2RLOA

Split ph domain of pi3-kinase enhancer
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
128
structure length
128
Chain Sequence
b'RAIPIKQSFLLKRSGNSLNKEWKKKYVTLSSNGFLLYHPSINDYIHSTHGKEMDLLRTTVKVPGKRPPRAISAFGPSASGSAGQAEEENFEFLIVSSTGQTWHFEAASFEERDAWVQAIESQILASLQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Centaurin-gamma 1
publication title Split pleckstrin homology domain-mediated cytoplasmic-nuclear localization of PI3-kinase enhancer GTPase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 17
structure length 128
sequence length 128
ec nomenclature
pdb deposition date 2007-07-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2rloA00
2VSZA 4CHMA 2I5CA 3F5RA 5DHAB 1U5GA 3F0WA 1M7EA 3U7DA 1EGXA 1DBHA 3SNHA 2X18A 4A6FB 2D11A 4K2OA 1U2BA 1V89A 3T06A 3TCAA 2IFSA 2L2IA 2ELBA 3D8FA 2NZ8B 4PQ0A 2COAA 2GCJA 2YT0A 5J3QA 2D9VA 1P5TA 4HB0B 1KZGA 2DA0A 2DX1A 3TFMA 2D4QA 1LW3A 3ZDTA 1FAOA 1DDMA 2ROVA 2R09A 1WI1A 2LG1A 4HAYB 5DHFB 4F7GA 3P7ZA 5J3TA 3GYOA 2N23A 1V5UA 4A6KA 1N3HA 3D8DA 3HK0A 1BWNA 4K2PA 2UVMA 2VKIA 1BAKA 2NMBA 1Y5OA 4IAPA 5HE0A 1W1HA 2G35A 2J59M 2VRWB 1WGUA 1UNRA 2J0JA 2N0YA 2W2XC 4WJ7A 1BTNA 1UNQA 2K2JA 1E5WA 3PZDA 4P7IA 4HAXB 5D27A 4WVFB 3SV1A 2IYBA 4TYZA 3VOQA 2K00A 2Q13A 4HB4B 2W2XD 2D2QA 1H10A 3ULCA 3M1IB 5D3XA 3PG7A 2DKPA 2P0FA 3KRXA 2LOXA 4NY0A 4MY6A 1KZ7A 2P8VA 3PVWA 1QQGA 2ELAA 3ODOA 3IVFA 4HDQA 2FJLA 2J0MA 2DTCA 3TW1A 2I1JA 3A98B 4K17A 2EC1A 4D0NB 5JP4A 1KI1B 2RNRB 2HE7A 2LOZA 2K2UA 5C5BA 4EJNA 5CLLB 2GS0A 2E2XA 3V5WA 2DX5A 2MFQA 4GMVA 4EKUA 1GG3A 1B55A 2Z0PA 2CRFA 4DX8A 1TQZA 4IFSA 2LYDA 4KVGB 1NTVA 2YT1A 3ML4A 4YONA 2LKOA 2RLOA 1LB1A 1DYNA 4H8SA 5DIFB 3G9WA 3TVVA 2L1CA 1W1GA 2QKMA 1I2HA 1MIZB 1ZVRA 4L6EA 1FHOA 4Z2MB 2DHIA 3A8QA 3PVLA 5C16A 4NSWA 1J19A 4HAZB 2UZRA 5CLQB 4KHAA 4MT7A 3A8PA 4HAWB 4GPTB 1MPHA 1WGQA 4GXBA 5GOWB 5KCVA 3PP2A 2LULA 2CODA 2EMTA 3DXDA 3RCPA 1Z87A 1WJMA 5KQ4A 1FHWA 2M38A 1PMSA 3KSYA 2I5FA 2ROZB 5J3YA 1FGZA 2EJ8A 1OQNA 3U8ZA 2W2WA 1AWEA 1DDWA 2KUPA 2MKRA 3LJUX 4GN1A 5HE1A 3CIKA 5DI9B 3ZVRA 4HAVB 3NSUA 1MK7B 1NU2A 5L81A 2PZ1A 5KQ1A 4C0AA 1WG7A 1MK9B 1P6SA 3KRWA 2ADZA 1U27A 2YS1A 3HW2B 2D9WA 1I7AA 1NTYA 1GC6A 1DROA 2BCJA 2DLWA 1V5MA 1P3RA 4GMXB 1Q67A 2H7DA 3QBVB 4ZRIA 1FGYA 1U5EA 1PLSA 2CAYA 5EFXA 3ODWA 2YRYA 1MKEA 1BTKA 2RGNB 2J0KA 1UNPA 4A5KA 1IRSA 1X86A 2DN6A 3HQCA 1XX0A 3X23A 2JP2A 2KCJA 2Z0OA 3BINA 2XQNM 4F7HA 5C79A 1X1GA 1X1FA 2P0DA 2MWNB 5JHHA 1TJ6A 3AU5A 3PSCA 2RSGA 3FSSA 3KY9A 1V88A 3AU4A 2AEHA 3UZTA 3TO1A 1WVHA 2EMSA 2OTXA 5C5BB 1RJ2A 2GCLA 2Z0QA 1H4RA 3DXEA 2D9ZA 3MPXA 4HATB 1NI2A 4HDOA 1EF1A 3AJ4A 3SYXA 5FI1A 1SHCA 1XKEA 2D9XA 1X05A 3BJIA 1SGHA 1U5FA 1XD4A 2Y8GA 1U5DA 1OY2A 3ODXA 1J0WA 4KHOA 4IOYX 1RRPB 5FI0A 2CY4A 2R0DA 4BBKA 3D8EA 4ZRJA 1Y19B 3P6AA 4K81A 3PVUA 4PNKA 2COCA 3FEHA 1EVHA 1FOEA 3MDBC 4B6HA 5LONB 1X11A 1M7RA 1PFJA 3VIAA 3DXCA 2Y8FA 4KHBB 4HAUB 2H7EA 2I1KA 1XCGA 4CHJA 4GZUA 