2RLOA

Split ph domain of pi3-kinase enhancer
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
128
structure length
128
Chain Sequence
RAIPIKQSFLLKRSGNSLNKEWKKKYVTLSSNGFLLYHPSINDYIHSTHGKEMDLLRTTVKVPGKRPPRAISAFGPSASGSAGQAEEENFEFLIVSSTGQTWHFEAASFEERDAWVQAIESQILASLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Centaurin-gamma 1
publication title Split pleckstrin homology domain-mediated cytoplasmic-nuclear localization of PI3-kinase enhancer GTPase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 17
structure length 128
sequence length 128
ec nomenclature
pdb deposition date 2007-07-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2rloA00
4MK0A 4K81A 2EJ8A 2N23A 3HW2B 2YVCA 2I1KA 5DHFB 5EFXA 2W2WA 2MFQA 5JLJB 1MKEA 1W1GA 2K2JA 5D3WA 1UPRA 3TVVA 3TCAA 1V5PA 1FB8A 1DYNA 1NU2A 2P0FA 5FI1A 3MPXA 1XR0B 4K2PA 5DIFB 3FSSA 5JHHA 4HAYB 2M14A 1V5UA 1KZGA 2UVMA 1XX0A 2LOZA 2M38A 2R0DA 5KQ1A 5C6RA 3DXDA 1WI1A 1WGQA 4KVGB 4Z2MB 1KZ7A 1EAZA 2D9VA 2IYBA 2R09A 5CLQB 1WG7A 2VKIA 2COCA 2DLWA 2DKQA 2GS0A 4DX8A 1E5WA 1TJ6A 4C0AA 4MY6A 2J0MA 3PP2A 3V5WA 1LW3A 4A6FB 4DX90 3F5RA 2LKOA 1FGYA 2CY4A 5D3VA 2ROVA 5LONB 1J0WA 4A6KA 2IFSA 3PVWA 4Z2NA 1WGUA 3A8PA 2NZ8B 4CHJA 2COAA 1OMWA 3SUZA 4D0NB 1U27A 4GMVA 1EGXA 1BTKA 1EVHA 1Y19B 3AJ4A 4KHOA 1V5MA 2NMBA 3PVLA 2KUPA 5L81A 1U5FA 1WVHA 4EKUA 1GC6A 4L6EA 1QQGA 1XKEA 1UNQA 5KCVA 4YONA 3MDBC 4HDOA 1FHWA 2DYNA 4IOYX 3FM8C 1GC7A 1N3HA 2DFKA 2FJLA 5HE2A 1DDMA 1AWEA 4YL8A 5C5BA 2W2XC 3NSUA 4PNKA 1RRPB 1BWNA 3N7CA 2CRFA 4MT7A 4A5KA 5C16A 4B6HA 3TW1A 3ZDTA 4DBBA 5DH9B 3AU4A 3D8DA 5J3QA 3X23A 1AQCA 2GJYA 3T06A 1MIZB 2V76A 1X05A 3KRXA 5D3YA 2H7EA 2DYQA 1OQNA 2ROZB 1U5DA 4A6HA 1FAOA 1V61A 1U5GA 2YSZA 3ODXA 2GCLA 1UEFA 5FI0A 3SV1A 4ZRJA 3LJUX 1FHOA 4HHVA 2DX1A 4CHMA 4CYEA 4EMOA 3ULCA 1RJ2A 4HB2B 4Y94A 4K17A 2DA0A 2LG1A 2K2UA 4HAVB 1BTNA 4TKNA 5JP4A 2J59M 5HE3A 4ZRIA 4WVFB 2DX5A 1ZVRA 1OY2A 2MDXA 1ZSQA 3OANA 5KQ4A 3KSYA 1ISNA 2Y7BA 1SGHA 2GCJA 3TO1A 4H8SA 4EJNA 1IRSA 1WJ1A 3TFMA 1TQZA 2DHJA 4HAUB 3UZTA 2J0KA 4KHAA 1KI1B 2YT1A 4HB3B 1ZC3B 2DN6A 3ML4A 2DTCA 2HE7A 1U2BA 2RSGA 2D11A 2QKLA 4HB4B 1MPHA 2Q13A 4NSWA 2YS3A 1X1GA 4GXBA 3GYOA 2RLOA 2DKPA 1P6SA 1W1DA 2RNRB 2D4QA 4F7UP 1EF1A 3D8EA 2ELAA 4HAXB 2DHKA 1UPQA 1NI2A 2YT0A 2EC1A 3A98B 5JHGA 1J19A 1NTYA 2Y8FA 2YF0A 5J3YA 3SO6A 3SYXA 3KRWA 5J3TA 2COFA 2L1CA 4WSFA 5C5BB 3O96A 3P7ZA 3PZDA 1XODA 4F7HA 2L2IA 2LYDA 1BAKA 4GMXB 3G9WA 2RUKB 2YS1A 2E2XA 4HB0B 2I1JA 3PG7A 1LB1A 4GPTB 3PSCA 5C79A 2Z0QA 2RGNB 2H7DA 2OQBA 3P6AA 2I5CA 2XQNM 1XCGA 3ODOA 2ELBA 3WYFB 1MAIA 3QWMA 3A8QA 3PEGA 2VSZA 4HATB 2OTXA 2DHIA 4TYZA 2EMTA 5CLLB 2CY5A 4NY0A 2CAYA 2AEHA 3ZVRA 3ULBA 1MK9B 1WJMA 3KZ1A 1TXDA 3HQCA 1DROA 1ZC4B 5DHAB 4K2OA 1X11A 2P8VA 5DI9B 3GYPA 3KY9A 2D2QA 1K5GB 3CXBB 5GOWB 2VRWB 2Y8GA 1Z87A 2MKRA 1U5EA 3CIKA 2ZPYA 1P3RA 1FOEA 1XD4A 2KGXB 4ZRKA 1X1FA 4HAWB 1K5DB 4KAXB 2YS5A 1DDVA 1V89A 3SNHA 1M7RA 