1V89A

Solution structure of the pleckstrin homology domain of human kiaa0053 protein
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
118
structure length
118
Chain Sequence
b'GSSGSSGPIKMGWLKKQRSIVKNWQQRYFVLRAQQLYYYKDEEDTKPQGCMYLPGCTIKEIATNPEEAGKFVFEIIPASWDQNRMGQDSYVLMASSQAEMEEWVKFLRRVAGSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein KIAA0053
publication title Solution Structure of the Pleckstrin Homology Domain of Human KIAA0053 Protein
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 13
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2003-12-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1v89A00
4HB4B 3WYFB 2LOZA 2D9YA 5HE2A 1X11A 2P0FA 3ULCA 1RJ2A 2Y7BA 4F7HA 4HATB 3FSSA 2I5FA 4ZRKA 2Z0QA 3V5WA 1KZGA 2COFA 3DXEA 2YS5A 1TXDA 4IAPA 2UZSA 4HB2B 5J3YA 2KUPA 1MIZB 1M7RA 1I2HA 3PP2A 4MY6A 4DBBA 3ODOA 2CY4A 2P0DA 4A5KA 2MKRA 5DIFB 4A6FA 5HE1A 2RSGA 3MDBC 4GMXB 4L6EA 4PQ0A 5CLQB 5GOWB 2ZPYA 4HB3B 2ADZA 2IYBA 4KHAA 2CY5A 3PZDA 1DROA 1M7EA 2YT1A 5KQ4A 1ZC3B 4H8SA 5D3VA 3TVVA 1I7AA 2LULA 1Q67A 3PEGA 4NSWA 3QIJA 4HAVB 3RCPA 1N3HA 3NSUA 4TYZA 1J19A 2Y8GA 2UVMA 2LKOA 2COCA 2GCJA 1FAOA 4YONA 1H10A 1Y19B 2RVBB 2W2WA 2EMSA 1DBHA 1MPHA 1XCGA 2RUKB 3F5RA 1WG7A 1Z87A 3KSYA 1WVHA 3ULBA 1UEFA 3LJUX 3BINA 2K00A 1EGXA 1BTKA 1XKEA 4GXBA 1V5UA 2KCJA 3F0WA 1RRPB 1NTVA 2P8VA 1BAKA 2N0YA 1FHWA 2E2XA 1UNPA 3ODXA 1X86A 4KHOA 3QWMA 3ML4A 3PVLA 2D4QA 2VKIA 3SYXA 4DX90 2RLOA 3P7ZA 4K2PA 2FJLA 4GN1A 3G9WA 1OQNA 5JP4A 5EFXA 2DYNA 1DDMA 3UZTA 4GZUA 5C79A 2EJ8A 2IFSA 3HK0A 1K5GB 4ZRIA 2H7DA 2PZ1A 1WI1A 5KCVA 3CXBB 4HAYB 4A6FB 1PLSA 5KQ1A 2DHKA 2AL6A 2D2QA 3O96A 3D8EA 1PFJA 2DFKA 5DI9B 1U5GA 4CHJA 1W1DA 1H4RA 1NI2A 2CODA 1MK9B 3VOQA 2COAA 3FEHA 1U2BA 3T06A 4P7IA 3PVWA 5DHFB 1P3RA 2YF0A 4D0NB 1MK7B 2K2UA 2DLWA 3X23A 2D10A 4GPTB 1UPRA 4C0AA 1FOEA 1NU2A 2DX5A 2QKLA 1J0WA 2MDXA 2UZRA 1ZVRA 3D8DA 3PG7A 4HAWB 4EKUA 2ROZB 5D3XA 2ELBA 2R0DA 5CLLB 3ODWA 2DKQA 1X1GA 5FI0A 1EAZA 2YS3A 4KHBB 5LONB 1TJ6A 4K17A 1WGQA 4XWXA 5J3TA 3FM8C 1P5TA 2LG1A 1DYNA 1SGHA 3TFMA 2MFQA 2W2XD 3VIAA 3ZDTA 2GJYA 4DX8A 2OQBA 3GYPA 2RGNB 1ZC4B 3KRXA 2VRWB 4IFSA 1V5MA 2XQNM 3N7CA 3WA0A 2Q13A 3MPXA 3U7DA 4F7GA 1FGYA 5LOPB 1P6SA 2LOXA 2DYQA 1PMSA 2L1CA 1FHOA 1W1GA 1WGUA 5L81A 1Y5OA 4EMOA 1EVHA 2L2IA 4GMVA 2DX1A 2I1KA 5DH9B 1DDVA 1X1FA 1OY2A 1WJMA 2BCJA 1FHXA 2OTXA 3PSCA 1LW3A 3M1IB 4MT7A 1GC6A 4BBKA 1U29A 2LYDA 4IOYX 1DDWA 1X05A 2CAYA 3AJ4A 5JLJB 1U5FA 5J3QA 3GYOA 3DXCA 2D11A 5C6RA 2AEHA 2N23A 1ISNA 3TO1A 3CIKA 1MIXA 2GS0A 4B6HA 2HTHB 2R09A 2YSZA 2DHIA 1QC6A 3HW2B 2YT0A 4KAXB 1BTNA 4PNKA 5JHHA 1V61A 1AWEA 2KGXB 2QKMA 2W2XC 1XR0B 1MKEA 4ZRJA 2V76A 2NZ8B 1QQGA 3DXDA 4HAXB 4Y94A 4KVGB 4A6HA 2EC1A 2VSZA 2YS1A 1U5DA 2P0HA 2J59M 1UPQA 1BWNA 3HQCA 5FI1A 1V88A 1UNQA 3D8FA 4HB0B 4HDQA 4MK0A 5D3YA 4K81A 4WVFB 2G35A 1V89A 5C5BB 3U8ZA 2K2JA 5D27A 3PVUA 4WJ7A 1U5EA 1FB8A 2Z0OA 2DA0A 4K2OA 1EF1A 2DHJA 