3SO6A 1W1DA 2DYQA 1ZC4B 2Y7BA 3QWMA 4YL8A 2D10A 4EMOA 1U29A 2UZSA 2OQBA 2RVBB 5D3VA 1FHXA 1MAIA 4HB3B 3N7CA 2YF0A 1XR0B 1ZSQA 4Y94A 1V5PA 2DFKA 1ISNA 1XODA 1UPRA 1ZC3B 2AL6A 2RUKB 2MDXA 2DHKA 2KGXB 2P0HA 5HE3A 5C6RA 1OMWA 3PEGA 4Z2NA 2YSZA 5HE2A 3FM8C 3WA0A 1QC6A 2YVCA 1EAZA 3OANA 2D9YA 1WJ1A 1DDVA 2YS3A 4A6HA 4TKNA 4DXAB 4XWXA 4KAXB 2M14A 2YS5A 5JLJB 4HHVA 5DH9B 1TXDA 3CXBB 1AQCA 4F7UP 1GC7A 4CYEA 1ZM0A 3WYFB 2HTHB 5D3YA 5LOPB 1V61A 4HB2B 3GYPA 2ZPYA 3SUZA 2V76A 5D3WA 4DX90 1FB8A 2GJYA 4A6FA 2CY5A 1K5DB 3KZ1A 4MK0A 4DBBA 2DKQA 1MIXA 4WSFA 3ULBA 2DYNA 1UPQA 2QKLA 5JHGA 4ZRKA 1K5GB 3O96A 2COFA 2DHJA 3QIJA 1UEFA
chains in the Genus database with same CATH superfamily
2VSZA 4CHMA 2FJUB 2I5CA 3F5RA 5DHAB 1U5GA 3F0WA 4QJ3B 1M7EA 3U7DA 1EGXA 1DBHA 3SNHA 2X18A 4A6FB 2D11A 4K2OA 1U2BA 1V89A 2KR0A 3T06A 3TCAA 2NBVA 2IFSA 2L2IA 2ELBA 3D8FA 2NZ8B 4PQ0A 2COAA 2GCJA 2YT0A 5J3QA 2D9VA 1P5TA 4HB0B 1KZGA 2DA0A 2DX1A 3TFMA 2D4QA 1LW3A 3ZDTA 1FAOA 1DDMA 2ROVA 2R09A 1WI1A 2LG1A 4HAYB 5DHFB 4F7GA 3P7ZA 5J3TA 2Z59A 3GYOA 2N23A 1V5UA 4A6KA 1N3HA 3D8DA 3HK0A 1BWNA 4K2PA 2UVMA 2K49A 2VKIA 1BAKA 2NMBA 1Y5OA 2Z14A 4IAPA 5HE0A 1W1HA 2G35A 2J59M 2VRWB 1WGUA 1UNRA 2J0JA 2N0YA 2W2XC 2RRFA 4WJ7A 1BTNA 1UNQA 2K2JA 1E5WA 3PZDA 4P7IA 4HAXB 5D27A 4WVFB 3SV1A 2IYBA 4TYZA 3VOQA 2K00A 2Q13A 4HB4B 2W2XD 2D2QA 3B77A 1H10A 3ULCA 3M1IB 5D3XA 3PG7A 2DKPA 2P0FA 3KRXA 2LOXA 4NY0A 4MY6A 1KZ7A 2P8VA 3PVWA 1QQGA 2ELAA 3ODOA 3IVFA 4HDQA 2FJLA 2J0MA 2DTCA 3TW1A 2I1JA 3A98B 4K17A 2EC1A 4D0NB 5JP4A 1KI1B 4GNKB 2RNRB 2HE7A 2LOZA 2K2UA 5C5BA 4EJNA 5CLLB 2GS0A 2E2XA 3V5WA 2DX5A 2MFQA 4GMVA 4EKUA 1GG3A 1B55A 2Z0PA 2CRFA 4DX8A 1TQZA 4IFSA 2LYDA 4KVGB 1NTVA 2YT1A 3ML4A 4YONA 2LKOA 2RLOA 1LB1A 1DYNA 4H8SA 5DIFB 3G9WA 3TVVA 2L1CA 1W1GA 2QKMA 1I2HA 1MIZB 2KIGA 1ZVRA 4L6EA 1FHOA 4Z2MB 3FVCA 2DHIA 3A8QA 3PVLA 5C16A 4NSWA 1J19A 4HAZB 2UZRA 5CLQB 4KHAA 4CSQA 4MT7A 3A8PA 4HAWB 4GPTB 1MPHA 3HSAA 1WGQA 4GXBA 5GOWB 5KCVA 3PP2A 2LULA 2CODA 2EMTA 3DXDA 3RCPA 1Z87A 1WJMA 5KQ4A 1FHWA 2KIEA 2M38A 1PMSA 3KSYA 2I5FA 2ROZB 5J3YA 1FGZA 2EJ8A 1OQNA 3U8ZA 2W2WA 1AWEA 1DDWA 2KUPA 2MKRA 3LJUX 4GN1A 5HE1A 3CIKA 5DI9B 3ZVRA 4HAVB 3NSUA 1MK7B 1NU2A 5L81A 2KUQA 2PZ1A 5KQ1A 2K8EA 4C0AA 1WG7A 1MK9B 1P6SA 3KRWA 2ADZA 1U27A 4D6WA 1MI1A 2YS1A 3HW2B 2D9WA 1I7AA 1NTYA 1GC6A 1DROA 2BCJA 2DLWA 1V5MA 1P3RA 4GMXB 1Q67A 2H7DA 3HIEA 3QBVB 4ZRIA 1FGYA 1U5EA 1PLSA 2CAYA 5EFXA 3ODWA 2YRYA 3NW8A 1MKEA 1BTKA 2RGNB 2J0KA 1UNPA 4A5KA 1IRSA 4L1RA 1X86A 2DN6A 3HQCA 1XX0A 3X23A 2JP2A 2KCJA 2Z0OA 2GUMA 3BINA 2XQNM 4F7HA 5C79A 5IRSA 1X1GA 1X1FA 2P0DA 2MWNB 5M4YB 5JHHA 1TJ6A 3AU5A 3PSCA 2RSGA 3OHMB 3FSSA 3KY9A 1V88A 3AU4A 2AEHA 3U12A 3UZTA 3TO1A 1WVHA 2EMSA 2OTXA 5C5BB 1RJ2A 2GCLA 2Z0QA 1H4RA 3DXEA 2D9ZA 3MPXA 4GOUA 4OT1A 4HATB 4HSIA 1NI2A 4HDOA 1EF1A 3AJ4A 5I2SA 3SYXA 2ZKMX 5FI1A 4KHBA 1SHCA 1XKEA 2D9XA 1X05A 3BJIA 1SGHA 1U5FA 1XD4A 2Y8GA 1U5DA 1OY2A 3ODXA 