2RLOA

Split ph domain of pi3-kinase enhancer
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
128
structure length
128
Chain Sequence
RAIPIKQSFLLKRSGNSLNKEWKKKYVTLSSNGFLLYHPSINDYIHSTHGKEMDLLRTTVKVPGKRPPRAISAFGPSASGSAGQAEEENFEFLIVSSTGQTWHFEAASFEERDAWVQAIESQILASLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Centaurin-gamma 1
publication title Split pleckstrin homology domain-mediated cytoplasmic-nuclear localization of PI3-kinase enhancer GTPase
pubmed doi rcsb
source organism Homo sapiens
total genus 17
structure length 128
sequence length 128
ec nomenclature
pdb deposition date 2007-07-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2rloA00
2JP2A 2COAA 2YSZA 3IVFA 3D8FA 4CYEA 4HAVB 1J0WA 4IFSA 1GC7A 1UPRA 2Z0PA 4HAXB 2G35A 3PVUA 2MDXA 3TCAA 2EMSA 1H10A 3G9WA 4KHOA 4CHMA 2COCA 5C16A 1SGHA 1XCGA 4H8SA 4PQ0A 3F5RA 2ELBA 2K2UA 2PZ1A 4XWXA 3PVLA 5C5BA 2LOXA 2R0DA 4A5KA 5LOPB 2DYNA 2D9ZA 4GPTB 1PMSA 1U5GA 2OTXA 3N7CA 1EGXA 1I2HA 4TYZA 2N0YA 4K2PA 5GOWB 5C6RA 3SUZA 1GC6A 2M14A 4YL8A 2DA0A 2H7DA 2K00A 2YS1A 3BJIA 2E2XA 3V5WA 2EC1A 1FB8A 2BCJA 4HB4B 1KZ7A 2LYDA 2W2WA 3PVWA 4F7GA 2ELAA 3DXCA 1K5GB 1FHOA 1P6SA 4A6FA 1ZVRA 4DX8A 1BAKA 1WI1A 1K5DB 4ZRKA 2W2XD 2RGNB 4K2OA 1FHWA 5JP4A 4PNKA 4WVFB 2YVCA 3X23A 4EKUA 1B55A 4K81A 4ZRIA 1KI1B 2CY5A 1P5TA 4WSFA 2DX1A 1PFJA 4HDOA 2D9VA 1W1GA 2AEHA 4D0NB 3AU4A 1QC6A 1MAIA 4DX90 1KZGA 3AJ4A 3WA0A 2I1KA 1TXDA 1DDMA 1X1FA 3PP2A 3KRXA 1OY2A 4C0AA 4HAYB 5C5BB 5J3QA 2ROZB 1IRSA 5JHHA 1RJ2A 3U8ZA 3PEGA 1AWEA 2DHIA 3A8QA 3P7ZA 2H7EA 3ULCA 3QBVB 3FM8C 1BTKA 5D3VA 2R09A 1WJMA 1XD4A 2YS3A 3HQCA 4NY0A 1OQNA 2UZRA 2D9WA 3HK0A 4IAPA 4HHVA 2RNRB 3D8DA 1FGYA 1WVHA 4KHBB 1OMWA 2D9XA 1UPQA 3FEHA 5HE0A 1Y19B 1U5DA 4A6FB 2D10A 1MK9B 3MPXA 5J3YA 3ODWA 1NI2A 2VKIA 1PLSA 4DXAB 1U29A 2COFA 3DXDA 1FAOA 4KAXB 1V88A 5DI9B 3PZDA 2KGXB 4Z2MB 3SNHA 2FJLA 2V76A 2MWNB 1DYNA 5FI0A 4A6HA 1ZC3B 3UZTA 4WJ7A 2OQBA 3D8EA 2ROVA 2DKPA 1UNPA 2D9YA 1FGZA 3CIKA 2P0HA 2D11A 4NSWA 2Y8FA 3BINA 2LULA 2DKQA 1N3HA 2CODA 1V89A 3QWMA 1U27A 4ZRJA 2YF0A 2DN6A 3KRWA 3NSUA 3KZ1A 1XKEA 2AL6A 4HAWB 2Y8GA 2J0JA 1TJ6A 1EVHA 3PG7A 4GMXB 2L2IA 4GXBA 1X05A 2I1JA 2I5CA 4MY6A 5JLJB 2RSGA 3VOQA 1V5UA 1ZSQA 1LB1A 2CY4A 3ZVRA 1M7EA 1NTVA 1NU2A 3A8PA 3MDBC 1H4RA 1U5FA 2LKOA 2MKRA 5KQ4A 2KUPA 1Z87A 1NTYA 4CHJA 5HE1A 1U5EA 3LJUX 5CLQB 5FI1A 4TKNA 4P7IA 5D3XA 1P3RA 1Y5OA 1WGUA 2QKMA 3CXBB 4GMVA 2UZSA 4A6KA 1V61A 2ZPYA 4HB0B 1MKEA 3AU5A 5KCVA 3ODXA 5D3YA 2Q13A 1DDWA 4HAZB 3TVVA 2IYBA 3HW2B 2I5FA 2GCJA 3ML4A 5J3TA 2CRFA 5KQ1A 4Z2NA 4HATB 1ZM0A 1ZC4B 5CLLB 1J19A 2CAYA 3VIAA 2P0FA 1WJ1A 2RUKB 3O96A 3P6AA 3QIJA 3F0WA 2EJ8A 1DROA 1WGQA 1MPHA 4F7HA 1FOEA 1W1DA 4HB2B 2GCLA 1DDVA 1QQGA 1LW3A 2GS0A 4GN1A 4HB3B 2ADZA 4IOYX 2Z0OA 4EJNA 2LG1A 5LONB 2HE7A 2YRYA 3GYOA 4BBKA 4F7UP 1FHXA 2K2JA 3M1IB 1RRPB 1UNQA 3PSCA 5DIFB 1UNRA 5L81A 2QKLA 4HDQA 3U7DA 4YONA 1UEFA 4K17A 2NZ8B 1V5MA 1BTNA 1X86A 