1FGZA 2I5FA 2W2XD 1I7AA 5HE0A 2QKMA 2D9ZA 1NTVA 1W1HA 4IAPA 1Q67A 2KCJA 2EMSA 1H4RA 2YRYA 1UNPA 4BBKA 4GZUA 5LOPB 1ZM0A 1P5TA 1PFJA 1H10A 3ODWA 1V88A 1SHCA 2P0DA 1QC6A 1DDWA 3VOQA 4XWXA 2D10A 4HDQA 4PQ0A 2Z0OA 4DXAB 1U29A 4HAZB 5D27A 3D8FA 2X18A 3WA0A 1X86A 2HTHB 3BJIA 5D3XA 3U8ZA 2ADZA 2JP2A 2LULA 3M1IB 1B55A 4A6FA 1UNRA 1GG3A 4P7IA 2P0HA 1M7EA 2UZSA 4WJ7A 3RCPA 2CODA 2PZ1A 2N0YA 2AL6A 3DXEA 3BINA 1MK7B 3VIAA 2D9YA 4IFSA 3HK0A 2Z0PA 2BCJA 3FEHA 2G35A 1Y5OA 3AU5A 4F7GA 1I2HA 1PMSA 1DBHA 1PLSA 1FHXA 2UZRA 5HE1A 2K00A 2MWNB 3IVFA 3PVUA 2J0JA 2LOXA 3U7DA 4GN1A 2D9WA 3DXCA 3QBVB 3F0WA 1MIXA 2D9XA 2RVBB 4KHBB 3QIJA
chains in the Genus database with same CATH superfamily
4MK0A 4K81A 2EJ8A 2N23A 3HW2B 2YVCA 2I1KA 5DHFB 5EFXA 2W2WA 2MFQA 5JLJB 1MKEA 1W1GA 2KIEA 2ZKMX 2K2JA 5D3WA 4OSNA 4OT1A 1UPRA 3TVVA 3TCAA 1V5PA 1FB8A 1DYNA 1NU2A 2P0FA 5FI1A 3MPXA 1XR0B 4K2PA 5DIFB 3FSSA 2KIGA 5JHHA 2K8EA 4HAYB 2M14A 1V5UA 1KZGA 2UVMA 1XX0A 2LOZA 2M38A 2R0DA 5KQ1A 2K49A 5C6RA 3DXDA 1WI1A 1WGQA 4KVGB 4Z2MB 1KZ7A 1EAZA 2R2YA 4QJ5B 2D9VA 2IYBA 2R09A 5CLQB 1WG7A 2VKIA 2COCA 2DLWA 3B77A 2DKQA 2GS0A 3DCXA 3OHMB 4DX8A 1E5WA 1TJ6A 4C0AA 4MY6A 2J0MA 3PP2A 3V5WA 1LW3A 4A6FB 4DX90 3F5RA 3A58A 3HSAA 2LKOA 1FGYA 2CY4A 5D3VA 2ROVA 5LONB 1J0WA 4A6KA 2IFSA 3PVWA 4Z2NA 1WGUA 3A8PA 2NZ8B 4CHJA 2COAA 1OMWA 3SUZA 4D0NB 1U27A 4GMVA 1EGXA 1BTKA 1EVHA 1Y19B 5LG4B 3AJ4A 4KHOA 1V5MA 2NMBA 2KUPA 3PVLA 5L81A 1U5FA 1WVHA 4EKUA 1GC6A 4L6EA 1QQGA 1XKEA 1UNQA 5KCVA 4YONA 3MDBC 4HDOA 1FHWA 2DYNA 4GOUA 4IOYX 3FM8C 1GC7A 1N3HA 2DFKA 2FJLA 5HE2A 1DDMA 1AWEA 2NBVA 4YL8A 5C5BA 2W2XC 4GNKB 2Z4DA 4QJ3B 3NSUA 4PNKA 1RRPB 1BWNA 2Z14A 3N7CA 2CRFA 4D6WA 4MT7A 4A5KA 5C16A 4B6HA 2FJUB 3TW1A 3ZDTA 4DBBA 5DH9B 3AU4A 3D8DA 3HIEA 5J3QA 3X23A 1AQCA 2GJYA 3T06A 1MIZB 2V76A 1X05A 3KRXA 5D3YA 2H7EA 2DYQA 1OQNA 2ROZB 1U5DA 4A6HA 1FAOA 1V61A 1U5GA 2YSZA 3ODXA 2GCLA 1UEFA 5FI0A 3SV1A 4ZRJA 3LJUX 1FHOA 4HHVA 2DX1A 4CHMA 4CYEA 4EMOA 3ULCA 1RJ2A 4HB2B 4Y94A 4K17A 2DA0A 2LG1A 2K2UA 4HAVB 1BTNA 4TKNA 5JP4A 3FVCA 3NWAA 2J59M 5HE3A 4ZRIA 2KUQA 4WVFB 2DX5A 1ZVRA 1OY2A 3NWFA 2MDXA 1ZYIA 1ZSQA 3OANA 5KQ4A 5I2SA 3KSYA 1ISNA 2Y7BA 1SGHA 2GCJA 3TO1A 4H8SA 4EJNA 1IRSA 1WJ1A 2KR0A 1TQZA 2DHJA 4HAUB 3TFMA 2J0KA 3UZTA 4KHAA 1KI1B 2YT1A 4HB3B 3NW8A 1ZC3B 2DN6A 3ML4A 2DTCA 2HE7A 1U2BA 2RSGA 2D11A 2QKLA 4HB4B 1MPHA 2Q13A 4L1RA 4NSWA 2YS3A 1X1GA 4GXBA 3GYOA 2RLOA 2DKPA 1P6SA 1W1DA 2RNRB 2D4QA 4F7UP 1EF1A 3D8EA 2ELAA 4HAXB 2DHKA 1UPQA 1NI2A 2YT0A 2EC1A 3A98B 5JHGA 4CSQA 1J19A 1NTYA 2Y8FA 2YF0A 5J3YA 3SO6A 3SYXA 3KRWA 5J3TA 2COFA 2L1CA 4WSFA 5C5BB 3O96A 3P7ZA 3PZDA 1XODA 4F7HA 2RRFA 2L2IA 2LYDA 3NWDA 1BAKA 4GMXB 3G9WA 2RUKB 2YS1A 2E2XA 4HB0B 2I1JA 3PG7A 1LB1A 4GPTB 3PSCA 5C79A 2Z0QA 2RGNB 2H7DA 2OQBA 4QXAB 3P6AA 2I5CA 2XQNM 1XCGA 3ODOA 2ELBA 3WYFB 1MAIA 2Z59A 3QWMA 3A8QA 3PEGA 2VSZA 4HATB 2YT2A 2OTXA 2DHIA 4TYZA 2EMTA 5CLLB 2CY5A 4NY0A 2CAYA 2AEHA 3ZVRA 