1V89A

Solution structure of the pleckstrin homology domain of human kiaa0053 protein
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
118
structure length
118
Chain Sequence
GSSGSSGPIKMGWLKKQRSIVKNWQQRYFVLRAQQLYYYKDEEDTKPQGCMYLPGCTIKEIATNPEEAGKFVFEIIPASWDQNRMGQDSYVLMASSQAEMEEWVKFLRRVAGSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein KIAA0053
publication title Solution Structure of the Pleckstrin Homology Domain of Human KIAA0053 Protein
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 13
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2003-12-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1v89A00
1U5EA 1UNQA 1Q67A 2D10A 4L6EA 5C16A 4H8SA 4HHVA 1ZM0A 2DTCA 1MK7B 1WI1A 2LOXA 1TJ6A 2I5FA 4HDOA 2J59M 3UZTA 1FHWA 1U2BA 3TW1A 2GCJA 2EMTA 3PVUA 1V5PA 4NY0A 2LYDA 2RVBB 5DIFB 2Q13A 2P0FA 5C6RA 5J3QA 5JHGA 2RGNB 1FGYA 3U7DA 2LOZA 5KQ1A 5DI9B 2DKQA 4XWXA 4WSFA 4HB0B 1MK9B 2Z0PA 3SYXA 4B6HA 1M7EA 3KSYA 3QWMA 1V61A 2RLOA 5CLQB 2D9ZA 1DDVA 1XODA 2I1JA 2N0YA 3N7CA 4ZRJA 2UZSA 4PNKA 3U8ZA 1MKEA 2HTHB 1N3HA 5D3YA 5CLLB 2HE7A 2DYNA 5KQ4A 2ELBA 2K00A 1UPQA 2DA0A 2COAA 2J0MA 3TCAA 4GMXB 2QKLA 2VRWB 5HE1A 4CHJA 2W2XC 4GXBA 3SNHA 1EAZA 3DXCA 2N23A 1FHOA 2DX5A 1U5FA 2ZPYA 1LB1A 2KUPA 4A5KA 2L2IA 3SUZA 2K2UA 1MAIA 4IFSA 4ZRIA 2YF0A 2Z0OA 3PSCA 2E2XA 2AEHA 2Z0QA 4D0NB 4BBKA 1K5GB 2YT1A 2YT0A 2IYBA 4A6FA 2R09A 4KHOA 1X86A 5J3TA 1FHXA 3MPXA 2EC1A 2P0HA 1BAKA 5FI1A 5JLJB 1H4RA 4KHBB 3F5RA 5C5BB 2MKRA 3T06A 4F7GA 3FSSA 1UNPA 3TO1A 4PQ0A 3VOQA 2DN6A 3CXBB 4P7IA 4HAVB 3D8FA 4DX90 3KY9A 3PZDA 1DROA 2J0JA 1X05A 3AU4A 4HB3B 1AWEA 1EVHA 2D4QA 2GJYA 3HK0A 4HB4B 1I7AA 3ODXA 2R0DA 3PEGA 2NMBA 5FI0A 3V5WA 1DDWA 2UVMA 2PZ1A 1UEFA 3WYFB 2M38A 1KZGA 2W2WA 2M14A 3BINA 1ZC4B 1H10A 4A6FB 2CRFA 1BTNA 2K2JA 3P7ZA 1U5GA 5C79A 3P6AA 3AU5A 4A6KA 4Z2MB 1ZC3B 3O96A 2QKMA 4GPTB 1V88A 2RNRB 2BCJA 2G35A 5J3YA 3CIKA 3MDBC 3DXEA 4MK0A 2L1CA 3SV1A 4HAUB 4HAWB 3RCPA 3NSUA 3X23A 2UZRA 2Y8GA 1FB8A 4WVFB 1LW3A 4YL8A 5EFXA 4EKUA 3QIJA 1RRPB 3PP2A 1V5MA 1QC6A 2Y7BA 2W2XD 2DFKA 1P3RA 1EF1A 2RSGA 1NU2A 3A8PA 4EJNA 2GCLA 4GMVA 2D9XA 3KZ1A 2YS5A 2D11A 3SO6A 4GZUA 5LONB 5DHFB 3PG7A 5L81A 2XQNM 1K5DB 1KZ7A 3TFMA 1P5TA 4F7HA 1X11A 2H7EA 5D3XA 1B55A 3FEHA 5KCVA 3FM8C 2YS3A 4IAPA 2I5CA 2GS0A 4HDQA 3WA0A 3D8DA 1WGUA 4Y94A 4Z2NA 2X18A 5JHHA 1V89A 2KGXB 1U29A 5JP4A 4K2PA 2DLWA 1PFJA 2CY5A 2OTXA 2YS1A 1AQCA 1MIZB 1J19A 2ELAA 4K17A 4TYZA 1OY2A 2DHJA 2DHKA 3VIAA 4A6HA 1X1FA 2D9YA 1DDMA 1XD4A 1GG3A 2RUKB 5GOWB 3ODWA 1Y19B 1ISNA 2D9WA 2CAYA 4TKNA 1U5DA 1PLSA 4HAXB 1WJMA 2DYQA 1P6SA 1FAOA 2FJLA 1MIXA 1WJ1A 2J0KA 4DX8A 1EGXA 1UNRA 1FGZA 3HW2B 2I1KA 1W1DA 3GYPA 4EMOA 3A8QA 2MWNB 1PMSA 1WGQA 4HB2B 5D3VA 3ODOA 2ROVA 1TXDA 3G9WA 4C0AA 1SHCA 1OMWA 1Y5OA 4HAYB 3ZVRA 1XX0A 5D3WA 1NTVA 4CYEA 1DYNA 2D9VA 1BWNA 2COFA 1XR0B 2DKPA 1BTKA 2CY4A 4MT7A 1GC7A 1WVHA 1ZSQA 3TVVA 1J0WA 4CHMA 1M7RA 1WG7A 2LULA 3BJIA 