2RVBB 2YS5A 1I7AA 3A98B 1SHCA 5HE2A 3SV1A 2Z0QA 4KHAA 5JHGA 2N23A 5D27A 4MT7A 1XODA 2D2QA 1X11A 1V5PA 2DTCA 1EAZA 3KSYA 3ULBA 3KY9A 1BWNA 2XQNM 3RCPA 1ISNA 5C79A 4GZUA 4L6EA 3FSSA 1DBHA 2P0DA 2J0KA 2DLWA 4DBBA 2DX5A 3OANA 2YT0A 2HTHB 2Y7BA 5HE3A 2X18A 4MK0A 2L1CA 3DXEA 3TO1A 1MIZB 3ODOA 1X1GA 4HAUB 2IFSA 1W1HA 2RLOA 2EMTA 2GJYA 3ZDTA 5EFXA 3TW1A 3SO6A 2D4QA 2P8VA 1XR0B 1MIXA 1U2BA 4EMOA 1Q67A 2DFKA 1EF1A 1E5WA 1XX0A 5DHFB 4B6HA 1TQZA 2YT1A 1GG3A 4Y94A 2MFQA 3GYPA 5DHAB 2VSZA 2W2XC 2VRWB 1AQCA 1WG7A 3WYFB 2J0MA 2M38A 2KCJA 2DHKA 3TFMA 1M7RA 3SYXA 2NMBA 3T06A 2UVMA 2DHJA 2LOZA 1MK7B 2J59M 5DH9B 2DYQA 5D3WA 4KVGB
chains in the Genus database with same CATH superfamily
2JP2A 2COAA 2YSZA 2NBVA 3IVFA 3D8FA 4CYEA 4HAVB 1J0WA 3U12A 4IFSA 1GC7A 1UPRA 2Z0PA 4HAXB 2G35A 3PVUA 2MDXA 3TCAA 2EMSA 5M4YB 1H10A 3G9WA 4KHOA 4CHMA 2COCA 5C16A 1SGHA 1XCGA 4H8SA 4PQ0A 3F5RA 2ELBA 2K2UA 2PZ1A 4XWXA 3PVLA 5C5BA 2LOXA 2R0DA 4QJ3B 4A5KA 5LOPB 2DYNA 2D9ZA 4GPTB 1PMSA 1U5GA 2OTXA 3N7CA 1EGXA 1I2HA 4QXAB 4TYZA 2N0YA 4K2PA 5GOWB 5C6RA 3SUZA 1GC6A 1ZYIA 2M14A 4YL8A 2DA0A 2H7DA 2K00A 2YS1A 3BJIA 2E2XA 3V5WA 2K8EA 5I2SA 2EC1A 1FB8A 2BCJA 4HB4B 1KZ7A 2LYDA 2W2WA 3PVWA 2Z59A 4KHBA 4F7GA 2ELAA 3DXCA 1K5GB 1FHOA 1P6SA 4A6FA 1ZVRA 4DX8A 1BAKA 1WI1A 1K5DB 4ZRKA 2W2XD 2RGNB 4K2OA 1FHWA 5JP4A 4PNKA 4WVFB 2YVCA 3X23A 4EKUA 1B55A 3B77A 4K81A 4ZRIA 1KI1B 2CY5A 4HSIA 1P5TA 4WSFA 2DX1A 1PFJA 4HDOA 2D9VA 1W1GA 2AEHA 4D0NB 3AU4A 3OHMB 1QC6A 1MAIA 4OT1A 4DX90 1KZGA 3AJ4A 3WA0A 2I1KA 1TXDA 1DDMA 1X1FA 4QJ4B 3PP2A 3KRXA 1OY2A 4C0AA 4HAYB 2RRFA 5C5BB 5J3QA 2ROZB 1IRSA 2K49A 5JHHA 1RJ2A 3U8ZA 3PEGA 1AWEA 4GOUA 2DHIA 3A8QA 3P7ZA 2H7EA 3ULCA 3QBVB 3FM8C 1MI1A 1BTKA 5D3VA 2R09A 1WJMA 2Z13A 1XD4A 2YS3A 3HQCA 4NY0A 1OQNA 2UZRA 2D9WA 3HK0A 4IAPA 4HHVA 2RNRB 3D8DA 1FGYA 1WVHA 4KHBB 1OMWA 2D9XA 1UPQA 3FEHA 5HE0A 1Y19B 1U5DA 4A6FB 2D10A 2KIGA 1MK9B 3MPXA 5J3YA 3ODWA 3NWDA 1NI2A 2VKIA 3A58A 1PLSA 4DXAB 1U29A 2COFA 3DXDA 1FAOA 4KAXB 1V88A 5DI9B 3PZDA 2KGXB 4Z2MB 3SNHA 2FJLA 2V76A 2MWNB 1DYNA 4DIXA 5FI0A 4A6HA 1ZC3B 3UZTA 4WJ7A 2OQBA 3D8EA 2ROVA 2DKPA 1UNPA 2D9YA 1FGZA 3CIKA 2P0HA 2D11A 4NSWA 2Y8FA 3BINA 2LULA 2KR0A 2DKQA 1N3HA 2CODA 3DCXA 1V89A 3QWMA 1U27A 4ZRJA 2YT2A 2YF0A 2DN6A 2ZKMX 3KRWA 3NSUA 3KZ1A 1XKEA 2AL6A 4HAWB 2Y8GA 2J0JA 1TJ6A 1EVHA 3PG7A 4GMXB 2L2IA 4GXBA 1X05A 2I1JA 2I5CA 4MY6A 5JLJB 4D6WA 5I2MA 2RSGA 2Z14A 3VOQA 1V5UA 1ZSQA 1LB1A 2CY4A 3ZVRA 1M7EA 1NTVA 1NU2A 3A8PA 3MDBC 1H4RA 1U5FA 2LKOA 2MKRA 5KQ4A 2KUPA 1Z87A 1NTYA 4CHJA 5HE1A 1U5EA 3HSAA 3LJUX 3FVCA 5CLQB 5FI1A 4TKNA 4P7IA 5D3XA 1P3RA 1Y5OA 1WGUA 2QKMA 3CXBB 4GMVA 2UZSA 4A6KA 1V61A 2ZPYA 4HB0B 1MKEA 3AU5A 5KCVA 3ODXA 5D3YA 2Q13A 1DDWA 4HAZB 3TVVA 2IYBA 3HW2B 2I5FA 2GCJA 3ML4A 5J3TA 2CRFA 5KQ1A 4Z2NA 4QJ5B 4HATB 1ZM0A 1ZC4B 2R2YA 5CLLB 1J19A 2CAYA 3VIAA 2P0FA 2FJUB 1WJ1A 2RUKB 3O96A 3NW8A 3P6AA 3QIJA 3F0WA 2EJ8A 1DROA 1WGQA 1MPHA 4CSQA 4F7HA 