1J0WA 4KHOA 4IOYX 1RRPB 5FI0A 2CY4A 2R0DA 4BBKA 3D8EA 4ZRJA 1Y19B 3P6AA 4OSNA 4K81A 5LG4B 3PVUA 4PNKA 2COCA 3FEHA 1EVHA 1FOEA 3MDBC 4DIXA 4B6HA 5LONB 1X11A 1M7RA 1PFJA 3VIAA 3DXCA 1T77A 2Y8FA 4KHBB 5I2MA 4HAUB 2H7EA 2I1KA 1XCGA 4CHJA 4GZUA 3SO6A 1W1DA 2DYQA 1ZC4B 2Y7BA 3QWMA 4YL8A 3NWFA 2D10A 2R2YA 4EMOA 1U29A 2UZSA 2OQBA 2RVBB 5D3VA 1FHXA 1MAIA 4HB3B 3N7CA 2YF0A 1XR0B 1ZSQA 4Y94A 1V5PA 2DFKA 1ISNA 1XODA 1UPRA 1ZC3B 2AL6A 2RUKB 2MDXA 2DHKA 2KGXB 2P0HA 3NWAA 4QXAB 5HE3A 5C6RA 1OMWA 3PEGA 4Z2NA 2YSZA 5HE2A 3FM8C 3WA0A 1QC6A 1ZYIA 2YVCA 1EAZA 3OANA 4QJ5B 2D9YA 1WJ1A 1DDVA 2YS3A 4A6HA 4TKNA 4DXAB 4QJ4B 4XWXA 4KAXB 2M14A 2YS5A 5JLJB 2Z13A 4HHVA 3A58A 2YT2A 5DH9B 1TXDA 3CXBB 1AQCA 4F7UP 1GC7A 4CYEA 1ZM0A 3WYFB 2HTHB 5D3YA 5LOPB 1V61A 4HB2B 3GYPA 2ZPYA 3SUZA 2V76A 5D3WA 3DCXA 3NWDA 2Z4DA 1FB8A 2GJYA 4DX90 4A6FA 2CY5A 1K5DB 3KZ1A 4MK0A 4DBBA 2DKQA 1MIXA 4WSFA 3ULBA 2DYNA 1UPQA 2QKLA 5JHGA 4ZRKA 1K5GB 3O96A 2COFA 2DHJA 3QIJA 1UEFA
chains in the Genus database with same CATH topology
2VSZA 4CHMA 2I5CA 3F5RA 5DHAB 1U5GA 3F0WA 1M7EA 3U7DA 1EGXA 1DBHA 3SNHA 2X18A 4A6FB 2D11A 4K2OA 1U2BA 1V89A 3T06A 3TCAA 2IFSA 2L2IA 2ELBA 3D8FA 2NZ8B 4PQ0A 2COAA 2GCJA 2YT0A 5J3QA 2D9VA 1P5TA 4HB0B 1KZGA 2DA0A 2DX1A 3TFMA 2D4QA 1LW3A 3ZDTA 1FAOA 1DDMA 2ROVA 2R09A 1WI1A 2LG1A 4HAYB 5DHFB 4F7GA 3P7ZA 5J3TA 3GYOA 2N23A 1V5UA 4A6KA 1N3HA 3D8DA 3HK0A 1BWNA 4K2PA 2UVMA 2VKIA 1BAKA 2NMBA 1Y5OA 4IAPA 5HE0A 1W1HA 2G35A 2J59M 2VRWB 1WGUA 1UNRA 2J0JA 2N0YA 2W2XC 4WJ7A 1BTNA 1UNQA 2K2JA 1E5WA 3PZDA 4P7IA 4HAXB 5D27A 4WVFB 3SV1A 2IYBA 4TYZA 3VOQA 2K00A 2Q13A 4HB4B 2W2XD 2D2QA 1H10A 3ULCA 3M1IB 5D3XA 3PG7A 2DKPA 2P0FA 3KRXA 2LOXA 4NY0A 4MY6A 1KZ7A 2P8VA 3PVWA 1QQGA 2ELAA 3ODOA 3IVFA 4HDQA 2FJLA 2J0MA 2DTCA 3TW1A 2I1JA 3A98B 4K17A 2EC1A 4D0NB 5JP4A 1KI1B 2RNRB 2HE7A 2LOZA 2K2UA 5C5BA 4EJNA 5CLLB 2GS0A 2E2XA 3V5WA 2DX5A 2MFQA 4GMVA 4EKUA 1GG3A 1B55A 2Z0PA 2CRFA 4DX8A 1TQZA 4IFSA 2LYDA 4KVGB 1NTVA 2YT1A 3ML4A 4YONA 2LKOA 2RLOA 1LB1A 1DYNA 4H8SA 5DIFB 3G9WA 3TVVA 2L1CA 1W1GA 2QKMA 1I2HA 1MIZB 1ZVRA 4L6EA 1FHOA 4Z2MB 2DHIA 3A8QA 3PVLA 5C16A 4NSWA 1J19A 4HAZB 2UZRA 5CLQB 4KHAA 4MT7A 3A8PA 4HAWB 4GPTB 1MPHA 1WGQA 4GXBA 5GOWB 5KCVA 3PP2A 2LULA 2CODA 2EMTA 3DXDA 3RCPA 1Z87A 1WJMA 5KQ4A 1FHWA 2M38A 1PMSA 3KSYA 2I5FA 2ROZB 5J3YA 1FGZA 2EJ8A 1OQNA 3U8ZA 2W2WA 1AWEA 1DDWA 2KUPA 2MKRA 3LJUX 4GN1A 5HE1A 3CIKA 5DI9B 3ZVRA 4HAVB 3NSUA 1MK7B 1NU2A 5L81A 2PZ1A 5KQ1A 4C0AA 1WG7A 1MK9B 1P6SA 3KRWA 2ADZA 1U27A 2YS1A 3HW2B 2D9WA 1I7AA 1NTYA 1GC6A 1DROA 2BCJA 2DLWA 1V5MA 1P3RA 4GMXB 1Q67A 2H7DA 3QBVB 4ZRIA 1FGYA 1U5EA 1PLSA 2CAYA 5EFXA 3ODWA 2YRYA 1MKEA 1BTKA 2RGNB 2J0KA 1UNPA 4A5KA 1IRSA 1X86A 2DN6A 3HQCA 1XX0A 3X23A 2JP2A 2KCJA 2Z0OA 3BINA 2XQNM 4F7HA 5C79A 1X1GA 1X1FA 2P0DA 2MWNB 5JHHA 1TJ6A 3AU5A 3PSCA 2RSGA 3FSSA 3KY9A 1V88A 3AU4A 2AEHA 3UZTA 3TO1A 1WVHA 2EMSA 2OTXA 5C5BB 1RJ2A 2GCLA 2Z0QA 1H4RA 3DXEA 2D9ZA 3MPXA 