4DBBA 2LG1A 2NZ8B 2Y8FA 4HAZB 2EMSA 1ZVRA 3QBVB 3OANA 2KCJA 1X1GA 3M1IB 1OQNA 2ADZA 3LJUX 5LOPB 2MFQA 1QQGA 4GN1A 1IRSA 2LKOA 2YRYA 2JP2A 3KRXA 3A98B 5D27A 5C5BA 1U27A 4ZRKA 3KRWA 2VKIA 1V5UA 3IVFA 2MDXA 2AL6A 4K81A 4WJ7A 4NSWA 1W1HA 3PVLA 3HQCA 4MY6A 2P8VA 4K2OA 5DHAB 3ML4A 4IOYX 2OQBA 1MPHA 2IFSA 4DXAB 4KVGB 1SGHA 1FOEA 4YONA 5HE2A 2DX1A 4KAXB 1E5WA 2P0DA 3ZDTA 1Z87A 1TQZA 3AJ4A 2VSZA 3PVWA 2V76A 2ROZB 2DHIA 4F7UP 2YVCA 1XCGA 2D2QA 1UPRA 1KI1B 3F0WA 1NI2A 1RJ2A 1GC6A 3GYOA 3ULCA 3DXDA 1W1GA 1XKEA 2YSZA 3ULBA 2EJ8A 4HATB 1DBHA 2H7DA 5DH9B 2CODA 3D8EA 4KHAA 1NTYA 1I2HA 5HE3A 2COCA 5HE0A
chains in the Genus database with same CATH superfamily
1U5EA 1UNQA 1Q67A 2D10A 4L6EA 3U12A 5C16A 4H8SA 2YT2A 2GUMA 4HHVA 1ZM0A 2DTCA 1MK7B 1WI1A 2LOXA 1TJ6A 2I5FA 4HDOA 2J59M 3UZTA 1FHWA 1U2BA 3TW1A 2GCJA 2EMTA 3PVUA 1V5PA 4NY0A 2LYDA 2RVBB 5DIFB 2Q13A 2P0FA 5C6RA 5J3QA 5JHGA 2RGNB 1FGYA 3U7DA 2LOZA 5KQ1A 5DI9B 2DKQA 4XWXA 4WSFA 4HB0B 1MK9B 2Z0PA 3SYXA 4B6HA 1M7EA 3KSYA 3QWMA 1V61A 2RLOA 3NW8A 5CLQB 2D9ZA 1DDVA 1XODA 2I1JA 2N0YA 3N7CA 4ZRJA 2UZSA 4PNKA 3U8ZA 1MKEA 2HTHB 1N3HA 5D3YA 5CLLB 2HE7A 4HSIA 2DYNA 5KQ4A 2ELBA 2K00A 1UPQA 2DA0A 2COAA 2J0MA 3HIEA 3TCAA 4GMXB 2QKLA 2RRFA 2VRWB 5LG4B 5HE1A 4CHJA 2W2XC 4GXBA 3SNHA 1EAZA 3DXCA 2N23A 1FHOA 2DX5A 1U5FA 2ZPYA 1LB1A 2KUPA 4A5KA 2L2IA 3SUZA 2K2UA 1MAIA 4IFSA 4ZRIA 2YF0A 2Z0OA 3PSCA 2E2XA 2AEHA 2Z0QA 4D0NB 4BBKA 1K5GB 2YT1A 2YT0A 2IYBA 4GNKB 4A6FA 2R09A 4KHOA 1X86A 5J3TA 1FHXA 3MPXA 2EC1A 2P0HA 2Z13A 1BAKA 5FI1A 5JLJB 1H4RA 4KHBB 3F5RA 5C5BB 1T77A 2MKRA 3T06A 4F7GA 4QJ4B 3FSSA 1UNPA 3TO1A 4PQ0A 5M4YB 3VOQA 2DN6A 3CXBB 4P7IA 3NWAA 4HAVB 2ZKMX 3D8FA 4DX90 3KY9A 3PZDA 1DROA 2J0JA 1X05A 3AU4A 4HB3B 1AWEA 1EVHA 2D4QA 3NWFA 2GJYA 2R2YA 3HK0A 4HB4B 1I7AA 3ODXA 2R0DA 3PEGA 2NMBA 5FI0A 3V5WA 1DDWA 2UVMA 2PZ1A 1UEFA 3WYFB 2M38A 2KIGA 2FJUB 1KZGA 2W2WA 2M14A 3BINA 1ZC4B 1H10A 4A6FB 2CRFA 2K49A 1BTNA 2K2JA 4CSQA 3P7ZA 5I2SA 1U5GA 5C79A 3P6AA 3AU5A 4A6KA 4Z2MB 1ZC3B 3O96A 2QKMA 4GPTB 2KR0A 1V88A 2RNRB 2BCJA 2G35A 5J3YA 3CIKA 3MDBC 3DXEA 4MK0A 2L1CA 3SV1A 4HAUB 4HAWB 3RCPA 3NSUA 3X23A 2UZRA 2Y8GA 4GOUA 1FB8A 4WVFB 1LW3A 4YL8A 5EFXA 4EKUA 3QIJA 1RRPB 3PP2A 3A58A 1V5MA 1QC6A 2Y7BA 2W2XD 2DFKA 1P3RA 1EF1A 2RSGA 1NU2A 3A8PA 4EJNA 2GCLA 4GMVA 2D9XA 3KZ1A 2YS5A 2D11A 3SO6A 4GZUA 2K8EA 5LONB 5DHFB 3PG7A 5L81A 2XQNM 1K5DB 1KZ7A 3TFMA 1P5TA 4L1RA 4F7HA 1X11A 2H7EA 5D3XA 1B55A 3FEHA 4QJ3B 5KCVA 3FM8C 2YS3A 4IAPA 2I5CA 2GS0A 4HDQA 1MI1A 3WA0A 5IRSA 3D8DA 1WGUA 3NWDA 4Y94A 4Z2NA 2X18A 5JHHA 1V89A 2KGXB 1U29A 5JP4A 4K2PA 2DLWA 1PFJA 2CY5A 2OTXA 2YS1A 2NBVA 5I2MA 2Z59A 1AQCA 1MIZB 1J19A 2ELAA 4K17A 4TYZA 1OY2A 2DHJA 2DHKA 3VIAA 4A6HA 1X1FA 2D9YA 1DDMA 1XD4A 1GG3A 2RUKB 5GOWB 3ODWA 1Y19B 1ISNA 2D9WA 2CAYA 4TKNA 1U5DA 1PLSA 4HAXB 1WJMA 2DYQA 1P6SA 1FAOA 2FJLA 1MIXA 1WJ1A 2J0KA 4DX8A 1EGXA 1UNRA 1FGZA 3HW2B 2I1KA 1W1DA 3GYPA 4EMOA 3A8QA 2MWNB 1PMSA 