1FOEA 1W1DA 4HB2B 2GCLA 1DDVA 1QQGA 1LW3A 3NWAA 2GS0A 4GN1A 4HB3B 4L1RA 2ADZA 4IOYX 2Z0OA 4EJNA 2LG1A 5LONB 2HE7A 2YRYA 3GYOA 4BBKA 4F7UP 1FHXA 2K2JA 3M1IB 1RRPB 1UNQA 3PSCA 5DIFB 1UNRA 1T77A 5L81A 2QKLA 4HDQA 3U7DA 4YONA 1UEFA 4K17A 2NZ8B 1V5MA 1BTNA 1X86A 2RVBB 2YS5A 1I7AA 3A98B 1SHCA 5HE2A 3SV1A 2Z0QA 5LG4B 4KHAA 5JHGA 2N23A 5D27A 4MT7A 1XODA 2D2QA 1X11A 1V5PA 2DTCA 1EAZA 3KSYA 2GUMA 3ULBA 3KY9A 1BWNA 2XQNM 3RCPA 1ISNA 5C79A 4GZUA 4L6EA 3FSSA 1DBHA 2P0DA 2J0KA 2DLWA 4DBBA 2DX5A 2KIEA 3OANA 2YT0A 2HTHB 2Y7BA 5HE3A 2X18A 2KUQA 4MK0A 2L1CA 3DXEA 3TO1A 1MIZB 3ODOA 1X1GA 4HAUB 2IFSA 1W1HA 2RLOA 2EMTA 2GJYA 3ZDTA 5EFXA 3TW1A 3SO6A 2D4QA 2P8VA 1XR0B 1MIXA 1U2BA 4EMOA 1Q67A 2DFKA 1EF1A 1E5WA 1XX0A 5DHFB 4B6HA 1TQZA 2YT1A 1GG3A 4Y94A 3HIEA 3NWFA 2MFQA 3GYPA 5DHAB 2VSZA 2W2XC 2VRWB 1AQCA 1WG7A 3WYFB 2J0MA 2M38A 2KCJA 2DHKA 5IRSA 2Z4DA 3TFMA 1M7RA 3SYXA 2NMBA 3T06A 2UVMA 2DHJA 2LOZA 4GNKB 1MK7B 2J59M 4OSNA 5DH9B 2DYQA 5D3WA 4KVGB
chains in the Genus database with same CATH topology
2JP2A 2COAA 2YSZA 3IVFA 3D8FA 4CYEA 4HAVB 1J0WA 4IFSA 1GC7A 1UPRA 2Z0PA 4HAXB 2G35A 3PVUA 2MDXA 3TCAA 2EMSA 1H10A 3G9WA 4KHOA 4CHMA 2COCA 5C16A 1SGHA 1XCGA 4H8SA 4PQ0A 3F5RA 2ELBA 2K2UA 2PZ1A 4XWXA 3PVLA 5C5BA 2LOXA 2R0DA 4A5KA 5LOPB 2DYNA 2D9ZA 4GPTB 1PMSA 1U5GA 2OTXA 3N7CA 1EGXA 1I2HA 4TYZA 2N0YA 4K2PA 5GOWB 5C6RA 3SUZA 1GC6A 2M14A 4YL8A 2DA0A 2H7DA 2K00A 2YS1A 3BJIA 2E2XA 3V5WA 2EC1A 1FB8A 2BCJA 4HB4B 1KZ7A 2LYDA 2W2WA 3PVWA 4F7GA 2ELAA 3DXCA 1K5GB 1FHOA 1P6SA 4A6FA 1ZVRA 4DX8A 1BAKA 1WI1A 1K5DB 4ZRKA 2W2XD 2RGNB 4K2OA 1FHWA 5JP4A 4PNKA 4WVFB 2YVCA 3X23A 4EKUA 1B55A 4K81A 4ZRIA 1KI1B 2CY5A 1P5TA 4WSFA 2DX1A 1PFJA 4HDOA 2D9VA 1W1GA 2AEHA 4D0NB 3AU4A 1QC6A 1MAIA 4DX90 1KZGA 3AJ4A 3WA0A 2I1KA 1TXDA 1DDMA 1X1FA 3PP2A 3KRXA 1OY2A 4C0AA 4HAYB 5C5BB 5J3QA 2ROZB 1IRSA 5JHHA 1RJ2A 3U8ZA 3PEGA 1AWEA 2DHIA 3A8QA 3P7ZA 2H7EA 3ULCA 3QBVB 3FM8C 1BTKA 5D3VA 2R09A 1WJMA 1XD4A 2YS3A 3HQCA 4NY0A 1OQNA 2UZRA 2D9WA 3HK0A 4IAPA 4HHVA 2RNRB 3D8DA 1FGYA 1WVHA 4KHBB 1OMWA 2D9XA 1UPQA 3FEHA 5HE0A 1Y19B 1U5DA 4A6FB 2D10A 1MK9B 3MPXA 5J3YA 3ODWA 1NI2A 2VKIA 1PLSA 4DXAB 1U29A 2COFA 3DXDA 1FAOA 4KAXB 1V88A 5DI9B 3PZDA 2KGXB 4Z2MB 3SNHA 2FJLA 2V76A 2MWNB 1DYNA 5FI0A 4A6HA 1ZC3B 3UZTA 4WJ7A 2OQBA 3D8EA 2ROVA 2DKPA 1UNPA 2D9YA 1FGZA 3CIKA 2P0HA 2D11A 4NSWA 2Y8FA 3BINA 2LULA 2DKQA 1N3HA 2CODA 1V89A 3QWMA 1U27A 4ZRJA 2YF0A 2DN6A 3KRWA 3NSUA 3KZ1A 1XKEA 2AL6A 4HAWB 2Y8GA 2J0JA 1TJ6A 1EVHA 3PG7A 4GMXB 2L2IA 4GXBA 1X05A 2I1JA 2I5CA 4MY6A 5JLJB 2RSGA 3VOQA 1V5UA 1ZSQA 1LB1A 2CY4A 3ZVRA 1M7EA 1NTVA 1NU2A 3A8PA 3MDBC 1H4RA 1U5FA 2LKOA 2MKRA 5KQ4A 2KUPA 1Z87A 1NTYA 4CHJA 5HE1A 1U5EA 3LJUX 5CLQB 5FI1A 4TKNA 4P7IA 5D3XA 1P3RA 1Y5OA 1WGUA 2QKMA 3CXBB 4GMVA 2UZSA 4A6KA 1V61A 2ZPYA 4HB0B 1MKEA 3AU5A 5KCVA 3ODXA 5D3YA 2Q13A 1DDWA 4HAZB 3TVVA 2IYBA 3HW2B 2I5FA 2GCJA 3ML4A 5J3TA 2CRFA 5KQ1A 4Z2NA 4HATB 1ZM0A 1ZC4B 5CLLB 1J19A 