4HATB 1NI2A 4HDOA 1EF1A 3AJ4A 3SYXA 5FI1A 1SHCA 1XKEA 2D9XA 1X05A 3BJIA 1SGHA 1U5FA 1XD4A 2Y8GA 1U5DA 1OY2A 3ODXA 1J0WA 4KHOA 4IOYX 1RRPB 5FI0A 2CY4A 2R0DA 4BBKA 3D8EA 4ZRJA 1Y19B 3P6AA 4K81A 3PVUA 4PNKA 2COCA 3FEHA 1EVHA 1FOEA 3MDBC 4B6HA 5LONB 1X11A 1M7RA 1PFJA 3VIAA 3DXCA 2Y8FA 4KHBB 4HAUB 2H7EA 2I1KA 1XCGA 4CHJA 4GZUA 3SO6A 1W1DA 2DYQA 1ZC4B 2Y7BA 3QWMA 4YL8A 2D10A 4EMOA 1U29A 2UZSA 2OQBA 2RVBB 5D3VA 1FHXA 1MAIA 4HB3B 3N7CA 2YF0A 1XR0B 1ZSQA 4Y94A 1V5PA 2DFKA 1ISNA 1XODA 1UPRA 1ZC3B 2AL6A 2RUKB 2MDXA 2DHKA 2KGXB 2P0HA 5HE3A 5C6RA 1OMWA 3PEGA 4Z2NA 2YSZA 5HE2A 3FM8C 3WA0A 1QC6A 2YVCA 1EAZA 3OANA 2D9YA 1WJ1A 1DDVA 2YS3A 4A6HA 4TKNA 4DXAB 4XWXA 4KAXB 2M14A 2YS5A 5JLJB 4HHVA 5DH9B 1TXDA 3CXBB 1AQCA 4F7UP 1GC7A 4CYEA 1ZM0A 3WYFB 2HTHB 5D3YA 5LOPB 1V61A 4HB2B 3GYPA 2ZPYA 3SUZA 2V76A 5D3WA 4DX90 1FB8A 2GJYA 4A6FA 2CY5A 1K5DB 3KZ1A 4MK0A 4DBBA 2DKQA 1MIXA 4WSFA 3ULBA 2DYNA 1UPQA 2QKLA 5JHGA 4ZRKA 1K5GB 3O96A 2COFA 2DHJA 3QIJA 1UEFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VSZ A;  4CHM A;  2I5C A;  3F5R A;  5DHA B;  1U5G A;  3F0W A;  1M7E A;  3U7D A;  1EGX A;  1DBH A;  3SNH A;  2X18 A;  4A6F B;  2D11 A;  4K2O A;  1U2B A;  1V89 A;  3T06 A;  3TCA A;  2IFS A;  2L2I A;  2ELB A;  3D8F A;  2NZ8 B;  4PQ0 A;  2COA A;  2GCJ A;  2YT0 A;  5J3Q A;  2D9V A;  1P5T A;  4HB0 B;  1KZG A;  2DA0 A;  2DX1 A;  3TFM A;  2D4Q A;  1LW3 A;  3ZDT A;  1FAO A;  1DDM A;  2ROV A;  2R09 A;  1WI1 A;  2LG1 A;  4HAY B;  5DHF B;  4F7G A;  3P7Z A;  5J3T A;  3GYO A;  2N23 A;  1V5U A;  4A6K A;  1N3H A;  3D8D A;  3HK0 A;  1BWN A;  4K2P A;  2UVM A;  2VKI A;  1BAK A;  2NMB A;  1Y5O A;  4IAP A;  5HE0 A;  1W1H A;  2G35 A;  2J59 M;  2VRW B;  1WGU A;  1UNR A;  2J0J A;  2N0Y A;  2W2X C;  4WJ7 A;  1BTN A;  1UNQ A;  2K2J A;  1E5W A;  3PZD A;  4P7I A;  4HAX B;  5D27 A;  4WVF B;  3SV1 A;  2IYB A;  4TYZ A;  3VOQ A;  2K00 A;  2Q13 A;  4HB4 B;  2W2X D;  2D2Q A;  1H10 A;  3ULC A;  3M1I B;  5D3X A;  3PG7 A;  2DKP A;  2P0F A;  3KRX A;  2LOX A;  4NY0 A;  4MY6 A;  1KZ7 A;  2P8V A;  3PVW A;  1QQG A;  2ELA A;  3ODO A;  3IVF A;  4HDQ A;  2FJL A;  2J0M A;  2DTC A;  3TW1 A;  2I1J A;  3A98 B;  4K17 A;  2EC1 A;  4D0N B;  5JP4 A;  1KI1 B;  2RNR B;  2HE7 A;  2LOZ A;  2K2U A;  5C5B A;  4EJN A;  5CLL B;  2GS0 A;  2E2X A;  3V5W A;  2DX5 A;  2MFQ A;  4GMV A;  4EKU A;  1GG3 A;  1B55 A;  2Z0P A;  2CRF A;  4DX8 A;  1TQZ A;  4IFS A;  2LYD A;  4KVG B;  1NTV A;  2YT1 A;  3ML4 A;  4YON A;  2LKO A;  2RLO A;  1LB1 A;  1DYN A;  4H8S A;  5DIF B;  3G9W A;  3TVV A;  2L1C A;  1W1G A;  2QKM A;  1I2H A;  1MIZ B;  1ZVR A;  4L6E A;  1FHO A;  4Z2M B;  2DHI A;  3A8Q A;  3PVL A;  5C16 A;  4NSW A;  1J19 A;  4HAZ B;  2UZR A;  5CLQ B;  4KHA A;  4MT7 A;  3A8P A;  4HAW B;  4GPT B;  1MPH A;  1WGQ A;  4GXB A;  5GOW B;  5KCV A;  3PP2 A;  2LUL A;  2COD A;  2EMT A;  3DXD A;  3RCP A;  1Z87 A;  1WJM A;  5KQ4 A;  1FHW A;  2M38 A;  1PMS A;  3KSY A;  