1ZYIA 1WGQA 3OHMB 4HB2B 5D3VA 2KUQA 3ODOA 2ROVA 1TXDA 3G9WA 4C0AA 1SHCA 1OMWA 1Y5OA 4HAYB 3ZVRA 1XX0A 5D3WA 1NTVA 4CYEA 1DYNA 2D9VA 1BWNA 2COFA 1XR0B 2DKPA 1BTKA 2CY4A 4MT7A 1GC7A 1WVHA 1ZSQA 3TVVA 1J0WA 4CHMA 1M7RA 1WG7A 4QJ5B 2LULA 3BJIA 4DBBA 2LG1A 2NZ8B 2Z14A 2Y8FA 4HAZB 2EMSA 1ZVRA 3QBVB 3OANA 2KCJA 1X1GA 3M1IB 1OQNA 2ADZA 3LJUX 5LOPB 2MFQA 1QQGA 4GN1A 1IRSA 4DIXA 2LKOA 2YRYA 2JP2A 3KRXA 3A98B 4KHBA 5D27A 5C5BA 1U27A 4ZRKA 3KRWA 2VKIA 1V5UA 3IVFA 2MDXA 2AL6A 4K81A 4WJ7A 4NSWA 4OT1A 1W1HA 3PVLA 3HQCA 4MY6A 2P8VA 4K2OA 2Z4DA 5DHAB 3ML4A 4IOYX 2OQBA 4QXAB 1MPHA 2IFSA 4OSNA 4DXAB 4KVGB 1SGHA 1FOEA 4YONA 5HE2A 2DX1A 4KAXB 1E5WA 2P0DA 3FVCA 3ZDTA 1Z87A 1TQZA 3AJ4A 2VSZA 3PVWA 2V76A 2ROZB 2DHIA 4F7UP 2YVCA 1XCGA 2D2QA 2KIEA 3HSAA 1UPRA 1KI1B 3F0WA 1NI2A 1RJ2A 1GC6A 3GYOA 3ULCA 3DXDA 4D6WA 3DCXA 1W1GA 1XKEA 2YSZA 3ULBA 2EJ8A 4HATB 1DBHA 2H7DA 5DH9B 2CODA 3D8EA 4KHAA 1NTYA 1I2HA 3B77A 5HE3A 2COCA 5HE0A
chains in the Genus database with same CATH topology
1U5EA 1UNQA 1Q67A 2D10A 4L6EA 5C16A 4H8SA 4HHVA 1ZM0A 2DTCA 1MK7B 1WI1A 2LOXA 1TJ6A 2I5FA 4HDOA 2J59M 3UZTA 1FHWA 1U2BA 3TW1A 2GCJA 2EMTA 3PVUA 1V5PA 4NY0A 2LYDA 2RVBB 5DIFB 2Q13A 2P0FA 5C6RA 5J3QA 5JHGA 2RGNB 1FGYA 3U7DA 2LOZA 5KQ1A 5DI9B 2DKQA 4XWXA 4WSFA 4HB0B 1MK9B 2Z0PA 3SYXA 4B6HA 1M7EA 3KSYA 3QWMA 1V61A 2RLOA 5CLQB 2D9ZA 1DDVA 1XODA 2I1JA 2N0YA 3N7CA 4ZRJA 2UZSA 4PNKA 3U8ZA 1MKEA 2HTHB 1N3HA 5D3YA 5CLLB 2HE7A 2DYNA 5KQ4A 2ELBA 2K00A 1UPQA 2DA0A 2COAA 2J0MA 3TCAA 4GMXB 2QKLA 2VRWB 5HE1A 4CHJA 2W2XC 4GXBA 3SNHA 1EAZA 3DXCA 2N23A 1FHOA 2DX5A 1U5FA 2ZPYA 1LB1A 2KUPA 4A5KA 2L2IA 3SUZA 2K2UA 1MAIA 4IFSA 4ZRIA 2YF0A 2Z0OA 3PSCA 2E2XA 2AEHA 2Z0QA 4D0NB 4BBKA 1K5GB 2YT1A 2YT0A 2IYBA 4A6FA 2R09A 4KHOA 1X86A 5J3TA 1FHXA 3MPXA 2EC1A 2P0HA 1BAKA 5FI1A 5JLJB 1H4RA 4KHBB 3F5RA 5C5BB 2MKRA 3T06A 4F7GA 3FSSA 1UNPA 3TO1A 4PQ0A 3VOQA 2DN6A 3CXBB 4P7IA 4HAVB 3D8FA 4DX90 3KY9A 3PZDA 1DROA 2J0JA 1X05A 3AU4A 4HB3B 1AWEA 1EVHA 2D4QA 2GJYA 3HK0A 4HB4B 1I7AA 3ODXA 2R0DA 3PEGA 2NMBA 5FI0A 3V5WA 1DDWA 2UVMA 2PZ1A 1UEFA 3WYFB 2M38A 1KZGA 2W2WA 2M14A 3BINA 1ZC4B 1H10A 4A6FB 2CRFA 1BTNA 2K2JA 3P7ZA 1U5GA 5C79A 3P6AA 3AU5A 4A6KA 4Z2MB 1ZC3B 3O96A 2QKMA 4GPTB 1V88A 2RNRB 2BCJA 2G35A 5J3YA 3CIKA 3MDBC 3DXEA 4MK0A 2L1CA 3SV1A 4HAUB 4HAWB 3RCPA 3NSUA 3X23A 2UZRA 2Y8GA 1FB8A 4WVFB 1LW3A 4YL8A 5EFXA 4EKUA 3QIJA 1RRPB 3PP2A 1V5MA 1QC6A 2Y7BA 2W2XD 2DFKA 1P3RA 1EF1A 2RSGA 1NU2A 3A8PA 4EJNA 2GCLA 4GMVA 2D9XA 3KZ1A 2YS5A 2D11A 3SO6A 4GZUA 5LONB 5DHFB 3PG7A 5L81A 2XQNM 1K5DB 1KZ7A 3TFMA 1P5TA 4F7HA 1X11A 2H7EA 5D3XA 1B55A 3FEHA 5KCVA 3FM8C 2YS3A 4IAPA 2I5CA 2GS0A 4HDQA 3WA0A 3D8DA 1WGUA 4Y94A 4Z2NA 2X18A 5JHHA 1V89A 2KGXB 1U29A 5JP4A 4K2PA 2DLWA 1PFJA 2CY5A 2OTXA 2YS1A 1AQCA 1MIZB 1J19A 2ELAA 4K17A 4TYZA 1OY2A 2DHJA 2DHKA 3VIAA 4A6HA 1X1FA 2D9YA 1DDMA 1XD4A 1GG3A 2RUKB 5GOWB 3ODWA 1Y19B 1ISNA 2D9WA 2CAYA 4TKNA 1U5DA 1PLSA 4HAXB 1WJMA 