3ULBA 1MK9B 1WJMA 3KZ1A 1TXDA 3HQCA 1DROA 1ZC4B 5DHAB 4K2OA 1X11A 2P8VA 5DI9B 3GYPA 3U12A 3KY9A 5I2MA 4KHBA 2D2QA 1K5GB 3CXBB 5GOWB 2VRWB 2Y8GA 1Z87A 2MKRA 1U5EA 3CIKA 2ZPYA 1P3RA 1FOEA 1XD4A 2KGXB 4ZRKA 4HSIA 1X1FA 4HAWB 1K5DB 4KAXB 2YS5A 1DDVA 2Z13A 1V89A 3SNHA 1M7RA 1FGZA 2I5FA 2W2XD 1I7AA 5HE0A 2QKMA 2D9ZA 1NTVA 1W1HA 4IAPA 1Q67A 2KCJA 2EMSA 1H4RA 2YRYA 1UNPA 4BBKA 4GZUA 5LOPB 1ZM0A 1P5TA 2GUMA 1PFJA 1H10A 3ODWA 1V88A 1SHCA 2P0DA 1QC6A 1DDWA 3VOQA 4XWXA 2D10A 4HDQA 4PQ0A 2Z0OA 4DXAB 1U29A 4HAZB 5D27A 3D8FA 2X18A 3WA0A 1X86A 2HTHB 3BJIA 5D3XA 3U8ZA 4DIXA 2ADZA 2JP2A 2LULA 3M1IB 1B55A 4A6FA 1UNRA 1GG3A 4P7IA 2P0HA 1M7EA 2UZSA 4WJ7A 3RCPA 2CODA 2PZ1A 2N0YA 2AL6A 1MI1A 3DXEA 3BINA 1MK7B 3VIAA 2D9YA 4IFSA 3HK0A 5M4YB 2Z0PA 2BCJA 3FEHA 5IRSA 2G35A 1Y5OA 3AU5A 4F7GA 1I2HA 1PMSA 1DBHA 1PLSA 1FHXA 2UZRA 5HE1A 2K00A 2MWNB 3IVFA 3PVUA 2J0JA 2LOXA 3U7DA 4GN1A 2D9WA 3DXCA 3QBVB 3F0WA 1MIXA 2D9XA 2RVBB 4QJ4B 4KHBB 1T77A 3QIJA
chains in the Genus database with same CATH topology
4MK0A 4K81A 2EJ8A 2N23A 3HW2B 2YVCA 2I1KA 5DHFB 5EFXA 2W2WA 2MFQA 5JLJB 1MKEA 1W1GA 2K2JA 5D3WA 1UPRA 3TVVA 3TCAA 1V5PA 1FB8A 1DYNA 1NU2A 2P0FA 5FI1A 3MPXA 1XR0B 4K2PA 5DIFB 3FSSA 5JHHA 4HAYB 2M14A 1V5UA 1KZGA 2UVMA 1XX0A 2LOZA 2M38A 2R0DA 5KQ1A 5C6RA 3DXDA 1WI1A 1WGQA 4KVGB 4Z2MB 1KZ7A 1EAZA 2D9VA 2IYBA 2R09A 5CLQB 1WG7A 2VKIA 2COCA 2DLWA 2DKQA 2GS0A 4DX8A 1E5WA 1TJ6A 4C0AA 4MY6A 2J0MA 3PP2A 3V5WA 1LW3A 4A6FB 4DX90 3F5RA 2LKOA 1FGYA 2CY4A 5D3VA 2ROVA 5LONB 1J0WA 4A6KA 2IFSA 3PVWA 4Z2NA 1WGUA 3A8PA 2NZ8B 4CHJA 2COAA 1OMWA 3SUZA 4D0NB 1U27A 4GMVA 1EGXA 1BTKA 1EVHA 1Y19B 3AJ4A 4KHOA 1V5MA 2NMBA 3PVLA 2KUPA 5L81A 1U5FA 1WVHA 4EKUA 1GC6A 4L6EA 1QQGA 1XKEA 1UNQA 5KCVA 4YONA 3MDBC 4HDOA 1FHWA 2DYNA 4IOYX 3FM8C 1GC7A 1N3HA 2DFKA 2FJLA 5HE2A 1DDMA 1AWEA 4YL8A 5C5BA 2W2XC 3NSUA 4PNKA 1RRPB 1BWNA 3N7CA 2CRFA 4MT7A 4A5KA 5C16A 4B6HA 3TW1A 3ZDTA 4DBBA 5DH9B 3AU4A 3D8DA 5J3QA 3X23A 1AQCA 2GJYA 3T06A 1MIZB 2V76A 1X05A 3KRXA 5D3YA 2H7EA 2DYQA 1OQNA 2ROZB 1U5DA 4A6HA 1FAOA 1V61A 1U5GA 2YSZA 3ODXA 2GCLA 1UEFA 5FI0A 3SV1A 4ZRJA 3LJUX 1FHOA 4HHVA 2DX1A 4CHMA 4CYEA 4EMOA 3ULCA 1RJ2A 4HB2B 4Y94A 4K17A 2DA0A 2LG1A 2K2UA 4HAVB 1BTNA 4TKNA 5JP4A 2J59M 5HE3A 4ZRIA 4WVFB 2DX5A 1ZVRA 1OY2A 2MDXA 1ZSQA 3OANA 5KQ4A 3KSYA 1ISNA 2Y7BA 1SGHA 2GCJA 3TO1A 4H8SA 4EJNA 1IRSA 1WJ1A 3TFMA 1TQZA 2DHJA 4HAUB 3UZTA 2J0KA 4KHAA 1KI1B 2YT1A 4HB3B 1ZC3B 2DN6A 3ML4A 2DTCA 2HE7A 1U2BA 2RSGA 2D11A 2QKLA 4HB4B 1MPHA 2Q13A 4NSWA 2YS3A 1X1GA 4GXBA 3GYOA 2RLOA 2DKPA 1P6SA 1W1DA 2RNRB 2D4QA 4F7UP 1EF1A 3D8EA 2ELAA 4HAXB 2DHKA 1UPQA 1NI2A 2YT0A 2EC1A 3A98B 5JHGA 1J19A 1NTYA 2Y8FA 2YF0A 5J3YA 3SO6A 3SYXA 3KRWA 5J3TA 2COFA 2L1CA 4WSFA 5C5BB 3O96A 3P7ZA 3PZDA 1XODA 4F7HA 2L2IA 2LYDA 1BAKA 4GMXB 3G9WA 2RUKB 2YS1A 2E2XA 4HB0B 2I1JA 3PG7A 1LB1A 4GPTB 3PSCA 5C79A 2Z0QA 2RGNB 2H7DA 2OQBA 3P6AA 2I5CA 2XQNM 1XCGA 3ODOA 2ELBA 3WYFB 1MAIA 3QWMA 3A8QA 