2YVCA 1SHCA 3IVFA 1TQZA 1KZ7A 4NY0A 3SO6A 5HE3A 4HDOA 5C16A 2Z0PA 3TCAA 1LB1A 4F7UP 2H7EA 2J0KA 3QBVB 2J0MA 2J0JA 1AQCA 1K5DB 2D9WA 4HHVA 3AU5A 5DHAB 4EJNA 2GCLA 1WJ1A 1XD4A 2RNRB 4Z2MB 3A8PA 5C5BA 1V5PA 1KI1B 3SNHA 2HE7A 2M14A 5D3WA 5JHGA 3KRWA 4HAZB 3P6AA 2ELAA 2DKPA 3AU4A 2D9XA 2YRYA 3KY9A 2Y8FA 3A98B 2I1JA 1W1HA 2DN6A 2ROVA 3SUZA 1FGZA 2EMTA 3TW1A 4CHMA 3OANA 4A6KA 1UNRA 1NTYA 4DXAB 1XODA 1ZSQA 4CYEA 1U27A 2NMBA 4YL8A 5HE0A 2D9ZA 1XX0A 4WSFA 1GG3A 2I5CA 1OMWA 2M38A 2JP2A 4Z2NA 2MWNB 4HAUB 3SV1A 2D9VA 1B55A 1MAIA 1IRSA 3A8QA 4TKNA 2X18A 2DTCA 1E5WA 1GC7A 3BJIA 3KZ1A 3ZVRA 1ZM0A 2CRFA
chains in the Genus database with same CATH superfamily
4HB4B 3WYFB 2LOZA 2D9YA 3DCXA 5HE2A 1X11A 2KR0A 2P0FA 3ULCA 1RJ2A 2Y7BA 2KIGA 4F7HA 4HATB 3FSSA 2I5FA 2R2YA 4ZRKA 2Z0QA 3V5WA 1KZGA 2COFA 3DXEA 2YS5A 1TXDA 4IAPA 3U12A 2UZSA 4HB2B 5J3YA 2ZKMX 2KUPA 1MIZB 4GNKB 1M7RA 1I2HA 3PP2A 4MY6A 4DBBA 3ODOA 2CY4A 2P0DA 4A5KA 4CSQA 2MKRA 5DIFB 4A6FA 5HE1A 2RSGA 3MDBC 4GMXB 4L6EA 4PQ0A 3NWAA 5CLQB 3OHMB 5GOWB 2ZPYA 4HB3B 2ADZA 2IYBA 4KHAA 2CY5A 3PZDA 1DROA 1M7EA 2YT1A 5KQ4A 1ZC3B 4H8SA 5D3VA 3TVVA 1I7AA 2LULA 1Q67A 3PEGA 4NSWA 3QIJA 4HAVB 3RCPA 1N3HA 3NSUA 4TYZA 1J19A 2Y8GA 2UVMA 2LKOA 2COCA 2GCJA 1FAOA 4YONA 1H10A 1Y19B 2RVBB 2W2WA 4L1RA 2EMSA 1DBHA 1MPHA 2Z59A 1XCGA 2RUKB 3F5RA 5I2SA 1WG7A 1Z87A 3KSYA 1WVHA 3ULBA 1UEFA 3LJUX 3BINA 2K00A 1EGXA 1BTKA 1XKEA 3A58A 4GXBA 2KIEA 1V5UA 2KCJA 3F0WA 1RRPB 1NTVA 2P8VA 1BAKA 4QJ4B 2N0YA 1FHWA 2E2XA 1UNPA 3ODXA 1X86A 4KHOA 3QWMA 3NW8A 3ML4A 3PVLA 2D4QA 2VKIA 3SYXA 4GOUA 4DX90 2RLOA 3P7ZA 4K2PA 2FJLA 4GN1A 3NWFA 3G9WA 2NBVA 1OQNA 5JP4A 5EFXA 2DYNA 1DDMA 3UZTA 4GZUA 5C79A 2EJ8A 2IFSA 3HK0A 1K5GB 4ZRIA 2H7DA 2PZ1A 1WI1A 5KCVA 3CXBB 4HAYB 4A6FB 1PLSA 5KQ1A 2DHKA 2AL6A 2D2QA 3O96A 3D8EA 1PFJA 2DFKA 5DI9B 1U5GA 4CHJA 1W1DA 1H4RA 1NI2A 2CODA 1MK9B 3VOQA 2COAA 3FEHA 1U2BA 2Z14A 3T06A 4P7IA 3PVWA 5DHFB 1P3RA 2YF0A 4D0NB 1MK7B 2K2UA 2DLWA 3X23A 2D10A 4GPTB 1UPRA 1T77A 4C0AA 1FOEA 1NU2A 2DX5A 2QKLA 2UZRA 1J0WA 2MDXA 1ZVRA 1MI1A 3D8DA 3PG7A 4HAWB 4EKUA 2ROZB 5D3XA 2ELBA 2R0DA 5CLLB 3ODWA 2DKQA 1X1GA 5FI0A 1EAZA 2YS3A 4KHBB 5LONB 1TJ6A 4K17A 1WGQA 4XWXA 5J3TA 3FM8C 2FJUB 1P5TA 2LG1A 1DYNA 1SGHA 3TFMA 2MFQA 2W2XD 4OT1A 3VIAA 3ZDTA 2GJYA 4DX8A 2OQBA 3GYPA 2RGNB 1ZC4B 3KRXA 2VRWB 4IFSA 1V5MA 2XQNM 3N7CA 3WA0A 2Q13A 3MPXA 3U7DA 4F7GA 1FGYA 3HSAA 5LOPB 1P6SA 2LOXA 2DYQA 1PMSA 2L1CA 1FHOA 4DIXA 2KUQA 1W1GA 1WGUA 5L81A 2Z13A 1Y5OA 4KHBA 4EMOA 1EVHA 2L2IA 4GMVA 2DX1A 2I1KA 2Z4DA 5DH9B 1DDVA 1X1FA 1OY2A 1WJMA 2BCJA 1FHXA 2OTXA 3PSCA 5IRSA 4QJ3B 1LW3A 3M1IB 4MT7A 1GC6A 2RRFA 4BBKA 1U29A 2GUMA 2LYDA 4IOYX 1DDWA 1X05A 2CAYA 3AJ4A 5JLJB 1U5FA 5J3QA 3GYOA 3DXCA 2D11A 5C6RA 2AEHA 2N23A 1ISNA 3TO1A 3CIKA 1MIXA 2GS0A 4B6HA 2K49A 2HTHB 2R09A 2YSZA 2DHIA 1QC6A 3HW2B 2YT0A 4KAXB 1BTNA 4PNKA 5JHHA 1V61A 3FVCA 1AWEA 2KGXB 2QKMA 2W2XC 1XR0B 1MKEA 2YT2A 4ZRJA 2V76A 2NZ8B 