2DYQA 1P6SA 1FAOA 2FJLA 1MIXA 1WJ1A 2J0KA 4DX8A 1EGXA 1UNRA 1FGZA 3HW2B 2I1KA 1W1DA 3GYPA 4EMOA 3A8QA 2MWNB 1PMSA 1WGQA 4HB2B 5D3VA 3ODOA 2ROVA 1TXDA 3G9WA 4C0AA 1SHCA 1OMWA 1Y5OA 4HAYB 3ZVRA 1XX0A 5D3WA 1NTVA 4CYEA 1DYNA 2D9VA 1BWNA 2COFA 1XR0B 2DKPA 1BTKA 2CY4A 4MT7A 1GC7A 1WVHA 1ZSQA 3TVVA 1J0WA 4CHMA 1M7RA 1WG7A 2LULA 3BJIA 4DBBA 2LG1A 2NZ8B 2Y8FA 4HAZB 2EMSA 1ZVRA 3QBVB 3OANA 2KCJA 1X1GA 3M1IB 1OQNA 2ADZA 3LJUX 5LOPB 2MFQA 1QQGA 4GN1A 1IRSA 2LKOA 2YRYA 2JP2A 3KRXA 3A98B 5D27A 5C5BA 1U27A 4ZRKA 3KRWA 2VKIA 1V5UA 3IVFA 2MDXA 2AL6A 4K81A 4WJ7A 4NSWA 1W1HA 3PVLA 3HQCA 4MY6A 2P8VA 4K2OA 5DHAB 3ML4A 4IOYX 2OQBA 1MPHA 2IFSA 4DXAB 4KVGB 1SGHA 1FOEA 4YONA 5HE2A 2DX1A 4KAXB 1E5WA 2P0DA 3ZDTA 1Z87A 1TQZA 3AJ4A 2VSZA 3PVWA 2V76A 2ROZB 2DHIA 4F7UP 2YVCA 1XCGA 2D2QA 1UPRA 1KI1B 3F0WA 1NI2A 1RJ2A 1GC6A 3GYOA 3ULCA 3DXDA 1W1GA 1XKEA 2YSZA 3ULBA 2EJ8A 4HATB 1DBHA 2H7DA 5DH9B 2CODA 3D8EA 4KHAA 1NTYA 1I2HA 5HE3A 2COCA 5HE0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1U5E A;  1UNQ A;  1Q67 A;  2D10 A;  4L6E A;  5C16 A;  4H8S A;  4HHV A;  1ZM0 A;  2DTC A;  1MK7 B;  1WI1 A;  2LOX A;  1TJ6 A;  2I5F A;  4HDO A;  2J59 M;  3UZT A;  1FHW A;  1U2B A;  3TW1 A;  2GCJ A;  2EMT A;  3PVU A;  1V5P A;  4NY0 A;  2LYD A;  2RVB B;  5DIF B;  2Q13 A;  2P0F A;  5C6R A;  5J3Q A;  5JHG A;  2RGN B;  1FGY A;  3U7D A;  2LOZ A;  5KQ1 A;  5DI9 B;  2DKQ A;  4XWX A;  4WSF A;  4HB0 B;  1MK9 B;  2Z0P A;  3SYX A;  4B6H A;  1M7E A;  3KSY A;  3QWM A;  1V61 A;  2RLO A;  5CLQ B;  2D9Z A;  1DDV A;  1XOD A;  2I1J A;  2N0Y A;  3N7C A;  4ZRJ A;  2UZS A;  4PNK A;  3U8Z A;  1MKE A;  2HTH B;  1N3H A;  5D3Y A;  5CLL B;  2HE7 A;  2DYN A;  5KQ4 A;  2ELB A;  2K00 A;  1UPQ A;  2DA0 A;  2COA A;  2J0M A;  3TCA A;  4GMX B;  2QKL A;  2VRW B;  5HE1 A;  4CHJ A;  2W2X C;  4GXB A;  3SNH A;  1EAZ A;  3DXC A;  2N23 A;  1FHO A;  2DX5 A;  1U5F A;  2ZPY A;  1LB1 A;  2KUP A;  4A5K A;  2L2I A;  3SUZ A;  2K2U A;  1MAI A;  4IFS A;  4ZRI A;  2YF0 A;  2Z0O A;  3PSC A;  2E2X A;  2AEH A;  2Z0Q A;  4D0N B;  4BBK A;  1K5G B;  2YT1 A;  2YT0 A;  2IYB A;  4A6F A;  2R09 A;  4KHO A;  1X86 A;  5J3T A;  1FHX A;  3MPX A;  2EC1 A;  2P0H A;  1BAK A;  5FI1 A;  5JLJ B;  1H4R A;  4KHB B;  3F5R A;  5C5B B;  2MKR A;  3T06 A;  4F7G A;  3FSS A;  1UNP A;  3TO1 A;  4PQ0 A;  3VOQ A;  2DN6 A;  3CXB B;  4P7I A;  4HAV B;  3D8F A;  4DX9 0;  3KY9 A;  3PZD A;  1DRO A;  2J0J A;  1X05 A;  3AU4 A;  4HB3 B;  1AWE A;  1EVH A;  2D4Q A;  2GJY A;  3HK0 A;  4HB4 B;  1I7A A;  3ODX A;  2R0D A;  3PEG A;  2NMB A;  5FI0 A;  3V5W A;  1DDW A;  2UVM A;  2PZ1 A;  1UEF A;  3WYF B;  2M38 A;  1KZG A;  2W2W A;  2M14 A;  3BIN A;  1ZC4 B;  1H10 A;  4A6F B;  2CRF A;  1BTN A;  2K2J A;  3P7Z A;  1U5G A;  5C79 A;  3P6A A;  3AU5 A;  4A6K A;  4Z2M B;  1ZC3 B;  3O96 A;  2QKM A;  4GPT B;  1V88 A;  2RNR B;  2BCJ A;  2G35 A;  5J3Y A;  3CIK A;  3MDB C;  3DXE A;  4MK0 A;  2L1C A;  3SV1 