2CAYA 3VIAA 2P0FA 1WJ1A 2RUKB 3O96A 3P6AA 3QIJA 3F0WA 2EJ8A 1DROA 1WGQA 1MPHA 4F7HA 1FOEA 1W1DA 4HB2B 2GCLA 1DDVA 1QQGA 1LW3A 2GS0A 4GN1A 4HB3B 2ADZA 4IOYX 2Z0OA 4EJNA 2LG1A 5LONB 2HE7A 2YRYA 3GYOA 4BBKA 4F7UP 1FHXA 2K2JA 3M1IB 1RRPB 1UNQA 3PSCA 5DIFB 1UNRA 5L81A 2QKLA 4HDQA 3U7DA 4YONA 1UEFA 4K17A 2NZ8B 1V5MA 1BTNA 1X86A 2RVBB 2YS5A 1I7AA 3A98B 1SHCA 5HE2A 3SV1A 2Z0QA 4KHAA 5JHGA 2N23A 5D27A 4MT7A 1XODA 2D2QA 1X11A 1V5PA 2DTCA 1EAZA 3KSYA 3ULBA 3KY9A 1BWNA 2XQNM 3RCPA 1ISNA 5C79A 4GZUA 4L6EA 3FSSA 1DBHA 2P0DA 2J0KA 2DLWA 4DBBA 2DX5A 3OANA 2YT0A 2HTHB 2Y7BA 5HE3A 2X18A 4MK0A 2L1CA 3DXEA 3TO1A 1MIZB 3ODOA 1X1GA 4HAUB 2IFSA 1W1HA 2RLOA 2EMTA 2GJYA 3ZDTA 5EFXA 3TW1A 3SO6A 2D4QA 2P8VA 1XR0B 1MIXA 1U2BA 4EMOA 1Q67A 2DFKA 1EF1A 1E5WA 1XX0A 5DHFB 4B6HA 1TQZA 2YT1A 1GG3A 4Y94A 2MFQA 3GYPA 5DHAB 2VSZA 2W2XC 2VRWB 1AQCA 1WG7A 3WYFB 2J0MA 2M38A 2KCJA 2DHKA 3TFMA 1M7RA 3SYXA 2NMBA 3T06A 2UVMA 2DHJA 2LOZA 1MK7B 2J59M 5DH9B 2DYQA 5D3WA 4KVGB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JP2 A;  2COA A;  2YSZ A;  3IVF A;  3D8F A;  4CYE A;  4HAV B;  1J0W A;  4IFS A;  1GC7 A;  1UPR A;  2Z0P A;  4HAX B;  2G35 A;  3PVU A;  2MDX A;  3TCA A;  2EMS A;  1H10 A;  3G9W A;  4KHO A;  4CHM A;  2COC A;  5C16 A;  1SGH A;  1XCG A;  4H8S A;  4PQ0 A;  3F5R A;  2ELB A;  2K2U A;  2PZ1 A;  4XWX A;  3PVL A;  5C5B A;  2LOX A;  2R0D A;  4A5K A;  5LOP B;  2DYN A;  2D9Z A;  4GPT B;  1PMS A;  1U5G A;  2OTX A;  3N7C A;  1EGX A;  1I2H A;  4TYZ A;  2N0Y A;  4K2P A;  5GOW B;  5C6R A;  3SUZ A;  1GC6 A;  2M14 A;  4YL8 A;  2DA0 A;  2H7D A;  2K00 A;  2YS1 A;  3BJI A;  2E2X A;  3V5W A;  2EC1 A;  1FB8 A;  2BCJ A;  4HB4 B;  1KZ7 A;  2LYD A;  2W2W A;  3PVW A;  4F7G A;  2ELA A;  3DXC A;  1K5G B;  1FHO A;  1P6S A;  4A6F A;  1ZVR A;  4DX8 A;  1BAK A;  1WI1 A;  1K5D B;  4ZRK A;  2W2X D;  2RGN B;  4K2O A;  1FHW A;  5JP4 A;  4PNK A;  4WVF B;  2YVC A;  3X23 A;  4EKU A;  1B55 A;  4K81 A;  4ZRI A;  1KI1 B;  2CY5 A;  1P5T A;  4WSF A;  2DX1 A;  1PFJ A;  4HDO A;  2D9V A;  1W1G A;  2AEH A;  4D0N B;  3AU4 A;  1QC6 A;  1MAI A;  4DX9 0;  1KZG A;  3AJ4 A;  3WA0 A;  2I1K A;  1TXD A;  1DDM A;  1X1F A;  3PP2 A;  3KRX A;  1OY2 A;  4C0A A;  4HAY B;  5C5B B;  5J3Q A;  2ROZ B;  1IRS A;  5JHH A;  1RJ2 A;  3U8Z A;  3PEG A;  1AWE A;  2DHI A;  3A8Q A;  3P7Z A;  2H7E A;  3ULC A;  3QBV B;  3FM8 C;  1BTK A;  5D3V A;  2R09 A;  1WJM A;  1XD4 A;  2YS3 A;  3HQC A;  4NY0 A;  1OQN A;  2UZR A;  2D9W A;  3HK0 A;  4IAP A;  4HHV A;  2RNR B;  3D8D A;  1FGY A;  1WVH A;  4KHB B;  1OMW A;  2D9X A;  1UPQ A;  3FEH A;  5HE0 A;  1Y19 B;  1U5D A;  4A6F B;  2D10 A;  1MK9 B;  3MPX A;  5J3Y A;  3ODW A;  1NI2 A;  2VKI A;  1PLS A;  4DXA B;  1U29 A;  2COF A;  3DXD A;  1FAO A;  4KAX B;  1V88 A;  5DI9 B;  3PZD A;  2KGX B;  4Z2M B;  3SNH A;  2FJL A;  2V76 A;  2MWN B;  1DYN A;  5FI0 A;  4A6H A;  1ZC3 B;  3UZT A;  4WJ7 A;  2OQB A;  3D8E A;  2ROV A;  2DKP A;  