1QQGA 3DXDA 4HAXB 4Y94A 4OSNA 4KVGB 4A6HA 2EC1A 2K8EA 2VSZA 2YS1A 1U5DA 2P0HA 2J59M 1UPQA 1BWNA 3HQCA 5FI1A 1V88A 1UNQA 3D8FA 4HB0B 4HDQA 4MK0A 4D6WA 5D3YA 4K81A 4WVFB 2G35A 1V89A 5C5BB 3U8ZA 2K2JA 5D27A 3PVUA 4WJ7A 1U5EA 1FB8A 2Z0OA 2DA0A 4K2OA 1EF1A 2DHJA 2YVCA 1SHCA 3IVFA 4HSIA 1TQZA 1KZ7A 4NY0A 3SO6A 5HE3A 4HDOA 5C16A 2Z0PA 3TCAA 1LB1A 4QJ5B 4F7UP 2H7EA 2J0KA 3QBVB 2J0MA 2J0JA 1AQCA 1K5DB 2D9WA 4HHVA 3AU5A 5DHAB 4EJNA 2GCLA 1WJ1A 1XD4A 2RNRB 4Z2MB 3B77A 3A8PA 5C5BA 1V5PA 3NWDA 1KI1B 3SNHA 2HE7A 2M14A 5D3WA 5JHGA 3KRWA 4HAZB 3P6AA 2ELAA 2DKPA 3AU4A 2D9XA 2YRYA 3KY9A 2Y8FA 3HIEA 3A98B 2I1JA 1W1HA 2DN6A 2ROVA 3SUZA 1FGZA 2EMTA 3TW1A 4CHMA 3OANA 4A6KA 1UNRA 5I2MA 1NTYA 4DXAB 1XODA 1ZSQA 4CYEA 1U27A 2NMBA 4YL8A 5HE0A 2D9ZA 5M4YB 1XX0A 4WSFA 1GG3A 2I5CA 1OMWA 2M38A 4QXAB 2JP2A 4Z2NA 2MWNB 4HAUB 3SV1A 2D9VA 1B55A 1MAIA 1IRSA 3A8QA 4TKNA 2X18A 2DTCA 1E5WA 1GC7A 3BJIA 3KZ1A 3ZVRA 1ZYIA 5LG4B 1ZM0A 2CRFA
chains in the Genus database with same CATH topology
4HB4B 3WYFB 2LOZA 2D9YA 5HE2A 1X11A 2P0FA 3ULCA 1RJ2A 2Y7BA 4F7HA 4HATB 3FSSA 2I5FA 4ZRKA 2Z0QA 3V5WA 1KZGA 2COFA 3DXEA 2YS5A 1TXDA 4IAPA 2UZSA 4HB2B 5J3YA 2KUPA 1MIZB 1M7RA 1I2HA 3PP2A 4MY6A 4DBBA 3ODOA 2CY4A 2P0DA 4A5KA 2MKRA 5DIFB 4A6FA 5HE1A 2RSGA 3MDBC 4GMXB 4L6EA 4PQ0A 5CLQB 5GOWB 2ZPYA 4HB3B 2ADZA 2IYBA 4KHAA 2CY5A 3PZDA 1DROA 1M7EA 2YT1A 5KQ4A 1ZC3B 4H8SA 5D3VA 3TVVA 1I7AA 2LULA 1Q67A 3PEGA 4NSWA 3QIJA 4HAVB 3RCPA 1N3HA 3NSUA 4TYZA 1J19A 2Y8GA 2UVMA 2LKOA 2COCA 2GCJA 1FAOA 4YONA 1H10A 1Y19B 2RVBB 2W2WA 2EMSA 1DBHA 1MPHA 1XCGA 2RUKB 3F5RA 1WG7A 1Z87A 3KSYA 1WVHA 3ULBA 1UEFA 3LJUX 3BINA 2K00A 1EGXA 1BTKA 1XKEA 4GXBA 1V5UA 2KCJA 3F0WA 1RRPB 1NTVA 2P8VA 1BAKA 2N0YA 1FHWA 2E2XA 1UNPA 3ODXA 1X86A 4KHOA 3QWMA 3ML4A 3PVLA 2D4QA 2VKIA 3SYXA 4DX90 2RLOA 3P7ZA 4K2PA 2FJLA 4GN1A 3G9WA 1OQNA 5JP4A 5EFXA 2DYNA 1DDMA 3UZTA 4GZUA 5C79A 2EJ8A 2IFSA 3HK0A 1K5GB 4ZRIA 2H7DA 2PZ1A 1WI1A 5KCVA 3CXBB 4HAYB 4A6FB 1PLSA 5KQ1A 2DHKA 2AL6A 2D2QA 3O96A 3D8EA 1PFJA 2DFKA 5DI9B 1U5GA 4CHJA 1W1DA 1H4RA 1NI2A 2CODA 1MK9B 3VOQA 2COAA 3FEHA 1U2BA 3T06A 4P7IA 3PVWA 5DHFB 1P3RA 2YF0A 4D0NB 1MK7B 2K2UA 2DLWA 3X23A 2D10A 4GPTB 1UPRA 4C0AA 1FOEA 1NU2A 2DX5A 2QKLA 1J0WA 2MDXA 2UZRA 1ZVRA 3D8DA 3PG7A 4HAWB 4EKUA 2ROZB 5D3XA 2ELBA 2R0DA 5CLLB 3ODWA 2DKQA 1X1GA 5FI0A 1EAZA 2YS3A 4KHBB 5LONB 1TJ6A 4K17A 1WGQA 4XWXA 5J3TA 3FM8C 1P5TA 2LG1A 1DYNA 1SGHA 3TFMA 2MFQA 2W2XD 3VIAA 3ZDTA 2GJYA 4DX8A 2OQBA 3GYPA 2RGNB 1ZC4B 3KRXA 2VRWB 4IFSA 1V5MA 2XQNM 3N7CA 3WA0A 2Q13A 3MPXA 3U7DA 4F7GA 1FGYA 5LOPB 1P6SA 2LOXA 2DYQA 1PMSA 2L1CA 1FHOA 1W1GA 1WGUA 5L81A 1Y5OA 4EMOA 1EVHA 2L2IA 4GMVA 2DX1A 2I1KA 5DH9B 1DDVA 1X1FA 1OY2A 1WJMA 2BCJA 1FHXA 2OTXA 3PSCA 1LW3A 3M1IB 4MT7A 1GC6A 4BBKA 1U29A 2LYDA 4IOYX 1DDWA 1X05A 2CAYA 3AJ4A 5JLJB 1U5FA 5J3QA 3GYOA 3DXCA 2D11A 5C6RA 2AEHA 2N23A 1ISNA 3TO1A 3CIKA 1MIXA 2GS0A 4B6HA 2HTHB 2R09A 2YSZA 2DHIA 1QC6A 3HW2B 