3PEGA 2VSZA 4HATB 2OTXA 2DHIA 4TYZA 2EMTA 5CLLB 2CY5A 4NY0A 2CAYA 2AEHA 3ZVRA 3ULBA 1MK9B 1WJMA 3KZ1A 1TXDA 3HQCA 1DROA 1ZC4B 5DHAB 4K2OA 1X11A 2P8VA 5DI9B 3GYPA 3KY9A 2D2QA 1K5GB 3CXBB 5GOWB 2VRWB 2Y8GA 1Z87A 2MKRA 1U5EA 3CIKA 2ZPYA 1P3RA 1FOEA 1XD4A 2KGXB 4ZRKA 1X1FA 4HAWB 1K5DB 4KAXB 2YS5A 1DDVA 1V89A 3SNHA 1M7RA 1FGZA 2I5FA 2W2XD 1I7AA 5HE0A 2QKMA 2D9ZA 1NTVA 1W1HA 4IAPA 1Q67A 2KCJA 2EMSA 1H4RA 2YRYA 1UNPA 4BBKA 4GZUA 5LOPB 1ZM0A 1P5TA 1PFJA 1H10A 3ODWA 1V88A 1SHCA 2P0DA 1QC6A 1DDWA 3VOQA 4XWXA 2D10A 4HDQA 4PQ0A 2Z0OA 4DXAB 1U29A 4HAZB 5D27A 3D8FA 2X18A 3WA0A 1X86A 2HTHB 3BJIA 5D3XA 3U8ZA 2ADZA 2JP2A 2LULA 3M1IB 1B55A 4A6FA 1UNRA 1GG3A 4P7IA 2P0HA 1M7EA 2UZSA 4WJ7A 3RCPA 2CODA 2PZ1A 2N0YA 2AL6A 3DXEA 3BINA 1MK7B 3VIAA 2D9YA 4IFSA 3HK0A 2Z0PA 2BCJA 3FEHA 2G35A 1Y5OA 3AU5A 4F7GA 1I2HA 1PMSA 1DBHA 1PLSA 1FHXA 2UZRA 5HE1A 2K00A 2MWNB 3IVFA 3PVUA 2J0JA 2LOXA 3U7DA 4GN1A 2D9WA 3DXCA 3QBVB 3F0WA 1MIXA 2D9XA 2RVBB 4KHBB 3QIJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MK0 A;  4K81 A;  2EJ8 A;  2N23 A;  3HW2 B;  2YVC A;  2I1K A;  5DHF B;  5EFX A;  2W2W A;  2MFQ A;  5JLJ B;  1MKE A;  1W1G A;  2K2J A;  5D3W A;  1UPR A;  3TVV A;  3TCA A;  1V5P A;  1FB8 A;  1DYN A;  1NU2 A;  2P0F A;  5FI1 A;  3MPX A;  1XR0 B;  4K2P A;  5DIF B;  3FSS A;  5JHH A;  4HAY B;  2M14 A;  1V5U A;  1KZG A;  2UVM A;  1XX0 A;  2LOZ A;  2M38 A;  2R0D A;  5KQ1 A;  5C6R A;  3DXD A;  1WI1 A;  1WGQ A;  4KVG B;  4Z2M B;  1KZ7 A;  1EAZ A;  2D9V A;  2IYB A;  2R09 A;  5CLQ B;  1WG7 A;  2VKI A;  2COC A;  2DLW A;  2DKQ A;  2GS0 A;  4DX8 A;  1E5W A;  1TJ6 A;  4C0A A;  4MY6 A;  2J0M A;  3PP2 A;  3V5W A;  1LW3 A;  4A6F B;  4DX9 0;  3F5R A;  2LKO A;  1FGY A;  2CY4 A;  5D3V A;  2ROV A;  5LON B;  1J0W A;  4A6K A;  2IFS A;  3PVW A;  4Z2N A;  1WGU A;  3A8P A;  2NZ8 B;  4CHJ A;  2COA A;  1OMW A;  3SUZ A;  4D0N B;  1U27 A;  4GMV A;  1EGX A;  1BTK A;  1EVH A;  1Y19 B;  3AJ4 A;  4KHO A;  1V5M A;  2NMB A;  3PVL A;  2KUP A;  5L81 A;  1U5F A;  1WVH A;  4EKU A;  1GC6 A;  4L6E A;  1QQG A;  1XKE A;  1UNQ A;  5KCV A;  4YON A;  3MDB C;  4HDO A;  1FHW A;  2DYN A;  4IOY X;  3FM8 C;  1GC7 A;  1N3H A;  2DFK A;  2FJL A;  5HE2 A;  1DDM A;  1AWE A;  4YL8 A;  5C5B A;  2W2X C;  3NSU A;  4PNK A;  1RRP B;  1BWN A;  3N7C A;  2CRF A;  4MT7 A;  4A5K A;  5C16 A;  4B6H A;  3TW1 A;  3ZDT A;  4DBB A;  5DH9 B;  3AU4 A;  3D8D A;  5J3Q A;  3X23 A;  1AQC A;  2GJY A;  3T06 A;  1MIZ B;  2V76 A;  1X05 A;  3KRX A;  5D3Y A;  2H7E A;  2DYQ A;  1OQN A;  2ROZ B;  1U5D A;  4A6H A;  1FAO A;  1V61 A;  1U5G A;  2YSZ A;  3ODX A;  2GCL A;  1UEF A;  5FI0 A;  3SV1 A;  4ZRJ A;  3LJU X;  1FHO A;  4HHV A;  2DX1 A;  4CHM A;  4CYE A;  4EMO A;  3ULC A;  1RJ2 A;  4HB2 B;  4Y94 A;  4K17 A;  2DA0 A;  2LG1 A;  2K2U A;  4HAV B;  1BTN A;  4TKN A;  5JP4 A;  2J59 M;  5HE3 A;  4ZRI A;  4WVF B;  2DX5 A;  1ZVR A;  1OY2 A;  2MDX A;  1ZSQ A;  3OAN A;  5KQ4 A;  