1UNP A;  2D9Y A;  1FGZ A;  3CIK A;  2P0H A;  2D11 A;  4NSW A;  2Y8F A;  3BIN A;  2LUL A;  2DKQ A;  1N3H A;  2COD A;  1V89 A;  3QWM A;  1U27 A;  4ZRJ A;  2YF0 A;  2DN6 A;  3KRW A;  3NSU A;  3KZ1 A;  1XKE A;  2AL6 A;  4HAW B;  2Y8G A;  2J0J A;  1TJ6 A;  1EVH A;  3PG7 A;  4GMX B;  2L2I A;  4GXB A;  1X05 A;  2I1J A;  2I5C A;  4MY6 A;  5JLJ B;  2RSG A;  3VOQ A;  1V5U A;  1ZSQ A;  1LB1 A;  2CY4 A;  3ZVR A;  1M7E A;  1NTV A;  1NU2 A;  3A8P A;  3MDB C;  1H4R A;  1U5F A;  2LKO A;  2MKR A;  5KQ4 A;  2KUP A;  1Z87 A;  1NTY A;  4CHJ A;  5HE1 A;  1U5E A;  3LJU X;  5CLQ B;  5FI1 A;  4TKN A;  4P7I A;  5D3X A;  1P3R A;  1Y5O A;  1WGU A;  2QKM A;  3CXB B;  4GMV A;  2UZS A;  4A6K A;  1V61 A;  2ZPY A;  4HB0 B;  1MKE A;  3AU5 A;  5KCV A;  3ODX A;  5D3Y A;  2Q13 A;  1DDW A;  4HAZ B;  3TVV A;  2IYB A;  3HW2 B;  2I5F A;  2GCJ A;  3ML4 A;  5J3T A;  2CRF A;  5KQ1 A;  4Z2N A;  4HAT B;  1ZM0 A;  1ZC4 B;  5CLL B;  1J19 A;  2CAY A;  3VIA A;  2P0F A;  1WJ1 A;  2RUK B;  3O96 A;  3P6A A;  3QIJ A;  3F0W A;  2EJ8 A;  1DRO A;  1WGQ A;  1MPH A;  4F7H A;  1FOE A;  1W1D A;  4HB2 B;  2GCL A;  1DDV A;  1QQG A;  1LW3 A;  2GS0 A;  4GN1 A;  4HB3 B;  2ADZ A;  4IOY X;  2Z0O A;  4EJN A;  2LG1 A;  5LON B;  2HE7 A;  2YRY A;  3GYO A;  4BBK A;  4F7U P;  1FHX A;  2K2J A;  3M1I B;  1RRP B;  1UNQ A;  3PSC A;  5DIF B;  1UNR A;  5L81 A;  2QKL A;  4HDQ A;  3U7D A;  4YON A;  1UEF A;  4K17 A;  2NZ8 B;  1V5M A;  1BTN A;  1X86 A;  2RVB B;  2YS5 A;  1I7A A;  3A98 B;  1SHC A;  5HE2 A;  3SV1 A;  2Z0Q A;  4KHA A;  5JHG A;  2N23 A;  5D27 A;  4MT7 A;  1XOD A;  2D2Q A;  1X11 A;  1V5P A;  2DTC A;  1EAZ A;  3KSY A;  3ULB A;  3KY9 A;  1BWN A;  2XQN M;  3RCP A;  1ISN A;  5C79 A;  4GZU A;  4L6E A;  3FSS A;  1DBH A;  2P0D A;  2J0K A;  2DLW A;  4DBB A;  2DX5 A;  3OAN A;  2YT0 A;  2HTH B;  2Y7B A;  5HE3 A;  2X18 A;  4MK0 A;  2L1C A;  3DXE A;  3TO1 A;  1MIZ B;  3ODO A;  1X1G A;  4HAU B;  2IFS A;  1W1H A;  2RLO A;  2EMT A;  2GJY A;  3ZDT A;  5EFX A;  3TW1 A;  3SO6 A;  2D4Q A;  2P8V A;  1XR0 B;  1MIX A;  1U2B A;  4EMO A;  1Q67 A;  2DFK A;  1EF1 A;  1E5W A;  1XX0 A;  5DHF B;  4B6H A;  1TQZ A;  2YT1 A;  1GG3 A;  4Y94 A;  2MFQ A;  3GYP A;  5DHA B;  2VSZ A;  2W2X C;  2VRW B;  1AQC A;  1WG7 A;  3WYF B;  2J0M A;  2M38 A;  2KCJ A;  2DHK A;  3TFM A;  1M7R A;  3SYX A;  2NMB A;  3T06 A;  2UVM A;  2DHJ A;  2LOZ A;  1MK7 B;  2J59 M;  5DH9 B;  2DYQ A;  5D3W A;  4KVG B; 
#chains in the Genus database with same CATH topology
 2JP2 A;  2COA A;  2YSZ A;  2NBV A;  3IVF A;  3D8F A;  4CYE A;  4HAV B;  1J0W A;  3U12 A;  4IFS A;  1GC7 A;  1UPR A;  2Z0P A;  4HAX B;  2G35 A;  3PVU A;  2MDX A;  3TCA A;  2EMS A;  5M4Y B;  1H10 A;  3G9W A;  4KHO A;  4CHM A;  2COC A;  5C16 A;  1SGH A;  1XCG A;  4H8S A;  4PQ0 A;  3F5R A;  2ELB A;  2K2U A;  2PZ1 A;  4XWX A;  3PVL A;  5C5B A;  2LOX A;  2R0D A;  4QJ3 B;  4A5K A;  5LOP B;  2DYN A;  2D9Z A;  4GPT B;  1PMS A;  