2YT0A 4KAXB 1BTNA 4PNKA 5JHHA 1V61A 1AWEA 2KGXB 2QKMA 2W2XC 1XR0B 1MKEA 4ZRJA 2V76A 2NZ8B 1QQGA 3DXDA 4HAXB 4Y94A 4KVGB 4A6HA 2EC1A 2VSZA 2YS1A 1U5DA 2P0HA 2J59M 1UPQA 1BWNA 3HQCA 5FI1A 1V88A 1UNQA 3D8FA 4HB0B 4HDQA 4MK0A 5D3YA 4K81A 4WVFB 2G35A 1V89A 5C5BB 3U8ZA 2K2JA 5D27A 3PVUA 4WJ7A 1U5EA 1FB8A 2Z0OA 2DA0A 4K2OA 1EF1A 2DHJA 2YVCA 1SHCA 3IVFA 1TQZA 1KZ7A 4NY0A 3SO6A 5HE3A 4HDOA 5C16A 2Z0PA 3TCAA 1LB1A 4F7UP 2H7EA 2J0KA 3QBVB 2J0MA 2J0JA 1AQCA 1K5DB 2D9WA 4HHVA 3AU5A 5DHAB 4EJNA 2GCLA 1WJ1A 1XD4A 2RNRB 4Z2MB 3A8PA 5C5BA 1V5PA 1KI1B 3SNHA 2HE7A 2M14A 5D3WA 5JHGA 3KRWA 4HAZB 3P6AA 2ELAA 2DKPA 3AU4A 2D9XA 2YRYA 3KY9A 2Y8FA 3A98B 2I1JA 1W1HA 2DN6A 2ROVA 3SUZA 1FGZA 2EMTA 3TW1A 4CHMA 3OANA 4A6KA 1UNRA 1NTYA 4DXAB 1XODA 1ZSQA 4CYEA 1U27A 2NMBA 4YL8A 5HE0A 2D9ZA 1XX0A 4WSFA 1GG3A 2I5CA 1OMWA 2M38A 2JP2A 4Z2NA 2MWNB 4HAUB 3SV1A 2D9VA 1B55A 1MAIA 1IRSA 3A8QA 4TKNA 2X18A 2DTCA 1E5WA 1GC7A 3BJIA 3KZ1A 3ZVRA 1ZM0A 2CRFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HB4 B;  3WYF B;  2LOZ A;  2D9Y A;  5HE2 A;  1X11 A;  2P0F A;  3ULC A;  1RJ2 A;  2Y7B A;  4F7H A;  4HAT B;  3FSS A;  2I5F A;  4ZRK A;  2Z0Q A;  3V5W A;  1KZG A;  2COF A;  3DXE A;  2YS5 A;  1TXD A;  4IAP A;  2UZS A;  4HB2 B;  5J3Y A;  2KUP A;  1MIZ B;  1M7R A;  1I2H A;  3PP2 A;  4MY6 A;  4DBB A;  3ODO A;  2CY4 A;  2P0D A;  4A5K A;  2MKR A;  5DIF B;  4A6F A;  5HE1 A;  2RSG A;  3MDB C;  4GMX B;  4L6E A;  4PQ0 A;  5CLQ B;  5GOW B;  2ZPY A;  4HB3 B;  2ADZ A;  2IYB A;  4KHA A;  2CY5 A;  3PZD A;  1DRO A;  1M7E A;  2YT1 A;  5KQ4 A;  1ZC3 B;  4H8S A;  5D3V A;  3TVV A;  1I7A A;  2LUL A;  1Q67 A;  3PEG A;  4NSW A;  3QIJ A;  4HAV B;  3RCP A;  1N3H A;  3NSU A;  4TYZ A;  1J19 A;  2Y8G A;  2UVM A;  2LKO A;  2COC A;  2GCJ A;  1FAO A;  4YON A;  1H10 A;  1Y19 B;  2RVB B;  2W2W A;  2EMS A;  1DBH A;  1MPH A;  1XCG A;  2RUK B;  3F5R A;  1WG7 A;  1Z87 A;  3KSY A;  1WVH A;  3ULB A;  1UEF A;  3LJU X;  3BIN A;  2K00 A;  1EGX A;  1BTK A;  1XKE A;  4GXB A;  1V5U A;  2KCJ A;  3F0W A;  1RRP B;  1NTV A;  2P8V A;  1BAK A;  2N0Y A;  1FHW A;  2E2X A;  1UNP A;  3ODX A;  1X86 A;  4KHO A;  3QWM A;  3ML4 A;  3PVL A;  2D4Q A;  2VKI A;  3SYX A;  4DX9 0;  2RLO A;  3P7Z A;  4K2P A;  2FJL A;  4GN1 A;  3G9W A;  1OQN A;  5JP4 A;  5EFX A;  2DYN A;  1DDM A;  3UZT A;  4GZU A;  5C79 A;  2EJ8 A;  2IFS A;  3HK0 A;  1K5G B;  4ZRI A;  2H7D A;  2PZ1 A;  1WI1 A;  5KCV A;  3CXB B;  4HAY B;  4A6F B;  1PLS A;  5KQ1 A;  2DHK A;  2AL6 A;  2D2Q A;  3O96 A;  3D8E A;  1PFJ A;  2DFK A;  5DI9 B;  1U5G A;  4CHJ A;  1W1D A;  1H4R A;  1NI2 A;  2COD A;  1MK9 B;  3VOQ A;  2COA A;  3FEH A;  1U2B A;  3T06 A;  4P7I A;  3PVW A;  5DHF B;  1P3R A;  2YF0 A;  4D0N B;  1MK7 B;  2K2U A;  2DLW A;  3X23 A;  2D10 A;  4GPT B;  1UPR A;  4C0A A;  1FOE A;  1NU2 A;  2DX5 A;  2QKL A;  1J0W A;  2MDX A;  2UZR A;  1ZVR A;  3D8D A;  3PG7 A;  4HAW B;  4EKU A;  2ROZ B;  5D3X A;  2ELB