3KSY A;  1ISN A;  2Y7B A;  1SGH A;  2GCJ A;  3TO1 A;  4H8S A;  4EJN A;  1IRS A;  1WJ1 A;  3TFM A;  1TQZ A;  2DHJ A;  4HAU B;  3UZT A;  2J0K A;  4KHA A;  1KI1 B;  2YT1 A;  4HB3 B;  1ZC3 B;  2DN6 A;  3ML4 A;  2DTC A;  2HE7 A;  1U2B A;  2RSG A;  2D11 A;  2QKL A;  4HB4 B;  1MPH A;  2Q13 A;  4NSW A;  2YS3 A;  1X1G A;  4GXB A;  3GYO A;  2RLO A;  2DKP A;  1P6S A;  1W1D A;  2RNR B;  2D4Q A;  4F7U P;  1EF1 A;  3D8E A;  2ELA A;  4HAX B;  2DHK A;  1UPQ A;  1NI2 A;  2YT0 A;  2EC1 A;  3A98 B;  5JHG A;  1J19 A;  1NTY A;  2Y8F A;  2YF0 A;  5J3Y A;  3SO6 A;  3SYX A;  3KRW A;  5J3T A;  2COF A;  2L1C A;  4WSF A;  5C5B B;  3O96 A;  3P7Z A;  3PZD A;  1XOD A;  4F7H A;  2L2I A;  2LYD A;  1BAK A;  4GMX B;  3G9W A;  2RUK B;  2YS1 A;  2E2X A;  4HB0 B;  2I1J A;  3PG7 A;  1LB1 A;  4GPT B;  3PSC A;  5C79 A;  2Z0Q A;  2RGN B;  2H7D A;  2OQB A;  3P6A A;  2I5C A;  2XQN M;  1XCG A;  3ODO A;  2ELB A;  3WYF B;  1MAI A;  3QWM A;  3A8Q A;  3PEG A;  2VSZ A;  4HAT B;  2OTX A;  2DHI A;  4TYZ A;  2EMT A;  5CLL B;  2CY5 A;  4NY0 A;  2CAY A;  2AEH A;  3ZVR A;  3ULB A;  1MK9 B;  1WJM A;  3KZ1 A;  1TXD A;  3HQC A;  1DRO A;  1ZC4 B;  5DHA B;  4K2O A;  1X11 A;  2P8V A;  5DI9 B;  3GYP A;  3KY9 A;  2D2Q A;  1K5G B;  3CXB B;  5GOW B;  2VRW B;  2Y8G A;  1Z87 A;  2MKR A;  1U5E A;  3CIK A;  2ZPY A;  1P3R A;  1FOE A;  1XD4 A;  2KGX B;  4ZRK A;  1X1F A;  4HAW B;  1K5D B;  4KAX B;  2YS5 A;  1DDV A;  1V89 A;  3SNH A;  1M7R A;  1FGZ A;  2I5F A;  2W2X D;  1I7A A;  5HE0 A;  2QKM A;  2D9Z A;  1NTV A;  1W1H A;  4IAP A;  1Q67 A;  2KCJ A;  2EMS A;  1H4R A;  2YRY A;  1UNP A;  4BBK A;  4GZU A;  5LOP B;  1ZM0 A;  1P5T A;  1PFJ A;  1H10 A;  3ODW A;  1V88 A;  1SHC A;  2P0D A;  1QC6 A;  1DDW A;  3VOQ A;  4XWX A;  2D10 A;  4HDQ A;  4PQ0 A;  2Z0O A;  4DXA B;  1U29 A;  4HAZ B;  5D27 A;  3D8F A;  2X18 A;  3WA0 A;  1X86 A;  2HTH B;  3BJI A;  5D3X A;  3U8Z A;  2ADZ A;  2JP2 A;  2LUL A;  3M1I B;  1B55 A;  4A6F A;  1UNR A;  1GG3 A;  4P7I A;  2P0H A;  1M7E A;  2UZS A;  4WJ7 A;  3RCP A;  2COD A;  2PZ1 A;  2N0Y A;  2AL6 A;  3DXE A;  3BIN A;  1MK7 B;  3VIA A;  2D9Y A;  4IFS A;  3HK0 A;  2Z0P A;  2BCJ A;  3FEH A;  2G35 A;  1Y5O A;  3AU5 A;  4F7G A;  1I2H A;  1PMS A;  1DBH A;  1PLS A;  1FHX A;  2UZR A;  5HE1 A;  2K00 A;  2MWN B;  3IVF A;  3PVU A;  2J0J A;  2LOX A;  3U7D A;  4GN1 A;  2D9W A;  3DXC A;  3QBV B;  3F0W A;  1MIX A;  2D9X A;  2RVB B;  4KHB B;  3QIJ A; 
#chains in the Genus database with same CATH topology
 4MK0 A;  4K81 A;  2EJ8 A;  2N23 A;  3HW2 B;  2YVC A;  2I1K A;  5DHF B;  5EFX A;  2W2W A;  2MFQ A;  5JLJ B;  1MKE A;  1W1G A;  2KIE A;  2ZKM X;  2K2J A;  5D3W A;  4OSN A;  4OT1 A;  1UPR A;  3TVV A;  3TCA A;  1V5P A;  1FB8 A;  1DYN A;  1NU2 A;  2P0F A;  5FI1 A;  3MPX A;  1XR0 B;  4K2P A;  5DIF B;  3FSS A;  2KIG A;  5JHH A;  2K8E A;  4HAY B;  2M14 A;  1V5U A;  1KZG A;  2UVM A;  1XX0 A;  2LOZ A;  2M38 A;  2R0D A;  5KQ1 A;  2K49 