2I5F A;  2ROZ B;  5J3Y A;  1FGZ A;  2EJ8 A;  1OQN A;  3U8Z A;  2W2W A;  1AWE A;  1DDW A;  2KUP A;  2MKR A;  3LJU X;  4GN1 A;  5HE1 A;  3CIK A;  5DI9 B;  3ZVR A;  4HAV B;  3NSU A;  1MK7 B;  1NU2 A;  5L81 A;  2PZ1 A;  5KQ1 A;  4C0A A;  1WG7 A;  1MK9 B;  1P6S A;  3KRW A;  2ADZ A;  1U27 A;  2YS1 A;  3HW2 B;  2D9W A;  1I7A A;  1NTY A;  1GC6 A;  1DRO A;  2BCJ A;  2DLW A;  1V5M A;  1P3R A;  4GMX B;  1Q67 A;  2H7D A;  3QBV B;  4ZRI A;  1FGY A;  1U5E A;  1PLS A;  2CAY A;  5EFX A;  3ODW A;  2YRY A;  1MKE A;  1BTK A;  2RGN B;  2J0K A;  1UNP A;  4A5K A;  1IRS A;  1X86 A;  2DN6 A;  3HQC A;  1XX0 A;  3X23 A;  2JP2 A;  2KCJ A;  2Z0O A;  3BIN A;  2XQN M;  4F7H A;  5C79 A;  1X1G A;  1X1F A;  2P0D A;  2MWN B;  5JHH A;  1TJ6 A;  3AU5 A;  3PSC A;  2RSG A;  3FSS A;  3KY9 A;  1V88 A;  3AU4 A;  2AEH A;  3UZT A;  3TO1 A;  1WVH A;  2EMS A;  2OTX A;  5C5B B;  1RJ2 A;  2GCL A;  2Z0Q A;  1H4R A;  3DXE A;  2D9Z A;  3MPX A;  4HAT B;  1NI2 A;  4HDO A;  1EF1 A;  3AJ4 A;  3SYX A;  5FI1 A;  1SHC A;  1XKE A;  2D9X A;  1X05 A;  3BJI A;  1SGH A;  1U5F A;  1XD4 A;  2Y8G A;  1U5D A;  1OY2 A;  3ODX A;  1J0W A;  4KHO A;  4IOY X;  1RRP B;  5FI0 A;  2CY4 A;  2R0D A;  4BBK A;  3D8E A;  4ZRJ A;  1Y19 B;  3P6A A;  4K81 A;  3PVU A;  4PNK A;  2COC A;  3FEH A;  1EVH A;  1FOE A;  3MDB C;  4B6H A;  5LON B;  1X11 A;  1M7R A;  1PFJ A;  3VIA A;  3DXC A;  2Y8F A;  4KHB B;  4HAU B;  2H7E A;  2I1K A;  1XCG A;  4CHJ A;  4GZU A;  3SO6 A;  1W1D A;  2DYQ A;  1ZC4 B;  2Y7B A;  3QWM A;  4YL8 A;  2D10 A;  4EMO A;  1U29 A;  2UZS A;  2OQB A;  2RVB B;  5D3V A;  1FHX A;  1MAI A;  4HB3 B;  3N7C A;  2YF0 A;  1XR0 B;  1ZSQ A;  4Y94 A;  1V5P A;  2DFK A;  1ISN A;  1XOD A;  1UPR A;  1ZC3 B;  2AL6 A;  2RUK B;  2MDX A;  2DHK A;  2KGX B;  2P0H A;  5HE3 A;  5C6R A;  1OMW A;  3PEG A;  4Z2N A;  2YSZ A;  5HE2 A;  3FM8 C;  3WA0 A;  1QC6 A;  2YVC A;  1EAZ A;  3OAN A;  2D9Y A;  1WJ1 A;  1DDV A;  2YS3 A;  4A6H A;  4TKN A;  4DXA B;  4XWX A;  4KAX B;  2M14 A;  2YS5 A;  5JLJ B;  4HHV A;  5DH9 B;  1TXD A;  3CXB B;  1AQC A;  4F7U P;  1GC7 A;  4CYE A;  1ZM0 A;  3WYF B;  2HTH B;  5D3Y A;  5LOP B;  1V61 A;  4HB2 B;  3GYP A;  2ZPY A;  3SUZ A;  2V76 A;  5D3W A;  4DX9 0;  1FB8 A;  2GJY A;  4A6F A;  2CY5 A;  1K5D B;  3KZ1 A;  4MK0 A;  4DBB A;  2DKQ A;  1MIX A;  4WSF A;  3ULB A;  2DYN A;  1UPQ A;  2QKL A;  5JHG A;  4ZRK A;  1K5G B;  3O96 A;  2COF A;  2DHJ A;  3QIJ A;  1UEF A; 
#chains in the Genus database with same CATH topology
 2VSZ A;  4CHM A;  2FJU B;  2I5C A;  3F5R A;  5DHA B;  1U5G A;  3F0W A;  4QJ3 B;  1M7E A;  3U7D A;  1EGX A;  1DBH A;  3SNH A;  2X18 A;  4A6F B;  2D11 A;  4K2O A;  1U2B A;  1V89 A;  2KR0 A;  3T06 A;  3TCA A;  2NBV A;  2IFS A;  2L2I A;  2ELB A;  3D8F A;  2NZ8 B;  4PQ0 A;  2COA A;  2GCJ A;  2YT0 A;  5J3Q A;  2D9V A;  1P5T A;  4HB0 B;  1KZG A;  2DA0 A;  2DX1 A;  3TFM A;  2D4Q A;  1LW3 A;  3ZDT A;  1FAO A;  1DDM A;  2ROV A;  