A;  2R0D A;  5CLL B;  3ODW A;  2DKQ A;  1X1G A;  5FI0 A;  1EAZ A;  2YS3 A;  4KHB B;  5LON B;  1TJ6 A;  4K17 A;  1WGQ A;  4XWX A;  5J3T A;  3FM8 C;  1P5T A;  2LG1 A;  1DYN A;  1SGH A;  3TFM A;  2MFQ A;  2W2X D;  3VIA A;  3ZDT A;  2GJY A;  4DX8 A;  2OQB A;  3GYP A;  2RGN B;  1ZC4 B;  3KRX A;  2VRW B;  4IFS A;  1V5M A;  2XQN M;  3N7C A;  3WA0 A;  2Q13 A;  3MPX A;  3U7D A;  4F7G A;  1FGY A;  5LOP B;  1P6S A;  2LOX A;  2DYQ A;  1PMS A;  2L1C A;  1FHO A;  1W1G A;  1WGU A;  5L81 A;  1Y5O A;  4EMO A;  1EVH A;  2L2I A;  4GMV A;  2DX1 A;  2I1K A;  5DH9 B;  1DDV A;  1X1F A;  1OY2 A;  1WJM A;  2BCJ A;  1FHX A;  2OTX A;  3PSC A;  1LW3 A;  3M1I B;  4MT7 A;  1GC6 A;  4BBK A;  1U29 A;  2LYD A;  4IOY X;  1DDW A;  1X05 A;  2CAY A;  3AJ4 A;  5JLJ B;  1U5F A;  5J3Q A;  3GYO A;  3DXC A;  2D11 A;  5C6R A;  2AEH A;  2N23 A;  1ISN A;  3TO1 A;  3CIK A;  1MIX A;  2GS0 A;  4B6H A;  2HTH B;  2R09 A;  2YSZ A;  2DHI A;  1QC6 A;  3HW2 B;  2YT0 A;  4KAX B;  1BTN A;  4PNK A;  5JHH A;  1V61 A;  1AWE A;  2KGX B;  2QKM A;  2W2X C;  1XR0 B;  1MKE A;  4ZRJ A;  2V76 A;  2NZ8 B;  1QQG A;  3DXD A;  4HAX B;  4Y94 A;  4KVG B;  4A6H A;  2EC1 A;  2VSZ A;  2YS1 A;  1U5D A;  2P0H A;  2J59 M;  1UPQ A;  1BWN A;  3HQC A;  5FI1 A;  1V88 A;  1UNQ A;  3D8F A;  4HB0 B;  4HDQ A;  4MK0 A;  5D3Y A;  4K81 A;  4WVF B;  2G35 A;  1V89 A;  5C5B B;  3U8Z A;  2K2J A;  5D27 A;  3PVU A;  4WJ7 A;  1U5E A;  1FB8 A;  2Z0O A;  2DA0 A;  4K2O A;  1EF1 A;  2DHJ A;  2YVC A;  1SHC A;  3IVF A;  1TQZ A;  1KZ7 A;  4NY0 A;  3SO6 A;  5HE3 A;  4HDO A;  5C16 A;  2Z0P A;  3TCA A;  1LB1 A;  4F7U P;  2H7E A;  2J0K A;  3QBV B;  2J0M A;  2J0J A;  1AQC A;  1K5D B;  2D9W A;  4HHV A;  3AU5 A;  5DHA B;  4EJN A;  2GCL A;  1WJ1 A;  1XD4 A;  2RNR B;  4Z2M B;  3A8P A;  5C5B A;  1V5P A;  1KI1 B;  3SNH A;  2HE7 A;  2M14 A;  5D3W A;  5JHG A;  3KRW A;  4HAZ B;  3P6A A;  2ELA A;  2DKP A;  3AU4 A;  2D9X A;  2YRY A;  3KY9 A;  2Y8F A;  3A98 B;  2I1J A;  1W1H A;  2DN6 A;  2ROV A;  3SUZ A;  1FGZ A;  2EMT A;  3TW1 A;  4CHM A;  3OAN A;  4A6K A;  1UNR A;  1NTY A;  4DXA B;  1XOD A;  1ZSQ A;  4CYE A;  1U27 A;  2NMB A;  4YL8 A;  5HE0 A;  2D9Z A;  1XX0 A;  4WSF A;  1GG3 A;  2I5C A;  1OMW A;  2M38 A;  2JP2 A;  4Z2N A;  2MWN B;  4HAU B;  3SV1 A;  2D9V A;  1B55 A;  1MAI A;  1IRS A;  3A8Q A;  4TKN A;  2X18 A;  2DTC A;  1E5W A;  1GC7 A;  3BJI A;  3KZ1 A;  3ZVR A;  1ZM0 A;  2CRF A; 
#chains in the Genus database with same CATH topology
 4HB4 B;  3WYF B;  2LOZ A;  2D9Y A;  3DCX A;  5HE2 A;  1X11 A;  2KR0 A;  2P0F A;  3ULC A;  1RJ2 A;  2Y7B A;  2KIG A;  4F7H A;  4HAT B;  3FSS A;  2I5F A;  2R2Y A;  4ZRK A;  2Z0Q A;  3V5W A;  1KZG A;  2COF A;  3DXE A;  2YS5 A;  1TXD A;  4IAP A;  3U12 A;  2UZS A;  4HB2 B;  5J3Y A;  2ZKM X;  2KUP A;  1MIZ B;  4GNK B;  1M7R A;  1I2H A;  3PP2 A;  4MY6 A;  4DBB A;  3ODO A;  2CY4 A;  2P0D A;  4A5K A;  4CSQ A;  2MKR A;  5DIF B;  4A6F A;  5HE1 