A;  4HAU B;  4HAW B;  3RCP A;  3NSU A;  3X23 A;  2UZR A;  2Y8G A;  1FB8 A;  4WVF B;  1LW3 A;  4YL8 A;  5EFX A;  4EKU A;  3QIJ A;  1RRP B;  3PP2 A;  1V5M A;  1QC6 A;  2Y7B A;  2W2X D;  2DFK A;  1P3R A;  1EF1 A;  2RSG A;  1NU2 A;  3A8P A;  4EJN A;  2GCL A;  4GMV A;  2D9X A;  3KZ1 A;  2YS5 A;  2D11 A;  3SO6 A;  4GZU A;  5LON B;  5DHF B;  3PG7 A;  5L81 A;  2XQN M;  1K5D B;  1KZ7 A;  3TFM A;  1P5T A;  4F7H A;  1X11 A;  2H7E A;  5D3X A;  1B55 A;  3FEH A;  5KCV A;  3FM8 C;  2YS3 A;  4IAP A;  2I5C A;  2GS0 A;  4HDQ A;  3WA0 A;  3D8D A;  1WGU A;  4Y94 A;  4Z2N A;  2X18 A;  5JHH A;  1V89 A;  2KGX B;  1U29 A;  5JP4 A;  4K2P A;  2DLW A;  1PFJ A;  2CY5 A;  2OTX A;  2YS1 A;  1AQC A;  1MIZ B;  1J19 A;  2ELA A;  4K17 A;  4TYZ A;  1OY2 A;  2DHJ A;  2DHK A;  3VIA A;  4A6H A;  1X1F A;  2D9Y A;  1DDM A;  1XD4 A;  1GG3 A;  2RUK B;  5GOW B;  3ODW A;  1Y19 B;  1ISN A;  2D9W A;  2CAY A;  4TKN A;  1U5D A;  1PLS A;  4HAX B;  1WJM A;  2DYQ A;  1P6S A;  1FAO A;  2FJL A;  1MIX A;  1WJ1 A;  2J0K A;  4DX8 A;  1EGX A;  1UNR A;  1FGZ A;  3HW2 B;  2I1K A;  1W1D A;  3GYP A;  4EMO A;  3A8Q A;  2MWN B;  1PMS A;  1WGQ A;  4HB2 B;  5D3V A;  3ODO A;  2ROV A;  1TXD A;  3G9W A;  4C0A A;  1SHC A;  1OMW A;  1Y5O A;  4HAY B;  3ZVR A;  1XX0 A;  5D3W A;  1NTV A;  4CYE A;  1DYN A;  2D9V A;  1BWN A;  2COF A;  1XR0 B;  2DKP A;  1BTK A;  2CY4 A;  4MT7 A;  1GC7 A;  1WVH A;  1ZSQ A;  3TVV A;  1J0W A;  4CHM A;  1M7R A;  1WG7 A;  2LUL A;  3BJI A;  4DBB A;  2LG1 A;  2NZ8 B;  2Y8F A;  4HAZ B;  2EMS A;  1ZVR A;  3QBV B;  3OAN A;  2KCJ A;  1X1G A;  3M1I B;  1OQN A;  2ADZ A;  3LJU X;  5LOP B;  2MFQ A;  1QQG A;  4GN1 A;  1IRS A;  2LKO A;  2YRY A;  2JP2 A;  3KRX A;  3A98 B;  5D27 A;  5C5B A;  1U27 A;  4ZRK A;  3KRW A;  2VKI A;  1V5U A;  3IVF A;  2MDX A;  2AL6 A;  4K81 A;  4WJ7 A;  4NSW A;  1W1H A;  3PVL A;  3HQC A;  4MY6 A;  2P8V A;  4K2O A;  5DHA B;  3ML4 A;  4IOY X;  2OQB A;  1MPH A;  2IFS A;  4DXA B;  4KVG B;  1SGH A;  1FOE A;  4YON A;  5HE2 A;  2DX1 A;  4KAX B;  1E5W A;  2P0D A;  3ZDT A;  1Z87 A;  1TQZ A;  3AJ4 A;  2VSZ A;  3PVW A;  2V76 A;  2ROZ B;  2DHI A;  4F7U P;  2YVC A;  1XCG A;  2D2Q A;  1UPR A;  1KI1 B;  3F0W A;  1NI2 A;  1RJ2 A;  1GC6 A;  3GYO A;  3ULC A;  3DXD A;  1W1G A;  1XKE A;  2YSZ A;  3ULB A;  2EJ8 A;  4HAT B;  1DBH A;  2H7D A;  5DH9 B;  2COD A;  3D8E A;  4KHA A;  1NTY A;  1I2H A;  5HE3 A;  2COC A;  5HE0 A; 
#chains in the Genus database with same CATH topology
 1U5E A;  1UNQ A;  1Q67 A;  2D10 A;  4L6E A;  3U12 A;  5C16 A;  4H8S A;  2YT2 A;  2GUM A;  4HHV A;  1ZM0 A;  2DTC A;  1MK7 B;  1WI1 A;  2LOX A;  1TJ6 A;  2I5F A;  4HDO A;  2J59 M;  3UZT A;  1FHW A;  1U2B A;  3TW1 A;  2GCJ A;  2EMT A;  3PVU A;  1V5P A;  4NY0 A;  2LYD A;  2RVB B;  5DIF B;  2Q13 A;  2P0F A;  5C6R A;  5J3Q A;  5JHG A;  2RGN B;  1FGY A;  3U7D A;  2LOZ A;  5KQ1 A;  5DI9 B;  2DKQ A;  4XWX A;  4WSF A;  4HB0 B;  1MK9 B;  2Z0P