2R09 A;  1WI1 A;  2LG1 A;  4HAY B;  5DHF B;  4F7G A;  3P7Z A;  5J3T A;  2Z59 A;  3GYO A;  2N23 A;  1V5U A;  4A6K A;  1N3H A;  3D8D A;  3HK0 A;  1BWN A;  4K2P A;  2UVM A;  2K49 A;  2VKI A;  1BAK A;  2NMB A;  1Y5O A;  2Z14 A;  4IAP A;  5HE0 A;  1W1H A;  2G35 A;  2J59 M;  2VRW B;  1WGU A;  1UNR A;  2J0J A;  2N0Y A;  2W2X C;  2RRF A;  4WJ7 A;  1BTN A;  1UNQ A;  2K2J A;  1E5W A;  3PZD A;  4P7I A;  4HAX B;  5D27 A;  4WVF B;  3SV1 A;  2IYB A;  4TYZ A;  3VOQ A;  2K00 A;  2Q13 A;  4HB4 B;  2W2X D;  2D2Q A;  3B77 A;  1H10 A;  3ULC A;  3M1I B;  5D3X A;  3PG7 A;  2DKP A;  2P0F A;  3KRX A;  2LOX A;  4NY0 A;  4MY6 A;  1KZ7 A;  2P8V A;  3PVW A;  1QQG A;  2ELA A;  3ODO A;  3IVF A;  4HDQ A;  2FJL A;  2J0M A;  2DTC A;  3TW1 A;  2I1J A;  3A98 B;  4K17 A;  2EC1 A;  4D0N B;  5JP4 A;  1KI1 B;  4GNK B;  2RNR B;  2HE7 A;  2LOZ A;  2K2U A;  5C5B A;  4EJN A;  5CLL B;  2GS0 A;  2E2X A;  3V5W A;  2DX5 A;  2MFQ A;  4GMV A;  4EKU A;  1GG3 A;  1B55 A;  2Z0P A;  2CRF A;  4DX8 A;  1TQZ A;  4IFS A;  2LYD A;  4KVG B;  1NTV A;  2YT1 A;  3ML4 A;  4YON A;  2LKO A;  2RLO A;  1LB1 A;  1DYN A;  4H8S A;  5DIF B;  3G9W A;  3TVV A;  2L1C A;  1W1G A;  2QKM A;  1I2H A;  1MIZ B;  2KIG A;  1ZVR A;  4L6E A;  1FHO A;  4Z2M B;  3FVC A;  2DHI A;  3A8Q A;  3PVL A;  5C16 A;  4NSW A;  1J19 A;  4HAZ B;  2UZR A;  5CLQ B;  4KHA A;  4CSQ A;  4MT7 A;  3A8P A;  4HAW B;  4GPT B;  1MPH A;  3HSA A;  1WGQ A;  4GXB A;  5GOW B;  5KCV A;  3PP2 A;  2LUL A;  2COD A;  2EMT A;  3DXD A;  3RCP A;  1Z87 A;  1WJM A;  5KQ4 A;  1FHW A;  2KIE A;  2M38 A;  1PMS A;  3KSY A;  2I5F A;  2ROZ B;  5J3Y A;  1FGZ A;  2EJ8 A;  1OQN A;  3U8Z A;  2W2W A;  1AWE A;  1DDW A;  2KUP A;  2MKR A;  3LJU X;  4GN1 A;  5HE1 A;  3CIK A;  5DI9 B;  3ZVR A;  4HAV B;  3NSU A;  1MK7 B;  1NU2 A;  5L81 A;  2KUQ A;  2PZ1 A;  5KQ1 A;  2K8E A;  4C0A A;  1WG7 A;  1MK9 B;  1P6S A;  3KRW A;  2ADZ A;  1U27 A;  4D6W A;  1MI1 A;  2YS1 A;  3HW2 B;  2D9W A;  1I7A A;  1NTY A;  1GC6 A;  1DRO A;  2BCJ A;  2DLW A;  1V5M A;  1P3R A;  4GMX B;  1Q67 A;  2H7D A;  3HIE A;  3QBV B;  4ZRI A;  1FGY A;  1U5E A;  1PLS A;  2CAY A;  5EFX A;  3ODW A;  2YRY A;  3NW8 A;  1MKE A;  1BTK A;  2RGN B;  2J0K A;  1UNP A;  4A5K A;  1IRS A;  4L1R A;  1X86 A;  2DN6 A;  3HQC A;  1XX0 A;  3X23 A;  2JP2 A;  2KCJ A;  2Z0O A;  2GUM A;  3BIN A;  2XQN M;  4F7H A;  5C79 A;  5IRS A;  1X1G A;  1X1F A;  2P0D A;  2MWN B;  5M4Y B;  5JHH A;  1TJ6 A;  3AU5 A;  3PSC A;  2RSG A;  3OHM B;  3FSS A;  3KY9 A;  1V88 A;  3AU4 A;  2AEH A;  3U12 A;  3UZT A;  3TO1 A;  1WVH A;  2EMS A;  2OTX A;  5C5B B;  1RJ2 A;  2GCL A;  2Z0Q A;  1H4R A;  3DXE A;  2D9Z A;  3MPX A;  4GOU A;  4OT1 A;  4HAT B;  4HSI A;  1NI2 A;  4HDO A;  1EF1 A;  3AJ4 A;  5I2S A;  3SYX A;  2ZKM X;  5FI1 A;  4KHB A;  1SHC A;  1XKE A;  2D9X A;  1X05 A;  3BJI A;  1SGH A;  1U5F A;  1XD4 A;  2Y8G A;  1U5D A;  1OY2 A;  3ODX A;  1J0W A;  4KHO A;  4IOY X;  1RRP B;  5FI0 