A;  5C6R A;  3DXD A;  1WI1 A;  1WGQ A;  4KVG B;  4Z2M B;  1KZ7 A;  1EAZ A;  2R2Y A;  4QJ5 B;  2D9V A;  2IYB A;  2R09 A;  5CLQ B;  1WG7 A;  2VKI A;  2COC A;  2DLW A;  3B77 A;  2DKQ A;  2GS0 A;  3DCX A;  3OHM B;  4DX8 A;  1E5W A;  1TJ6 A;  4C0A A;  4MY6 A;  2J0M A;  3PP2 A;  3V5W A;  1LW3 A;  4A6F B;  4DX9 0;  3F5R A;  3A58 A;  3HSA A;  2LKO A;  1FGY A;  2CY4 A;  5D3V A;  2ROV A;  5LON B;  1J0W A;  4A6K A;  2IFS A;  3PVW A;  4Z2N A;  1WGU A;  3A8P A;  2NZ8 B;  4CHJ A;  2COA A;  1OMW A;  3SUZ A;  4D0N B;  1U27 A;  4GMV A;  1EGX A;  1BTK A;  1EVH A;  1Y19 B;  5LG4 B;  3AJ4 A;  4KHO A;  1V5M A;  2NMB A;  2KUP A;  3PVL A;  5L81 A;  1U5F A;  1WVH A;  4EKU A;  1GC6 A;  4L6E A;  1QQG A;  1XKE A;  1UNQ A;  5KCV A;  4YON A;  3MDB C;  4HDO A;  1FHW A;  2DYN A;  4GOU A;  4IOY X;  3FM8 C;  1GC7 A;  1N3H A;  2DFK A;  2FJL A;  5HE2 A;  1DDM A;  1AWE A;  2NBV A;  4YL8 A;  5C5B A;  2W2X C;  4GNK B;  2Z4D A;  4QJ3 B;  3NSU A;  4PNK A;  1RRP B;  1BWN A;  2Z14 A;  3N7C A;  2CRF A;  4D6W A;  4MT7 A;  4A5K A;  5C16 A;  4B6H A;  2FJU B;  3TW1 A;  3ZDT A;  4DBB A;  5DH9 B;  3AU4 A;  3D8D A;  3HIE A;  5J3Q A;  3X23 A;  1AQC A;  2GJY A;  3T06 A;  1MIZ B;  2V76 A;  1X05 A;  3KRX A;  5D3Y A;  2H7E A;  2DYQ A;  1OQN A;  2ROZ B;  1U5D A;  4A6H A;  1FAO A;  1V61 A;  1U5G A;  2YSZ A;  3ODX A;  2GCL A;  1UEF A;  5FI0 A;  3SV1 A;  4ZRJ A;  3LJU X;  1FHO A;  4HHV A;  2DX1 A;  4CHM A;  4CYE A;  4EMO A;  3ULC A;  1RJ2 A;  4HB2 B;  4Y94 A;  4K17 A;  2DA0 A;  2LG1 A;  2K2U A;  4HAV B;  1BTN A;  4TKN A;  5JP4 A;  3FVC A;  3NWA A;  2J59 M;  5HE3 A;  4ZRI A;  2KUQ A;  4WVF B;  2DX5 A;  1ZVR A;  1OY2 A;  3NWF A;  2MDX A;  1ZYI A;  1ZSQ A;  3OAN A;  5KQ4 A;  5I2S A;  3KSY A;  1ISN A;  2Y7B A;  1SGH A;  2GCJ A;  3TO1 A;  4H8S A;  4EJN A;  1IRS A;  1WJ1 A;  2KR0 A;  1TQZ A;  2DHJ A;  4HAU B;  3TFM A;  2J0K A;  3UZT A;  4KHA A;  1KI1 B;  2YT1 A;  4HB3 B;  3NW8 A;  1ZC3 B;  2DN6 A;  3ML4 A;  2DTC A;  2HE7 A;  1U2B A;  2RSG A;  2D11 A;  2QKL A;  4HB4 B;  1MPH A;  2Q13 A;  4L1R A;  4NSW A;  2YS3 A;  1X1G A;  4GXB A;  3GYO A;  2RLO A;  2DKP A;  1P6S A;  1W1D A;  2RNR B;  2D4Q A;  4F7U P;  1EF1 A;  3D8E A;  2ELA A;  4HAX B;  2DHK A;  1UPQ A;  1NI2 A;  2YT0 A;  2EC1 A;  3A98 B;  5JHG A;  4CSQ A;  1J19 A;  1NTY A;  2Y8F A;  2YF0 A;  5J3Y A;  3SO6 A;  3SYX A;  3KRW A;  5J3T A;  2COF A;  2L1C A;  4WSF A;  5C5B B;  3O96 A;  3P7Z A;  3PZD A;  1XOD A;  4F7H A;  2RRF A;  2L2I A;  2LYD A;  3NWD A;  1BAK A;  4GMX B;  3G9W A;  2RUK B;  2YS1 A;  2E2X A;  4HB0 B;  2I1J A;  3PG7 A;  1LB1 A;  4GPT B;  3PSC A;  5C79 A;  2Z0Q A;  2RGN B;  2H7D A;  2OQB A;  4QXA B;  3P6A A;  2I5C A;  2XQN M;  1XCG A;  3ODO A;  2ELB A;  3WYF B;  1MAI A;  2Z59 A;  3QWM A;  3A8Q A;  3PEG A;  2VSZ A;  4HAT B;  2YT2 A;  2OTX A;  2DHI A;  4TYZ A;  2EMT A;  5CLL B;  2CY5 A;  4NY0 A;  2CAY A;  2AEH A;  3ZVR A;  3ULB A;  1MK9 B;  1WJM A;  3KZ1 