1U5G A;  2OTX A;  3N7C A;  1EGX A;  1I2H A;  4QXA B;  4TYZ A;  2N0Y A;  4K2P A;  5GOW B;  5C6R A;  3SUZ A;  1GC6 A;  1ZYI A;  2M14 A;  4YL8 A;  2DA0 A;  2H7D A;  2K00 A;  2YS1 A;  3BJI A;  2E2X A;  3V5W A;  2K8E A;  5I2S A;  2EC1 A;  1FB8 A;  2BCJ A;  4HB4 B;  1KZ7 A;  2LYD A;  2W2W A;  3PVW A;  2Z59 A;  4KHB A;  4F7G A;  2ELA A;  3DXC A;  1K5G B;  1FHO A;  1P6S A;  4A6F A;  1ZVR A;  4DX8 A;  1BAK A;  1WI1 A;  1K5D B;  4ZRK A;  2W2X D;  2RGN B;  4K2O A;  1FHW A;  5JP4 A;  4PNK A;  4WVF B;  2YVC A;  3X23 A;  4EKU A;  1B55 A;  3B77 A;  4K81 A;  4ZRI A;  1KI1 B;  2CY5 A;  4HSI A;  1P5T A;  4WSF A;  2DX1 A;  1PFJ A;  4HDO A;  2D9V A;  1W1G A;  2AEH A;  4D0N B;  3AU4 A;  3OHM B;  1QC6 A;  1MAI A;  4OT1 A;  4DX9 0;  1KZG A;  3AJ4 A;  3WA0 A;  2I1K A;  1TXD A;  1DDM A;  1X1F A;  4QJ4 B;  3PP2 A;  3KRX A;  1OY2 A;  4C0A A;  4HAY B;  2RRF A;  5C5B B;  5J3Q A;  2ROZ B;  1IRS A;  2K49 A;  5JHH A;  1RJ2 A;  3U8Z A;  3PEG A;  1AWE A;  4GOU A;  2DHI A;  3A8Q A;  3P7Z A;  2H7E A;  3ULC A;  3QBV B;  3FM8 C;  1MI1 A;  1BTK A;  5D3V A;  2R09 A;  1WJM A;  2Z13 A;  1XD4 A;  2YS3 A;  3HQC A;  4NY0 A;  1OQN A;  2UZR A;  2D9W A;  3HK0 A;  4IAP A;  4HHV A;  2RNR B;  3D8D A;  1FGY A;  1WVH A;  4KHB B;  1OMW A;  2D9X A;  1UPQ A;  3FEH A;  5HE0 A;  1Y19 B;  1U5D A;  4A6F B;  2D10 A;  2KIG A;  1MK9 B;  3MPX A;  5J3Y A;  3ODW A;  3NWD A;  1NI2 A;  2VKI A;  3A58 A;  1PLS A;  4DXA B;  1U29 A;  2COF A;  3DXD A;  1FAO A;  4KAX B;  1V88 A;  5DI9 B;  3PZD A;  2KGX B;  4Z2M B;  3SNH A;  2FJL A;  2V76 A;  2MWN B;  1DYN A;  4DIX A;  5FI0 A;  4A6H A;  1ZC3 B;  3UZT A;  4WJ7 A;  2OQB A;  3D8E A;  2ROV A;  2DKP A;  1UNP A;  2D9Y A;  1FGZ A;  3CIK A;  2P0H A;  2D11 A;  4NSW A;  2Y8F A;  3BIN A;  2LUL A;  2KR0 A;  2DKQ A;  1N3H A;  2COD A;  3DCX A;  1V89 A;  3QWM A;  1U27 A;  4ZRJ A;  2YT2 A;  2YF0 A;  2DN6 A;  2ZKM X;  3KRW A;  3NSU A;  3KZ1 A;  1XKE A;  2AL6 A;  4HAW B;  2Y8G A;  2J0J A;  1TJ6 A;  1EVH A;  3PG7 A;  4GMX B;  2L2I A;  4GXB A;  1X05 A;  2I1J A;  2I5C A;  4MY6 A;  5JLJ B;  4D6W A;  5I2M A;  2RSG A;  2Z14 A;  3VOQ A;  1V5U A;  1ZSQ A;  1LB1 A;  2CY4 A;  3ZVR A;  1M7E A;  1NTV A;  1NU2 A;  3A8P A;  3MDB C;  1H4R A;  1U5F A;  2LKO A;  2MKR A;  5KQ4 A;  2KUP A;  1Z87 A;  1NTY A;  4CHJ A;  5HE1 A;  1U5E A;  3HSA A;  3LJU X;  3FVC A;  5CLQ B;  5FI1 A;  4TKN A;  4P7I A;  5D3X A;  1P3R A;  1Y5O A;  1WGU A;  2QKM A;  3CXB B;  4GMV A;  2UZS A;  4A6K A;  1V61 A;  2ZPY A;  4HB0 B;  1MKE A;  3AU5 A;  5KCV A;  3ODX A;  5D3Y A;  2Q13 A;  1DDW A;  4HAZ B;  3TVV A;  2IYB A;  3HW2 B;  2I5F A;  2GCJ A;  3ML4 A;  5J3T A;  2CRF A;  5KQ1 A;  4Z2N A;  4QJ5 B;  4HAT B;  1ZM0 A;  1ZC4 B;  2R2Y A;  5CLL B;  1J19 A;  2CAY A;  3VIA A;  2P0F A;  2FJU B;  1WJ1 A;  2RUK B;  3O96 A;  3NW8 A;  3P6A A;  3QIJ A;  3F0W A;  2EJ8 A;  1DRO A;  1WGQ A;  1MPH A;  4CSQ A;  4F7H A;  1FOE A;  1W1D A;  4HB2 B;  2GCL A;  1DDV