A;  2CY4 A;  2R0D A;  4BBK A;  3D8E A;  4ZRJ A;  1Y19 B;  3P6A A;  4OSN A;  4K81 A;  5LG4 B;  3PVU A;  4PNK A;  2COC A;  3FEH A;  1EVH A;  1FOE A;  3MDB C;  4DIX A;  4B6H A;  5LON B;  1X11 A;  1M7R A;  1PFJ A;  3VIA A;  3DXC A;  1T77 A;  2Y8F A;  4KHB B;  5I2M A;  4HAU B;  2H7E A;  2I1K A;  1XCG A;  4CHJ A;  4GZU A;  3SO6 A;  1W1D A;  2DYQ A;  1ZC4 B;  2Y7B A;  3QWM A;  4YL8 A;  3NWF A;  2D10 A;  2R2Y A;  4EMO A;  1U29 A;  2UZS A;  2OQB A;  2RVB B;  5D3V A;  1FHX A;  1MAI A;  4HB3 B;  3N7C A;  2YF0 A;  1XR0 B;  1ZSQ A;  4Y94 A;  1V5P A;  2DFK A;  1ISN A;  1XOD A;  1UPR A;  1ZC3 B;  2AL6 A;  2RUK B;  2MDX A;  2DHK A;  2KGX B;  2P0H A;  3NWA A;  4QXA B;  5HE3 A;  5C6R A;  1OMW A;  3PEG A;  4Z2N A;  2YSZ A;  5HE2 A;  3FM8 C;  3WA0 A;  1QC6 A;  1ZYI A;  2YVC A;  1EAZ A;  3OAN A;  4QJ5 B;  2D9Y A;  1WJ1 A;  1DDV A;  2YS3 A;  4A6H A;  4TKN A;  4DXA B;  4QJ4 B;  4XWX A;  4KAX B;  2M14 A;  2YS5 A;  5JLJ B;  2Z13 A;  4HHV A;  3A58 A;  2YT2 A;  5DH9 B;  1TXD A;  3CXB B;  1AQC A;  4F7U P;  1GC7 A;  4CYE A;  1ZM0 A;  3WYF B;  2HTH B;  5D3Y A;  5LOP B;  1V61 A;  4HB2 B;  3GYP A;  2ZPY A;  3SUZ A;  2V76 A;  5D3W A;  3DCX A;  3NWD A;  2Z4D A;  1FB8 A;  2GJY A;  4DX9 0;  4A6F A;  2CY5 A;  1K5D B;  3KZ1 A;  4MK0 A;  4DBB A;  2DKQ A;  1MIX A;  4WSF A;  3ULB A;  2DYN A;  1UPQ A;  2QKL A;  5JHG A;  4ZRK A;  1K5G B;  3O96 A;  2COF A;  2DHJ A;  3QIJ A;  1UEF A; 
#chains in the Genus database with same CATH homology
 2VSZ A;  4CHM A;  2I5C A;  3F5R A;  5DHA B;  1U5G A;  3F0W A;  1M7E A;  3U7D A;  1EGX A;  1DBH A;  3SNH A;  2X18 A;  4A6F B;  2D11 A;  4K2O A;  1U2B A;  1V89 A;  3T06 A;  3TCA A;  2IFS A;  2L2I A;  2ELB A;  3D8F A;  2NZ8 B;  4PQ0 A;  2COA A;  2GCJ A;  2YT0 A;  5J3Q A;  2D9V A;  1P5T A;  4HB0 B;  1KZG A;  2DA0 A;  2DX1 A;  3TFM A;  2D4Q A;  1LW3 A;  3ZDT A;  1FAO A;  1DDM A;  2ROV A;  2R09 A;  1WI1 A;  2LG1 A;  4HAY B;  5DHF B;  4F7G A;  3P7Z A;  5J3T A;  3GYO A;  2N23 A;  1V5U A;  4A6K A;  1N3H A;  3D8D A;  3HK0 A;  1BWN A;  4K2P A;  2UVM A;  2VKI A;  1BAK A;  2NMB A;  1Y5O A;  4IAP A;  5HE0 A;  1W1H A;  2G35 A;  2J59 M;  2VRW B;  1WGU A;  1UNR A;  2J0J A;  2N0Y A;  2W2X C;  4WJ7 A;  1BTN A;  1UNQ A;  2K2J A;  1E5W A;  3PZD A;  4P7I A;  4HAX B;  5D27 A;  4WVF B;  3SV1 A;  2IYB A;  4TYZ A;  3VOQ A;  2K00 A;  2Q13 A;  4HB4 B;  2W2X D;  2D2Q A;  1H10 A;  3ULC A;  3M1I B;  5D3X A;  3PG7 A;  2DKP A;  2P0F A;  3KRX A;  2LOX A;  4NY0 A;  4MY6 A;  1KZ7 A;  2P8V A;  3PVW A;  1QQG A;  2ELA A;  3ODO A;  3IVF A;  4HDQ A;  2FJL A;  2J0M A;  2DTC A;  3TW1 A;  2I1J A;  3A98 B;  4K17 A;  2EC1 A;  4D0N B;  5JP4 A;  1KI1 B;  2RNR B;  2HE7 A;  2LOZ A;  2K2U A;  5C5B A;  4EJN A;  5CLL B;  2GS0 A;  2E2X A;  3V5W A;  2DX5 A;  2MFQ A;  4GMV A;  4EKU A;  1GG3 A;  1B55 A;  2Z0P A;  2CRF A;  4DX8 A;  1TQZ A;  4IFS A;  2LYD A;  4KVG B;  1NTV A;  2YT1 A;  3ML4 A;  4YON A;  2LKO A;  2RLO