A;  3SYX A;  4B6H A;  1M7E A;  3KSY A;  3QWM A;  1V61 A;  2RLO A;  3NW8 A;  5CLQ B;  2D9Z A;  1DDV A;  1XOD A;  2I1J A;  2N0Y A;  3N7C A;  4ZRJ A;  2UZS A;  4PNK A;  3U8Z A;  1MKE A;  2HTH B;  1N3H A;  5D3Y A;  5CLL B;  2HE7 A;  4HSI A;  2DYN A;  5KQ4 A;  2ELB A;  2K00 A;  1UPQ A;  2DA0 A;  2COA A;  2J0M A;  3HIE A;  3TCA A;  4GMX B;  2QKL A;  2RRF A;  2VRW B;  5LG4 B;  5HE1 A;  4CHJ A;  2W2X C;  4GXB A;  3SNH A;  1EAZ A;  3DXC A;  2N23 A;  1FHO A;  2DX5 A;  1U5F A;  2ZPY A;  1LB1 A;  2KUP A;  4A5K A;  2L2I A;  3SUZ A;  2K2U A;  1MAI A;  4IFS A;  4ZRI A;  2YF0 A;  2Z0O A;  3PSC A;  2E2X A;  2AEH A;  2Z0Q A;  4D0N B;  4BBK A;  1K5G B;  2YT1 A;  2YT0 A;  2IYB A;  4GNK B;  4A6F A;  2R09 A;  4KHO A;  1X86 A;  5J3T A;  1FHX A;  3MPX A;  2EC1 A;  2P0H A;  2Z13 A;  1BAK A;  5FI1 A;  5JLJ B;  1H4R A;  4KHB B;  3F5R A;  5C5B B;  1T77 A;  2MKR A;  3T06 A;  4F7G A;  4QJ4 B;  3FSS A;  1UNP A;  3TO1 A;  4PQ0 A;  5M4Y B;  3VOQ A;  2DN6 A;  3CXB B;  4P7I A;  3NWA A;  4HAV B;  2ZKM X;  3D8F A;  4DX9 0;  3KY9 A;  3PZD A;  1DRO A;  2J0J A;  1X05 A;  3AU4 A;  4HB3 B;  1AWE A;  1EVH A;  2D4Q A;  3NWF A;  2GJY A;  2R2Y A;  3HK0 A;  4HB4 B;  1I7A A;  3ODX A;  2R0D A;  3PEG A;  2NMB A;  5FI0 A;  3V5W A;  1DDW A;  2UVM A;  2PZ1 A;  1UEF A;  3WYF B;  2M38 A;  2KIG A;  2FJU B;  1KZG A;  2W2W A;  2M14 A;  3BIN A;  1ZC4 B;  1H10 A;  4A6F B;  2CRF A;  2K49 A;  1BTN A;  2K2J A;  4CSQ A;  3P7Z A;  5I2S A;  1U5G A;  5C79 A;  3P6A A;  3AU5 A;  4A6K A;  4Z2M B;  1ZC3 B;  3O96 A;  2QKM A;  4GPT B;  2KR0 A;  1V88 A;  2RNR B;  2BCJ A;  2G35 A;  5J3Y A;  3CIK A;  3MDB C;  3DXE A;  4MK0 A;  2L1C A;  3SV1 A;  4HAU B;  4HAW B;  3RCP A;  3NSU A;  3X23 A;  2UZR A;  2Y8G A;  4GOU A;  1FB8 A;  4WVF B;  1LW3 A;  4YL8 A;  5EFX A;  4EKU A;  3QIJ A;  1RRP B;  3PP2 A;  3A58 A;  1V5M A;  1QC6 A;  2Y7B A;  2W2X D;  2DFK A;  1P3R A;  1EF1 A;  2RSG A;  1NU2 A;  3A8P A;  4EJN A;  2GCL A;  4GMV A;  2D9X A;  3KZ1 A;  2YS5 A;  2D11 A;  3SO6 A;  4GZU A;  2K8E A;  5LON B;  5DHF B;  3PG7 A;  5L81 A;  2XQN M;  1K5D B;  1KZ7 A;  3TFM A;  1P5T A;  4L1R A;  4F7H A;  1X11 A;  2H7E A;  5D3X A;  1B55 A;  3FEH A;  4QJ3 B;  5KCV A;  3FM8 C;  2YS3 A;  4IAP A;  2I5C A;  2GS0 A;  4HDQ A;  1MI1 A;  3WA0 A;  5IRS A;  3D8D A;  1WGU A;  3NWD A;  4Y94 A;  4Z2N A;  2X18 A;  5JHH A;  1V89 A;  2KGX B;  1U29 A;  5JP4 A;  4K2P A;  2DLW A;  1PFJ A;  2CY5 A;  2OTX A;  2YS1 A;  2NBV A;  5I2M A;  2Z59 A;  1AQC A;  1MIZ B;  1J19 A;  2ELA A;  4K17 A;  4TYZ A;  1OY2 A;  2DHJ A;  2DHK A;  3VIA A;  4A6H A;  1X1F A;  2D9Y A;  1DDM A;  1XD4 A;  1GG3 A;  2RUK B;  5GOW B;  3ODW A;  1Y19 B;  1ISN A;  2D9W A;  2CAY A;  4TKN A;  1U5D A;  1PLS A;  4HAX B;  1WJM A;  2DYQ A;  1P6S A;  1FAO A;  2FJL A;  1MIX A;  1WJ1 A;  2J0K A;  4DX8 A;  1EGX A;  1UNR A;  1FGZ A;  3HW2 B;  2I1K A;  1W1D A;  3GYP A;  4EMO A;  3A8Q A;  2MWN B;  1PMS A;  1ZYI A;  