A;  1QQG A;  1LW3 A;  3NWA A;  2GS0 A;  4GN1 A;  4HB3 B;  4L1R A;  2ADZ A;  4IOY X;  2Z0O A;  4EJN A;  2LG1 A;  5LON B;  2HE7 A;  2YRY A;  3GYO A;  4BBK A;  4F7U P;  1FHX A;  2K2J A;  3M1I B;  1RRP B;  1UNQ A;  3PSC A;  5DIF B;  1UNR A;  1T77 A;  5L81 A;  2QKL A;  4HDQ A;  3U7D A;  4YON A;  1UEF A;  4K17 A;  2NZ8 B;  1V5M A;  1BTN A;  1X86 A;  2RVB B;  2YS5 A;  1I7A A;  3A98 B;  1SHC A;  5HE2 A;  3SV1 A;  2Z0Q A;  5LG4 B;  4KHA A;  5JHG A;  2N23 A;  5D27 A;  4MT7 A;  1XOD A;  2D2Q A;  1X11 A;  1V5P A;  2DTC A;  1EAZ A;  3KSY A;  2GUM A;  3ULB A;  3KY9 A;  1BWN A;  2XQN M;  3RCP A;  1ISN A;  5C79 A;  4GZU A;  4L6E A;  3FSS A;  1DBH A;  2P0D A;  2J0K A;  2DLW A;  4DBB A;  2DX5 A;  2KIE A;  3OAN A;  2YT0 A;  2HTH B;  2Y7B A;  5HE3 A;  2X18 A;  2KUQ A;  4MK0 A;  2L1C A;  3DXE A;  3TO1 A;  1MIZ B;  3ODO A;  1X1G A;  4HAU B;  2IFS A;  1W1H A;  2RLO A;  2EMT A;  2GJY A;  3ZDT A;  5EFX A;  3TW1 A;  3SO6 A;  2D4Q A;  2P8V A;  1XR0 B;  1MIX A;  1U2B A;  4EMO A;  1Q67 A;  2DFK A;  1EF1 A;  1E5W A;  1XX0 A;  5DHF B;  4B6H A;  1TQZ A;  2YT1 A;  1GG3 A;  4Y94 A;  3HIE A;  3NWF A;  2MFQ A;  3GYP A;  5DHA B;  2VSZ A;  2W2X C;  2VRW B;  1AQC A;  1WG7 A;  3WYF B;  2J0M A;  2M38 A;  2KCJ A;  2DHK A;  5IRS A;  2Z4D A;  3TFM A;  1M7R A;  3SYX A;  2NMB A;  3T06 A;  2UVM A;  2DHJ A;  2LOZ A;  4GNK B;  1MK7 B;  2J59 M;  4OSN A;  5DH9 B;  2DYQ A;  5D3W A;  4KVG B; 
#chains in the Genus database with same CATH homology
 2JP2 A;  2COA A;  2YSZ A;  3IVF A;  3D8F A;  4CYE A;  4HAV B;  1J0W A;  4IFS A;  1GC7 A;  1UPR A;  2Z0P A;  4HAX B;  2G35 A;  3PVU A;  2MDX A;  3TCA A;  2EMS A;  1H10 A;  3G9W A;  4KHO A;  4CHM A;  2COC A;  5C16 A;  1SGH A;  1XCG A;  4H8S A;  4PQ0 A;  3F5R A;  2ELB A;  2K2U A;  2PZ1 A;  4XWX A;  3PVL A;  5C5B A;  2LOX A;  2R0D A;  4A5K A;  5LOP B;  2DYN A;  2D9Z A;  4GPT B;  1PMS A;  1U5G A;  2OTX A;  3N7C A;  1EGX A;  1I2H A;  4TYZ A;  2N0Y A;  4K2P A;  5GOW B;  5C6R A;  3SUZ A;  1GC6 A;  2M14 A;  4YL8 A;  2DA0 A;  2H7D A;  2K00 A;  2YS1 A;  3BJI A;  2E2X A;  3V5W A;  2EC1 A;  1FB8 A;  2BCJ A;  4HB4 B;  1KZ7 A;  2LYD A;  2W2W A;  3PVW A;  4F7G A;  2ELA A;  3DXC A;  1K5G B;  1FHO A;  1P6S A;  4A6F A;  1ZVR A;  4DX8 A;  1BAK A;  1WI1 A;  1K5D B;  4ZRK A;  2W2X D;  2RGN B;  4K2O A;  1FHW A;  5JP4 A;  4PNK A;  4WVF B;  2YVC A;  3X23 A;  4EKU A;  1B55 A;  4K81 A;  4ZRI A;  1KI1 B;  2CY5 A;  1P5T A;  4WSF A;  2DX1 A;  1PFJ A;  4HDO A;  2D9V A;  1W1G A;  2AEH A;  4D0N B;  3AU4 A;  1QC6 A;  1MAI A;  4DX9 0;  1KZG A;  3AJ4 A;  3WA0 A;  2I1K A;  1TXD A;  1DDM A;  1X1F A;  3PP2 A;  3KRX A;  1OY2 A;  4C0A A;  4HAY B;  5C5B B;  5J3Q A;  2ROZ B;  1IRS A;  5JHH A;  1RJ2 A;  3U8Z A;  3PEG A;  1AWE A;  2DHI A;  3A8Q A;  3P7Z A;  2H7E A;  3ULC A;  3QBV B;  3FM8 C;  1BTK A;  5D3V A;  2R09 A;  1WJM A;  1XD4 A;  2YS3 A;  3HQC A;  4NY0 A;  1OQN A;  2UZR A;  2D9W A;  3HK0 A;  4IAP