A;  2RSG A;  3MDB C;  4GMX B;  4L6E A;  4PQ0 A;  3NWA A;  5CLQ B;  3OHM B;  5GOW B;  2ZPY A;  4HB3 B;  2ADZ A;  2IYB A;  4KHA A;  2CY5 A;  3PZD A;  1DRO A;  1M7E A;  2YT1 A;  5KQ4 A;  1ZC3 B;  4H8S A;  5D3V A;  3TVV A;  1I7A A;  2LUL A;  1Q67 A;  3PEG A;  4NSW A;  3QIJ A;  4HAV B;  3RCP A;  1N3H A;  3NSU A;  4TYZ A;  1J19 A;  2Y8G A;  2UVM A;  2LKO A;  2COC A;  2GCJ A;  1FAO A;  4YON A;  1H10 A;  1Y19 B;  2RVB B;  2W2W A;  4L1R A;  2EMS A;  1DBH A;  1MPH A;  2Z59 A;  1XCG A;  2RUK B;  3F5R A;  5I2S A;  1WG7 A;  1Z87 A;  3KSY A;  1WVH A;  3ULB A;  1UEF A;  3LJU X;  3BIN A;  2K00 A;  1EGX A;  1BTK A;  1XKE A;  3A58 A;  4GXB A;  2KIE A;  1V5U A;  2KCJ A;  3F0W A;  1RRP B;  1NTV A;  2P8V A;  1BAK A;  4QJ4 B;  2N0Y A;  1FHW A;  2E2X A;  1UNP A;  3ODX A;  1X86 A;  4KHO A;  3QWM A;  3NW8 A;  3ML4 A;  3PVL A;  2D4Q A;  2VKI A;  3SYX A;  4GOU A;  4DX9 0;  2RLO A;  3P7Z A;  4K2P A;  2FJL A;  4GN1 A;  3NWF A;  3G9W A;  2NBV A;  1OQN A;  5JP4 A;  5EFX A;  2DYN A;  1DDM A;  3UZT A;  4GZU A;  5C79 A;  2EJ8 A;  2IFS A;  3HK0 A;  1K5G B;  4ZRI A;  2H7D A;  2PZ1 A;  1WI1 A;  5KCV A;  3CXB B;  4HAY B;  4A6F B;  1PLS A;  5KQ1 A;  2DHK A;  2AL6 A;  2D2Q A;  3O96 A;  3D8E A;  1PFJ A;  2DFK A;  5DI9 B;  1U5G A;  4CHJ A;  1W1D A;  1H4R A;  1NI2 A;  2COD A;  1MK9 B;  3VOQ A;  2COA A;  3FEH A;  1U2B A;  2Z14 A;  3T06 A;  4P7I A;  3PVW A;  5DHF B;  1P3R A;  2YF0 A;  4D0N B;  1MK7 B;  2K2U A;  2DLW A;  3X23 A;  2D10 A;  4GPT B;  1UPR A;  1T77 A;  4C0A A;  1FOE A;  1NU2 A;  2DX5 A;  2QKL A;  2UZR A;  1J0W A;  2MDX A;  1ZVR A;  1MI1 A;  3D8D A;  3PG7 A;  4HAW B;  4EKU A;  2ROZ B;  5D3X A;  2ELB A;  2R0D A;  5CLL B;  3ODW A;  2DKQ A;  1X1G A;  5FI0 A;  1EAZ A;  2YS3 A;  4KHB B;  5LON B;  1TJ6 A;  4K17 A;  1WGQ A;  4XWX A;  5J3T A;  3FM8 C;  2FJU B;  1P5T A;  2LG1 A;  1DYN A;  1SGH A;  3TFM A;  2MFQ A;  2W2X D;  4OT1 A;  3VIA A;  3ZDT A;  2GJY A;  4DX8 A;  2OQB A;  3GYP A;  2RGN B;  1ZC4 B;  3KRX A;  2VRW B;  4IFS A;  1V5M A;  2XQN M;  3N7C A;  3WA0 A;  2Q13 A;  3MPX A;  3U7D A;  4F7G A;  1FGY A;  3HSA A;  5LOP B;  1P6S A;  2LOX A;  2DYQ A;  1PMS A;  2L1C A;  1FHO A;  4DIX A;  2KUQ A;  1W1G A;  1WGU A;  5L81 A;  2Z13 A;  1Y5O A;  4KHB A;  4EMO A;  1EVH A;  2L2I A;  4GMV A;  2DX1 A;  2I1K A;  2Z4D A;  5DH9 B;  1DDV A;  1X1F A;  1OY2 A;  1WJM A;  2BCJ A;  1FHX A;  2OTX A;  3PSC A;  5IRS A;  4QJ3 B;  1LW3 A;  3M1I B;  4MT7 A;  1GC6 A;  2RRF A;  4BBK A;  1U29 A;  2GUM A;  2LYD A;  4IOY X;  1DDW A;  1X05 A;  2CAY A;  3AJ4 A;  5JLJ B;  1U5F A;  5J3Q A;  3GYO A;  3DXC A;  2D11 A;  5C6R A;  2AEH A;  2N23 A;  1ISN A;  3TO1 A;  3CIK A;  1MIX A;  2GS0 A;  4B6H A;  2K49 A;  2HTH B;  2R09 A;  2YSZ A;  2DHI A;  1QC6 A;  3HW2 B;  2YT0 A;  4KAX B;  1BTN A;  4PNK A;  5JHH A;  1V61 A;  3FVC A;  1AWE A;  2KGX B;  2QKM A;  2W2X C;  1XR0 B;  1MKE A;  2YT2 A;  4ZRJ A;  2V76 A;  2NZ8 B;  1QQG A;  