A;  1TXD A;  3HQC A;  1DRO A;  1ZC4 B;  5DHA B;  4K2O A;  1X11 A;  2P8V A;  5DI9 B;  3GYP A;  3U12 A;  3KY9 A;  5I2M A;  4KHB A;  2D2Q A;  1K5G B;  3CXB B;  5GOW B;  2VRW B;  2Y8G A;  1Z87 A;  2MKR A;  1U5E A;  3CIK A;  2ZPY A;  1P3R A;  1FOE A;  1XD4 A;  2KGX B;  4ZRK A;  4HSI A;  1X1F A;  4HAW B;  1K5D B;  4KAX B;  2YS5 A;  1DDV A;  2Z13 A;  1V89 A;  3SNH A;  1M7R A;  1FGZ A;  2I5F A;  2W2X D;  1I7A A;  5HE0 A;  2QKM A;  2D9Z A;  1NTV A;  1W1H A;  4IAP A;  1Q67 A;  2KCJ A;  2EMS A;  1H4R A;  2YRY A;  1UNP A;  4BBK A;  4GZU A;  5LOP B;  1ZM0 A;  1P5T A;  2GUM A;  1PFJ A;  1H10 A;  3ODW A;  1V88 A;  1SHC A;  2P0D A;  1QC6 A;  1DDW A;  3VOQ A;  4XWX A;  2D10 A;  4HDQ A;  4PQ0 A;  2Z0O A;  4DXA B;  1U29 A;  4HAZ B;  5D27 A;  3D8F A;  2X18 A;  3WA0 A;  1X86 A;  2HTH B;  3BJI A;  5D3X A;  3U8Z A;  4DIX A;  2ADZ A;  2JP2 A;  2LUL A;  3M1I B;  1B55 A;  4A6F A;  1UNR A;  1GG3 A;  4P7I A;  2P0H A;  1M7E A;  2UZS A;  4WJ7 A;  3RCP A;  2COD A;  2PZ1 A;  2N0Y A;  2AL6 A;  1MI1 A;  3DXE A;  3BIN A;  1MK7 B;  3VIA A;  2D9Y A;  4IFS A;  3HK0 A;  5M4Y B;  2Z0P A;  2BCJ A;  3FEH A;  5IRS A;  2G35 A;  1Y5O A;  3AU5 A;  4F7G A;  1I2H A;  1PMS A;  1DBH A;  1PLS A;  1FHX A;  2UZR A;  5HE1 A;  2K00 A;  2MWN B;  3IVF A;  3PVU A;  2J0J A;  2LOX A;  3U7D A;  4GN1 A;  2D9W A;  3DXC A;  3QBV B;  3F0W A;  1MIX A;  2D9X A;  2RVB B;  4QJ4 B;  4KHB B;  1T77 A;  3QIJ A; 
#chains in the Genus database with same CATH homology
 4MK0 A;  4K81 A;  2EJ8 A;  2N23 A;  3HW2 B;  2YVC A;  2I1K A;  5DHF B;  5EFX A;  2W2W A;  2MFQ A;  5JLJ B;  1MKE A;  1W1G A;  2K2J A;  5D3W A;  1UPR A;  3TVV A;  3TCA A;  1V5P A;  1FB8 A;  1DYN A;  1NU2 A;  2P0F A;  5FI1 A;  3MPX A;  1XR0 B;  4K2P A;  5DIF B;  3FSS A;  5JHH A;  4HAY B;  2M14 A;  1V5U A;  1KZG A;  2UVM A;  1XX0 A;  2LOZ A;  2M38 A;  2R0D A;  5KQ1 A;  5C6R A;  3DXD A;  1WI1 A;  1WGQ A;  4KVG B;  4Z2M B;  1KZ7 A;  1EAZ A;  2D9V A;  2IYB A;  2R09 A;  5CLQ B;  1WG7 A;  2VKI A;  2COC A;  2DLW A;  2DKQ A;  2GS0 A;  4DX8 A;  1E5W A;  1TJ6 A;  4C0A A;  4MY6 A;  2J0M A;  3PP2 A;  3V5W A;  1LW3 A;  4A6F B;  4DX9 0;  3F5R A;  2LKO A;  1FGY A;  2CY4 A;  5D3V A;  2ROV A;  5LON B;  1J0W A;  4A6K A;  2IFS A;  3PVW A;  4Z2N A;  1WGU A;  3A8P A;  2NZ8 B;  4CHJ A;  2COA A;  1OMW A;  3SUZ A;  4D0N B;  1U27 A;  4GMV A;  1EGX A;  1BTK A;  1EVH A;  1Y19 B;  3AJ4 A;  4KHO A;  1V5M A;  2NMB A;  3PVL A;  2KUP A;  5L81 A;  1U5F A;  1WVH A;  4EKU A;  1GC6 A;  4L6E A;  1QQG A;  1XKE A;  1UNQ A;  5KCV A;  4YON A;  3MDB C;  4HDO A;  1FHW A;  2DYN A;  4IOY X;  3FM8 C;  1GC7 A;  1N3H A;  2DFK A;  2FJL A;  5HE2 A;  1DDM A;  1AWE A;  4YL8 A;  5C5B A;  2W2X C;  3NSU A;  4PNK A;  1RRP B;  1BWN A;  3N7C A;  2CRF A;  4MT7 A;  4A5K A;  5C16 A;  4B6H A;  3TW1 A;  3ZDT A;  4DBB A;  5DH9 B;  3AU4 A;  3D8D A;  5J3Q A;  3X23 A;  1AQC A;  2GJY A;  3T06 A;  1MIZ B;  2V76 A;  1X05 A;  3KRX