  2ZPY A;  3DXC A;  2COC A;  2I5F A;  1NTY A;  1QQG A;  2P0F A;  2MWN B;  3FSS A;  1V5U A;  2K00 A;  3D8F A;  2YS5 A;  2D2Q A;  3T06 A;  1OMW A;  2FJL A;  2EC1 A;  1U29 A;  2L2I A;  3AU5 A;  1W1H A;  1Y19 B;  3PP2 A;  2RGN B;  4C0A A;  2N0Y A;  1GC6 A;  1GG3 A;  3KSY A;  1DDM A;  3SUZ A;  1ISN A;  2ROZ B;  4CHJ A;  1U27 A;  3OAN A;  2YT0 A;  1FGZ A;  2W2X D;  2YT1 A;  5HE3 A;  5JHH A;  1BAK A;  1ZC4 B;  4TYZ A;  1XX0 A;  3KRW A;  4MT7 A;  3QWM A;  2YF0 A;  1UPQ A;  5GOW B;  4DX9 0;  3DXE A;  1N3H A;  4A6H A;  1MAI A;  1FHW A;  3NSU A;  3F0W A;  1V61 A;  1AWE A;  3HQC A;  2D9Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...