3DXD A;  4HAX B;  4Y94 A;  4OSN A;  4KVG B;  4A6H A;  2EC1 A;  2K8E A;  2VSZ A;  2YS1 A;  1U5D A;  2P0H A;  2J59 M;  1UPQ A;  1BWN A;  3HQC A;  5FI1 A;  1V88 A;  1UNQ A;  3D8F A;  4HB0 B;  4HDQ A;  4MK0 A;  4D6W A;  5D3Y A;  4K81 A;  4WVF B;  2G35 A;  1V89 A;  5C5B B;  3U8Z A;  2K2J A;  5D27 A;  3PVU A;  4WJ7 A;  1U5E A;  1FB8 A;  2Z0O A;  2DA0 A;  4K2O A;  1EF1 A;  2DHJ A;  2YVC A;  1SHC A;  3IVF A;  4HSI A;  1TQZ A;  1KZ7 A;  4NY0 A;  3SO6 A;  5HE3 A;  4HDO A;  5C16 A;  2Z0P A;  3TCA A;  1LB1 A;  4QJ5 B;  4F7U P;  2H7E A;  2J0K A;  3QBV B;  2J0M A;  2J0J A;  1AQC A;  1K5D B;  2D9W A;  4HHV A;  3AU5 A;  5DHA B;  4EJN A;  2GCL A;  1WJ1 A;  1XD4 A;  2RNR B;  4Z2M B;  3B77 A;  3A8P A;  5C5B A;  1V5P A;  3NWD A;  1KI1 B;  3SNH A;  2HE7 A;  2M14 A;  5D3W A;  5JHG A;  3KRW A;  4HAZ B;  3P6A A;  2ELA A;  2DKP A;  3AU4 A;  2D9X A;  2YRY A;  3KY9 A;  2Y8F A;  3HIE A;  3A98 B;  2I1J A;  1W1H A;  2DN6 A;  2ROV A;  3SUZ A;  1FGZ A;  2EMT A;  3TW1 A;  4CHM A;  3OAN A;  4A6K A;  1UNR A;  5I2M A;  1NTY A;  4DXA B;  1XOD A;  1ZSQ A;  4CYE A;  1U27 A;  2NMB A;  4YL8 A;  5HE0 A;  2D9Z A;  5M4Y B;  1XX0 A;  4WSF A;  1GG3 A;  2I5C A;  1OMW A;  2M38 A;  4QXA B;  2JP2 A;  4Z2N A;  2MWN B;  4HAU B;  3SV1 A;  2D9V A;  1B55 A;  1MAI A;  1IRS A;  3A8Q A;  4TKN A;  2X18 A;  2DTC A;  1E5W A;  1GC7 A;  3BJI A;  3KZ1 A;  3ZVR A;  1ZYI A;  5LG4 B;  1ZM0 A;  2CRF A; 
#chains in the Genus database with same CATH homology
 4HB4 B;  3WYF B;  2LOZ A;  2D9Y A;  5HE2 A;  1X11 A;  2P0F A;  3ULC A;  1RJ2 A;  2Y7B A;  4F7H A;  4HAT B;  3FSS A;  2I5F A;  4ZRK A;  2Z0Q A;  3V5W A;  1KZG A;  2COF A;  3DXE A;  2YS5 A;  1TXD A;  4IAP A;  2UZS A;  4HB2 B;  5J3Y A;  2KUP A;  1MIZ B;  1M7R A;  1I2H A;  3PP2 A;  4MY6 A;  4DBB A;  3ODO A;  2CY4 A;  2P0D A;  4A5K A;  2MKR A;  5DIF B;  4A6F A;  5HE1 A;  2RSG A;  3MDB C;  4GMX B;  4L6E A;  4PQ0 A;  5CLQ B;  5GOW B;  2ZPY A;  4HB3 B;  2ADZ A;  2IYB A;  4KHA A;  2CY5 A;  3PZD A;  1DRO A;  1M7E A;  2YT1 A;  5KQ4 A;  1ZC3 B;  4H8S A;  5D3V A;  3TVV A;  1I7A A;  2LUL A;  1Q67 A;  3PEG A;  4NSW A;  3QIJ A;  4HAV B;  3RCP A;  1N3H A;  3NSU A;  4TYZ A;  1J19 A;  2Y8G A;  2UVM A;  2LKO A;  2COC A;  2GCJ A;  1FAO A;  4YON A;  1H10 A;  1Y19 B;  2RVB B;  2W2W A;  2EMS A;  1DBH A;  1MPH A;  1XCG A;  2RUK B;  3F5R A;  1WG7 A;  1Z87 A;  3KSY A;  1WVH A;  3ULB A;  1UEF A;  3LJU X;  3BIN A;  2K00 A;  1EGX A;  1BTK A;  1XKE A;  4GXB A;  1V5U A;  2KCJ A;  3F0W A;  1RRP B;  1NTV A;  2P8V A;  1BAK A;  2N0Y A;  1FHW A;  2E2X A;  1UNP A;  3ODX A;  1X86 A;  4KHO A;  3QWM A;  3ML4 A;  3PVL A;  2D4Q A;  2VKI A;  3SYX A;  4DX9 0;  2RLO A;  3P7Z A;  4K2P A;  2FJL A;  4GN1 A;  3G9W A;  1OQN A;  5JP4 A;  5EFX A;  2DYN A;  1DDM A;  3UZT A;  4GZU A;  5C79 A;  2EJ8 A;  2IFS A;  3HK0 A;  1K5G B;  4ZRI A;  2H7D A;  2PZ1 A;  1WI1 A;  5KCV A;  3CXB B;  4HAY B;  4A6F B;  1PLS A;  5KQ1 A;  