1WGQ A;  3OHM B;  4HB2 B;  5D3V A;  2KUQ A;  3ODO A;  2ROV A;  1TXD A;  3G9W A;  4C0A A;  1SHC A;  1OMW A;  1Y5O A;  4HAY B;  3ZVR A;  1XX0 A;  5D3W A;  1NTV A;  4CYE A;  1DYN A;  2D9V A;  1BWN A;  2COF A;  1XR0 B;  2DKP A;  1BTK A;  2CY4 A;  4MT7 A;  1GC7 A;  1WVH A;  1ZSQ A;  3TVV A;  1J0W A;  4CHM A;  1M7R A;  1WG7 A;  4QJ5 B;  2LUL A;  3BJI A;  4DBB A;  2LG1 A;  2NZ8 B;  2Z14 A;  2Y8F A;  4HAZ B;  2EMS A;  1ZVR A;  3QBV B;  3OAN A;  2KCJ A;  1X1G A;  3M1I B;  1OQN A;  2ADZ A;  3LJU X;  5LOP B;  2MFQ A;  1QQG A;  4GN1 A;  1IRS A;  4DIX A;  2LKO A;  2YRY A;  2JP2 A;  3KRX A;  3A98 B;  4KHB A;  5D27 A;  5C5B A;  1U27 A;  4ZRK A;  3KRW A;  2VKI A;  1V5U A;  3IVF A;  2MDX A;  2AL6 A;  4K81 A;  4WJ7 A;  4NSW A;  4OT1 A;  1W1H A;  3PVL A;  3HQC A;  4MY6 A;  2P8V A;  4K2O A;  2Z4D A;  5DHA B;  3ML4 A;  4IOY X;  2OQB A;  4QXA B;  1MPH A;  2IFS A;  4OSN A;  4DXA B;  4KVG B;  1SGH A;  1FOE A;  4YON A;  5HE2 A;  2DX1 A;  4KAX B;  1E5W A;  2P0D A;  3FVC A;  3ZDT A;  1Z87 A;  1TQZ A;  3AJ4 A;  2VSZ A;  3PVW A;  2V76 A;  2ROZ B;  2DHI A;  4F7U P;  2YVC A;  1XCG A;  2D2Q A;  2KIE A;  3HSA A;  1UPR A;  1KI1 B;  3F0W A;  1NI2 A;  1RJ2 A;  1GC6 A;  3GYO A;  3ULC A;  3DXD A;  4D6W A;  3DCX A;  1W1G A;  1XKE A;  2YSZ A;  3ULB A;  2EJ8 A;  4HAT B;  1DBH A;  2H7D A;  5DH9 B;  2COD A;  3D8E A;  4KHA A;  1NTY A;  1I2H A;  3B77 A;  5HE3 A;  2COC A;  5HE0 A; 
#chains in the Genus database with same CATH homology
 1U5E A;  1UNQ A;  1Q67 A;  2D10 A;  4L6E A;  5C16 A;  4H8S A;  4HHV A;  1ZM0 A;  2DTC A;  1MK7 B;  1WI1 A;  2LOX A;  1TJ6 A;  2I5F A;  4HDO A;  2J59 M;  3UZT A;  1FHW A;  1U2B A;  3TW1 A;  2GCJ A;  2EMT A;  3PVU A;  1V5P A;  4NY0 A;  2LYD A;  2RVB B;  5DIF B;  2Q13 A;  2P0F A;  5C6R A;  5J3Q A;  5JHG A;  2RGN B;  1FGY A;  3U7D A;  2LOZ A;  5KQ1 A;  5DI9 B;  2DKQ A;  4XWX A;  4WSF A;  4HB0 B;  1MK9 B;  2Z0P A;  3SYX A;  4B6H A;  1M7E A;  3KSY A;  3QWM A;  1V61 A;  2RLO A;  5CLQ B;  2D9Z A;  1DDV A;  1XOD A;  2I1J A;  2N0Y A;  3N7C A;  4ZRJ A;  2UZS A;  4PNK A;  3U8Z A;  1MKE A;  2HTH B;  1N3H A;  5D3Y A;  5CLL B;  2HE7 A;  2DYN A;  5KQ4 A;  2ELB A;  2K00 A;  1UPQ A;  2DA0 A;  2COA A;  2J0M A;  3TCA A;  4GMX B;  2QKL A;  2VRW B;  5HE1 A;  4CHJ A;  2W2X C;  4GXB A;  3SNH A;  1EAZ A;  3DXC A;  2N23 A;  1FHO A;  2DX5 A;  1U5F A;  2ZPY A;  1LB1 A;  2KUP A;  4A5K A;  2L2I A;  3SUZ A;  2K2U A;  1MAI A;  4IFS A;  4ZRI A;  2YF0 A;  2Z0O A;  3PSC A;  2E2X A;  2AEH A;  2Z0Q A;  4D0N B;  4BBK A;  1K5G B;  2YT1 A;  2YT0 A;  2IYB A;  4A6F A;  2R09 A;  4KHO A;  1X86 A;  5J3T A;  1FHX A;  3MPX A;  2EC1 A;  2P0H A;  1BAK A;  5FI1 A;  5JLJ B;  1H4R A;  4KHB B;  3F5R A;  5C5B B;  2MKR A;  3T06 A;  4F7G A;  3FSS A;  1UNP A;  3TO1 A;  4PQ0 A;  3VOQ A;  2DN6 A;  3CXB B;  4P7I A;  4HAV B;  3D8F A;  4DX9 0;  3KY9 A;  3PZD A;  1DRO A;  2J0J A;  1X05 A;  3AU4 A;  4HB3 B;  1AWE A;  1EVH A;  