A;  4HHV A;  2RNR B;  3D8D A;  1FGY A;  1WVH A;  4KHB B;  1OMW A;  2D9X A;  1UPQ A;  3FEH A;  5HE0 A;  1Y19 B;  1U5D A;  4A6F B;  2D10 A;  1MK9 B;  3MPX A;  5J3Y A;  3ODW A;  1NI2 A;  2VKI A;  1PLS A;  4DXA B;  1U29 A;  2COF A;  3DXD A;  1FAO A;  4KAX B;  1V88 A;  5DI9 B;  3PZD A;  2KGX B;  4Z2M B;  3SNH A;  2FJL A;  2V76 A;  2MWN B;  1DYN A;  5FI0 A;  4A6H A;  1ZC3 B;  3UZT A;  4WJ7 A;  2OQB A;  3D8E A;  2ROV A;  2DKP A;  1UNP A;  2D9Y A;  1FGZ A;  3CIK A;  2P0H A;  2D11 A;  4NSW A;  2Y8F A;  3BIN A;  2LUL A;  2DKQ A;  1N3H A;  2COD A;  1V89 A;  3QWM A;  1U27 A;  4ZRJ A;  2YF0 A;  2DN6 A;  3KRW A;  3NSU A;  3KZ1 A;  1XKE A;  2AL6 A;  4HAW B;  2Y8G A;  2J0J A;  1TJ6 A;  1EVH A;  3PG7 A;  4GMX B;  2L2I A;  4GXB A;  1X05 A;  2I1J A;  2I5C A;  4MY6 A;  5JLJ B;  2RSG A;  3VOQ A;  1V5U A;  1ZSQ A;  1LB1 A;  2CY4 A;  3ZVR A;  1M7E A;  1NTV A;  1NU2 A;  3A8P A;  3MDB C;  1H4R A;  1U5F A;  2LKO A;  2MKR A;  5KQ4 A;  2KUP A;  1Z87 A;  1NTY A;  4CHJ A;  5HE1 A;  1U5E A;  3LJU X;  5CLQ B;  5FI1 A;  4TKN A;  4P7I A;  5D3X A;  1P3R A;  1Y5O A;  1WGU A;  2QKM A;  3CXB B;  4GMV A;  2UZS A;  4A6K A;  1V61 A;  2ZPY A;  4HB0 B;  1MKE A;  3AU5 A;  5KCV A;  3ODX A;  5D3Y A;  2Q13 A;  1DDW A;  4HAZ B;  3TVV A;  2IYB A;  3HW2 B;  2I5F A;  2GCJ A;  3ML4 A;  5J3T A;  2CRF A;  5KQ1 A;  4Z2N A;  4HAT B;  1ZM0 A;  1ZC4 B;  5CLL B;  1J19 A;  2CAY A;  3VIA A;  2P0F A;  1WJ1 A;  2RUK B;  3O96 A;  3P6A A;  3QIJ A;  3F0W A;  2EJ8 A;  1DRO A;  1WGQ A;  1MPH A;  4F7H A;  1FOE A;  1W1D A;  4HB2 B;  2GCL A;  1DDV A;  1QQG A;  1LW3 A;  2GS0 A;  4GN1 A;  4HB3 B;  2ADZ A;  4IOY X;  2Z0O A;  4EJN A;  2LG1 A;  5LON B;  2HE7 A;  2YRY A;  3GYO A;  4BBK A;  4F7U P;  1FHX A;  2K2J A;  3M1I B;  1RRP B;  1UNQ A;  3PSC A;  5DIF B;  1UNR A;  5L81 A;  2QKL A;  4HDQ A;  3U7D A;  4YON A;  1UEF A;  4K17 A;  2NZ8 B;  1V5M A;  1BTN A;  1X86 A;  2RVB B;  2YS5 A;  1I7A A;  3A98 B;  1SHC A;  5HE2 A;  3SV1 A;  2Z0Q A;  4KHA A;  5JHG A;  2N23 A;  5D27 A;  4MT7 A;  1XOD A;  2D2Q A;  1X11 A;  1V5P A;  2DTC A;  1EAZ A;  3KSY A;  3ULB A;  3KY9 A;  1BWN A;  2XQN M;  3RCP A;  1ISN A;  5C79 A;  4GZU A;  4L6E A;  3FSS A;  1DBH A;  2P0D A;  2J0K A;  2DLW A;  4DBB A;  2DX5 A;  3OAN A;  2YT0 A;  2HTH B;  2Y7B A;  5HE3 A;  2X18 A;  4MK0 A;  2L1C A;  3DXE A;  3TO1 A;  1MIZ B;  3ODO A;  1X1G A;  4HAU B;  2IFS A;  1W1H A;  2RLO A;  2EMT A;  2GJY A;  3ZDT A;  5EFX A;  3TW1 A;  3SO6 A;  2D4Q A;  2P8V A;  1XR0 B;  1MIX A;  1U2B A;  4EMO A;  1Q67 A;  2DFK A;  1EF1 A;  1E5W A;  1XX0 A;  5DHF B;  4B6H A;  1TQZ A;  2YT1 A;  1GG3 A;  4Y94 A;  2MFQ A;  3GYP A;  5DHA B;  2VSZ A;  2W2X C;  2VRW B;  1AQC A;  1WG7 A;  3WYF B;  2J0M A;  2M38 A;  2KCJ A;  2DHK A;  3TFM A;  1M7R A;  3SYX A;  2NMB A;  3T06 A;  2UVM A;  2DHJ A;  2LOZ A;  1MK7 B;  2J59 M;  5DH9 B;  2DYQ A;  5D3W A;  4KVG B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...