2DHK A;  2AL6 A;  2D2Q A;  3O96 A;  3D8E A;  1PFJ A;  2DFK A;  5DI9 B;  1U5G A;  4CHJ A;  1W1D A;  1H4R A;  1NI2 A;  2COD A;  1MK9 B;  3VOQ A;  2COA A;  3FEH A;  1U2B A;  3T06 A;  4P7I A;  3PVW A;  5DHF B;  1P3R A;  2YF0 A;  4D0N B;  1MK7 B;  2K2U A;  2DLW A;  3X23 A;  2D10 A;  4GPT B;  1UPR A;  4C0A A;  1FOE A;  1NU2 A;  2DX5 A;  2QKL A;  1J0W A;  2MDX A;  2UZR A;  1ZVR A;  3D8D A;  3PG7 A;  4HAW B;  4EKU A;  2ROZ B;  5D3X A;  2ELB A;  2R0D A;  5CLL B;  3ODW A;  2DKQ A;  1X1G A;  5FI0 A;  1EAZ A;  2YS3 A;  4KHB B;  5LON B;  1TJ6 A;  4K17 A;  1WGQ A;  4XWX A;  5J3T A;  3FM8 C;  1P5T A;  2LG1 A;  1DYN A;  1SGH A;  3TFM A;  2MFQ A;  2W2X D;  3VIA A;  3ZDT A;  2GJY A;  4DX8 A;  2OQB A;  3GYP A;  2RGN B;  1ZC4 B;  3KRX A;  2VRW B;  4IFS A;  1V5M A;  2XQN M;  3N7C A;  3WA0 A;  2Q13 A;  3MPX A;  3U7D A;  4F7G A;  1FGY A;  5LOP B;  1P6S A;  2LOX A;  2DYQ A;  1PMS A;  2L1C A;  1FHO A;  1W1G A;  1WGU A;  5L81 A;  1Y5O A;  4EMO A;  1EVH A;  2L2I A;  4GMV A;  2DX1 A;  2I1K A;  5DH9 B;  1DDV A;  1X1F A;  1OY2 A;  1WJM A;  2BCJ A;  1FHX A;  2OTX A;  3PSC A;  1LW3 A;  3M1I B;  4MT7 A;  1GC6 A;  4BBK A;  1U29 A;  2LYD A;  4IOY X;  1DDW A;  1X05 A;  2CAY A;  3AJ4 A;  5JLJ B;  1U5F A;  5J3Q A;  3GYO A;  3DXC A;  2D11 A;  5C6R A;  2AEH A;  2N23 A;  1ISN A;  3TO1 A;  3CIK A;  1MIX A;  2GS0 A;  4B6H A;  2HTH B;  2R09 A;  2YSZ A;  2DHI A;  1QC6 A;  3HW2 B;  2YT0 A;  4KAX B;  1BTN A;  4PNK A;  5JHH A;  1V61 A;  1AWE A;  2KGX B;  2QKM A;  2W2X C;  1XR0 B;  1MKE A;  4ZRJ A;  2V76 A;  2NZ8 B;  1QQG A;  3DXD A;  4HAX B;  4Y94 A;  4KVG B;  4A6H A;  2EC1 A;  2VSZ A;  2YS1 A;  1U5D A;  2P0H A;  2J59 M;  1UPQ A;  1BWN A;  3HQC A;  5FI1 A;  1V88 A;  1UNQ A;  3D8F A;  4HB0 B;  4HDQ A;  4MK0 A;  5D3Y A;  4K81 A;  4WVF B;  2G35 A;  1V89 A;  5C5B B;  3U8Z A;  2K2J A;  5D27 A;  3PVU A;  4WJ7 A;  1U5E A;  1FB8 A;  2Z0O A;  2DA0 A;  4K2O A;  1EF1 A;  2DHJ A;  2YVC A;  1SHC A;  3IVF A;  1TQZ A;  1KZ7 A;  4NY0 A;  3SO6 A;  5HE3 A;  4HDO A;  5C16 A;  2Z0P A;  3TCA A;  1LB1 A;  4F7U P;  2H7E A;  2J0K A;  3QBV B;  2J0M A;  2J0J A;  1AQC A;  1K5D B;  2D9W A;  4HHV A;  3AU5 A;  5DHA B;  4EJN A;  2GCL A;  1WJ1 A;  1XD4 A;  2RNR B;  4Z2M B;  3A8P A;  5C5B A;  1V5P A;  1KI1 B;  3SNH A;  2HE7 A;  2M14 A;  5D3W A;  5JHG A;  3KRW A;  4HAZ B;  3P6A A;  2ELA A;  2DKP A;  3AU4 A;  2D9X A;  2YRY A;  3KY9 A;  2Y8F A;  3A98 B;  2I1J A;  1W1H A;  2DN6 A;  2ROV A;  3SUZ A;  1FGZ A;  2EMT A;  3TW1 A;  4CHM A;  3OAN A;  4A6K A;  1UNR A;  1NTY A;  4DXA B;  1XOD A;  1ZSQ A;  4CYE A;  1U27 A;  2NMB A;  4YL8 A;  5HE0 A;  2D9Z A;  1XX0 A;  4WSF A;  1GG3 A;  2I5C A;  1OMW A;  2M38 A;  2JP2 A;  4Z2N A;  2MWN B;  4HAU B;  3SV1 A;  2D9V A;  1B55 A;  1MAI A;  1IRS A;  3A8Q A;  4TKN A;  2X18 A;  2DTC A;  1E5W A;  1GC7 A;  3BJI A;  3KZ1 A;  3ZVR A;  1ZM0 A;  2CRF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...