A;  1LB1 A;  1DYN A;  4H8S A;  5DIF B;  3G9W A;  3TVV A;  2L1C A;  1W1G A;  2QKM A;  1I2H A;  1MIZ B;  1ZVR A;  4L6E A;  1FHO A;  4Z2M B;  2DHI A;  3A8Q A;  3PVL A;  5C16 A;  4NSW A;  1J19 A;  4HAZ B;  2UZR A;  5CLQ B;  4KHA A;  4MT7 A;  3A8P A;  4HAW B;  4GPT B;  1MPH A;  1WGQ A;  4GXB A;  5GOW B;  5KCV A;  3PP2 A;  2LUL A;  2COD A;  2EMT A;  3DXD A;  3RCP A;  1Z87 A;  1WJM A;  5KQ4 A;  1FHW A;  2M38 A;  1PMS A;  3KSY A;  2I5F A;  2ROZ B;  5J3Y A;  1FGZ A;  2EJ8 A;  1OQN A;  3U8Z A;  2W2W A;  1AWE A;  1DDW A;  2KUP A;  2MKR A;  3LJU X;  4GN1 A;  5HE1 A;  3CIK A;  5DI9 B;  3ZVR A;  4HAV B;  3NSU A;  1MK7 B;  1NU2 A;  5L81 A;  2PZ1 A;  5KQ1 A;  4C0A A;  1WG7 A;  1MK9 B;  1P6S A;  3KRW A;  2ADZ A;  1U27 A;  2YS1 A;  3HW2 B;  2D9W A;  1I7A A;  1NTY A;  1GC6 A;  1DRO A;  2BCJ A;  2DLW A;  1V5M A;  1P3R A;  4GMX B;  1Q67 A;  2H7D A;  3QBV B;  4ZRI A;  1FGY A;  1U5E A;  1PLS A;  2CAY A;  5EFX A;  3ODW A;  2YRY A;  1MKE A;  1BTK A;  2RGN B;  2J0K A;  1UNP A;  4A5K A;  1IRS A;  1X86 A;  2DN6 A;  3HQC A;  1XX0 A;  3X23 A;  2JP2 A;  2KCJ A;  2Z0O A;  3BIN A;  2XQN M;  4F7H A;  5C79 A;  1X1G A;  1X1F A;  2P0D A;  2MWN B;  5JHH A;  1TJ6 A;  3AU5 A;  3PSC A;  2RSG A;  3FSS A;  3KY9 A;  1V88 A;  3AU4 A;  2AEH A;  3UZT A;  3TO1 A;  1WVH A;  2EMS A;  2OTX A;  5C5B B;  1RJ2 A;  2GCL A;  2Z0Q A;  1H4R A;  3DXE A;  2D9Z A;  3MPX A;  4HAT B;  1NI2 A;  4HDO A;  1EF1 A;  3AJ4 A;  3SYX A;  5FI1 A;  1SHC A;  1XKE A;  2D9X A;  1X05 A;  3BJI A;  1SGH A;  1U5F A;  1XD4 A;  2Y8G A;  1U5D A;  1OY2 A;  3ODX A;  1J0W A;  4KHO A;  4IOY X;  1RRP B;  5FI0 A;  2CY4 A;  2R0D A;  4BBK A;  3D8E A;  4ZRJ A;  1Y19 B;  3P6A A;  4K81 A;  3PVU A;  4PNK A;  2COC A;  3FEH A;  1EVH A;  1FOE A;  3MDB C;  4B6H A;  5LON B;  1X11 A;  1M7R A;  1PFJ A;  3VIA A;  3DXC A;  2Y8F A;  4KHB B;  4HAU B;  2H7E A;  2I1K A;  1XCG A;  4CHJ A;  4GZU A;  3SO6 A;  1W1D A;  2DYQ A;  1ZC4 B;  2Y7B A;  3QWM A;  4YL8 A;  2D10 A;  4EMO A;  1U29 A;  2UZS A;  2OQB A;  2RVB B;  5D3V A;  1FHX A;  1MAI A;  4HB3 B;  3N7C A;  2YF0 A;  1XR0 B;  1ZSQ A;  4Y94 A;  1V5P A;  2DFK A;  1ISN A;  1XOD A;  1UPR A;  1ZC3 B;  2AL6 A;  2RUK B;  2MDX A;  2DHK A;  2KGX B;  2P0H A;  5HE3 A;  5C6R A;  1OMW A;  3PEG A;  4Z2N A;  2YSZ A;  5HE2 A;  3FM8 C;  3WA0 A;  1QC6 A;  2YVC A;  1EAZ A;  3OAN A;  2D9Y A;  1WJ1 A;  1DDV A;  2YS3 A;  4A6H A;  4TKN A;  4DXA B;  4XWX A;  4KAX B;  2M14 A;  2YS5 A;  5JLJ B;  4HHV A;  5DH9 B;  1TXD A;  3CXB B;  1AQC A;  4F7U P;  1GC7 A;  4CYE A;  1ZM0 A;  3WYF B;  2HTH B;  5D3Y A;  5LOP B;  1V61 A;  4HB2 B;  3GYP A;  2ZPY A;  3SUZ A;  2V76 A;  5D3W A;  4DX9 0;  1FB8 A;  2GJY A;  4A6F A;  2CY5 A;  1K5D B;  3KZ1 A;  4MK0 A;  4DBB A;  2DKQ A;  1MIX A;  4WSF A;  3ULB A;  2DYN A;  1UPQ A;  2QKL A;  5JHG A;  4ZRK A;  1K5G B;  3O96 A;  2COF A;  2DHJ A;  3QIJ A;  1UEF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...