2D4Q A;  2GJY A;  3HK0 A;  4HB4 B;  1I7A A;  3ODX A;  2R0D A;  3PEG A;  2NMB A;  5FI0 A;  3V5W A;  1DDW A;  2UVM A;  2PZ1 A;  1UEF A;  3WYF B;  2M38 A;  1KZG A;  2W2W A;  2M14 A;  3BIN A;  1ZC4 B;  1H10 A;  4A6F B;  2CRF A;  1BTN A;  2K2J A;  3P7Z A;  1U5G A;  5C79 A;  3P6A A;  3AU5 A;  4A6K A;  4Z2M B;  1ZC3 B;  3O96 A;  2QKM A;  4GPT B;  1V88 A;  2RNR B;  2BCJ A;  2G35 A;  5J3Y A;  3CIK A;  3MDB C;  3DXE A;  4MK0 A;  2L1C A;  3SV1 A;  4HAU B;  4HAW B;  3RCP A;  3NSU A;  3X23 A;  2UZR A;  2Y8G A;  1FB8 A;  4WVF B;  1LW3 A;  4YL8 A;  5EFX A;  4EKU A;  3QIJ A;  1RRP B;  3PP2 A;  1V5M A;  1QC6 A;  2Y7B A;  2W2X D;  2DFK A;  1P3R A;  1EF1 A;  2RSG A;  1NU2 A;  3A8P A;  4EJN A;  2GCL A;  4GMV A;  2D9X A;  3KZ1 A;  2YS5 A;  2D11 A;  3SO6 A;  4GZU A;  5LON B;  5DHF B;  3PG7 A;  5L81 A;  2XQN M;  1K5D B;  1KZ7 A;  3TFM A;  1P5T A;  4F7H A;  1X11 A;  2H7E A;  5D3X A;  1B55 A;  3FEH A;  5KCV A;  3FM8 C;  2YS3 A;  4IAP A;  2I5C A;  2GS0 A;  4HDQ A;  3WA0 A;  3D8D A;  1WGU A;  4Y94 A;  4Z2N A;  2X18 A;  5JHH A;  1V89 A;  2KGX B;  1U29 A;  5JP4 A;  4K2P A;  2DLW A;  1PFJ A;  2CY5 A;  2OTX A;  2YS1 A;  1AQC A;  1MIZ B;  1J19 A;  2ELA A;  4K17 A;  4TYZ A;  1OY2 A;  2DHJ A;  2DHK A;  3VIA A;  4A6H A;  1X1F A;  2D9Y A;  1DDM A;  1XD4 A;  1GG3 A;  2RUK B;  5GOW B;  3ODW A;  1Y19 B;  1ISN A;  2D9W A;  2CAY A;  4TKN A;  1U5D A;  1PLS A;  4HAX B;  1WJM A;  2DYQ A;  1P6S A;  1FAO A;  2FJL A;  1MIX A;  1WJ1 A;  2J0K A;  4DX8 A;  1EGX A;  1UNR A;  1FGZ A;  3HW2 B;  2I1K A;  1W1D A;  3GYP A;  4EMO A;  3A8Q A;  2MWN B;  1PMS A;  1WGQ A;  4HB2 B;  5D3V A;  3ODO A;  2ROV A;  1TXD A;  3G9W A;  4C0A A;  1SHC A;  1OMW A;  1Y5O A;  4HAY B;  3ZVR A;  1XX0 A;  5D3W A;  1NTV A;  4CYE A;  1DYN A;  2D9V A;  1BWN A;  2COF A;  1XR0 B;  2DKP A;  1BTK A;  2CY4 A;  4MT7 A;  1GC7 A;  1WVH A;  1ZSQ A;  3TVV A;  1J0W A;  4CHM A;  1M7R A;  1WG7 A;  2LUL A;  3BJI A;  4DBB A;  2LG1 A;  2NZ8 B;  2Y8F A;  4HAZ B;  2EMS A;  1ZVR A;  3QBV B;  3OAN A;  2KCJ A;  1X1G A;  3M1I B;  1OQN A;  2ADZ A;  3LJU X;  5LOP B;  2MFQ A;  1QQG A;  4GN1 A;  1IRS A;  2LKO A;  2YRY A;  2JP2 A;  3KRX A;  3A98 B;  5D27 A;  5C5B A;  1U27 A;  4ZRK A;  3KRW A;  2VKI A;  1V5U A;  3IVF A;  2MDX A;  2AL6 A;  4K81 A;  4WJ7 A;  4NSW A;  1W1H A;  3PVL A;  3HQC A;  4MY6 A;  2P8V A;  4K2O A;  5DHA B;  3ML4 A;  4IOY X;  2OQB A;  1MPH A;  2IFS A;  4DXA B;  4KVG B;  1SGH A;  1FOE A;  4YON A;  5HE2 A;  2DX1 A;  4KAX B;  1E5W A;  2P0D A;  3ZDT A;  1Z87 A;  1TQZ A;  3AJ4 A;  2VSZ A;  3PVW A;  2V76 A;  2ROZ B;  2DHI A;  4F7U P;  2YVC A;  1XCG A;  2D2Q A;  1UPR A;  1KI1 B;  3F0W A;  1NI2 A;  1RJ2 A;  1GC6 A;  3GYO A;  3ULC A;  3DXD A;  1W1G A;  1XKE A;  2YSZ A;  3ULB A;  2EJ8 A;  4HAT B;  1DBH A;  2H7D A;  5DH9 B;  2COD A;  3D8E A;  4KHA A;  1NTY A;  1I2H A;  5HE3 A;  2COC A;  5HE0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...