A;  5D3Y A;  2H7E A;  2DYQ A;  1OQN A;  2ROZ B;  1U5D A;  4A6H A;  1FAO A;  1V61 A;  1U5G A;  2YSZ A;  3ODX A;  2GCL A;  1UEF A;  5FI0 A;  3SV1 A;  4ZRJ A;  3LJU X;  1FHO A;  4HHV A;  2DX1 A;  4CHM A;  4CYE A;  4EMO A;  3ULC A;  1RJ2 A;  4HB2 B;  4Y94 A;  4K17 A;  2DA0 A;  2LG1 A;  2K2U A;  4HAV B;  1BTN A;  4TKN A;  5JP4 A;  2J59 M;  5HE3 A;  4ZRI A;  4WVF B;  2DX5 A;  1ZVR A;  1OY2 A;  2MDX A;  1ZSQ A;  3OAN A;  5KQ4 A;  3KSY A;  1ISN A;  2Y7B A;  1SGH A;  2GCJ A;  3TO1 A;  4H8S A;  4EJN A;  1IRS A;  1WJ1 A;  3TFM A;  1TQZ A;  2DHJ A;  4HAU B;  3UZT A;  2J0K A;  4KHA A;  1KI1 B;  2YT1 A;  4HB3 B;  1ZC3 B;  2DN6 A;  3ML4 A;  2DTC A;  2HE7 A;  1U2B A;  2RSG A;  2D11 A;  2QKL A;  4HB4 B;  1MPH A;  2Q13 A;  4NSW A;  2YS3 A;  1X1G A;  4GXB A;  3GYO A;  2RLO A;  2DKP A;  1P6S A;  1W1D A;  2RNR B;  2D4Q A;  4F7U P;  1EF1 A;  3D8E A;  2ELA A;  4HAX B;  2DHK A;  1UPQ A;  1NI2 A;  2YT0 A;  2EC1 A;  3A98 B;  5JHG A;  1J19 A;  1NTY A;  2Y8F A;  2YF0 A;  5J3Y A;  3SO6 A;  3SYX A;  3KRW A;  5J3T A;  2COF A;  2L1C A;  4WSF A;  5C5B B;  3O96 A;  3P7Z A;  3PZD A;  1XOD A;  4F7H A;  2L2I A;  2LYD A;  1BAK A;  4GMX B;  3G9W A;  2RUK B;  2YS1 A;  2E2X A;  4HB0 B;  2I1J A;  3PG7 A;  1LB1 A;  4GPT B;  3PSC A;  5C79 A;  2Z0Q A;  2RGN B;  2H7D A;  2OQB A;  3P6A A;  2I5C A;  2XQN M;  1XCG A;  3ODO A;  2ELB A;  3WYF B;  1MAI A;  3QWM A;  3A8Q A;  3PEG A;  2VSZ A;  4HAT B;  2OTX A;  2DHI A;  4TYZ A;  2EMT A;  5CLL B;  2CY5 A;  4NY0 A;  2CAY A;  2AEH A;  3ZVR A;  3ULB A;  1MK9 B;  1WJM A;  3KZ1 A;  1TXD A;  3HQC A;  1DRO A;  1ZC4 B;  5DHA B;  4K2O A;  1X11 A;  2P8V A;  5DI9 B;  3GYP A;  3KY9 A;  2D2Q A;  1K5G B;  3CXB B;  5GOW B;  2VRW B;  2Y8G A;  1Z87 A;  2MKR A;  1U5E A;  3CIK A;  2ZPY A;  1P3R A;  1FOE A;  1XD4 A;  2KGX B;  4ZRK A;  1X1F A;  4HAW B;  1K5D B;  4KAX B;  2YS5 A;  1DDV A;  1V89 A;  3SNH A;  1M7R A;  1FGZ A;  2I5F A;  2W2X D;  1I7A A;  5HE0 A;  2QKM A;  2D9Z A;  1NTV A;  1W1H A;  4IAP A;  1Q67 A;  2KCJ A;  2EMS A;  1H4R A;  2YRY A;  1UNP A;  4BBK A;  4GZU A;  5LOP B;  1ZM0 A;  1P5T A;  1PFJ A;  1H10 A;  3ODW A;  1V88 A;  1SHC A;  2P0D A;  1QC6 A;  1DDW A;  3VOQ A;  4XWX A;  2D10 A;  4HDQ A;  4PQ0 A;  2Z0O A;  4DXA B;  1U29 A;  4HAZ B;  5D27 A;  3D8F A;  2X18 A;  3WA0 A;  1X86 A;  2HTH B;  3BJI A;  5D3X A;  3U8Z A;  2ADZ A;  2JP2 A;  2LUL A;  3M1I B;  1B55 A;  4A6F A;  1UNR A;  1GG3 A;  4P7I A;  2P0H A;  1M7E A;  2UZS A;  4WJ7 A;  3RCP A;  2COD A;  2PZ1 A;  2N0Y A;  2AL6 A;  3DXE A;  3BIN A;  1MK7 B;  3VIA A;  2D9Y A;  4IFS A;  3HK0 A;  2Z0P A;  2BCJ A;  3FEH A;  2G35 A;  1Y5O A;  3AU5 A;  4F7G A;  1I2H A;  1PMS A;  1DBH A;  1PLS A;  1FHX A;  2UZR A;  5HE1 A;  2K00 A;  2MWN B;  3IVF A;  3PVU A;  2J0J A;  2LOX A;  3U7D A;  4GN1 A;  2D9W A;  3DXC A;  3QBV B;  3F0W A;  1MIX A;  2D9X A;  2RVB B;  4KHB B;  3QIJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...