1FHXA

Structure of the pleckstrin homology domain from grp1 in complex with inositol 1,3,4,5-tetrakisphosphate
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
123
structure length
123
Chain Sequence
NPDREGWLLKLGGRVKTWKRRWFILTDNCLYYFEYTTDKEPRGIIPLENLSIREVEDPRKPNCFELYNPSHKGQVIKACKTEADGRVVEGNHVVYRISAPSPEEKEEWMKSIKASISRDPFYD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords GUANINE NUCLEOTIDE EXCHANGE FACTOR AND INTEGRIN BINDING PROT
publication title Structural basis for discrimination of 3-phosphoinositides by pleckstrin homology domains
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
total genus 17
structure length 123
sequence length 123
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1fhxA00
1U5EA 4GPTB 5HE2A 2P0HA 3D8FA 1NTYA 2Y7BA 5L81A 1N3HA 1PFJA 3F0WA 1TJ6A 1E5WA 4A6FA 5DIFB 1P3RA 2Y8GA 1U27A 2DN6A 2J0MA 4Y94A 3DXEA 2KGXB 4MY6A 2M38A 3D8EA 5DI9B 1UEFA 2RNRB 2DHKA 1LB1A 1V88A 2D9ZA 2GCJA 3HQCA 5D3YA 4D0NB 1SGHA 2BCJA 4IOYX 1XX0A 2H7DA 3M1IB 4K2PA 3PP2A 1FHWA 1UNPA 1J0WA 4BBKA 2CRFA 1DYNA 2X18A 2AL6A 1MK7B 2MWNB 5C6RA 3TFMA 2J59M 4C0AA 3ODXA 2DKPA 4WVFB 4HATB 1DDVA 2EC1A 2FJLA 3FM8C 1M7RA 2YSZA 1ZM0A 2EMSA 2D9VA 1I2HA 4NY0A 2ELAA 5D27A 2RUKB 1NTVA 1U29A 4KAXB 4F7HA 3SUZA 2K00A 2DA0A 3PZDA 3U7DA 3AJ4A 1W1GA 4GMVA 5J3TA 1FHXA 5DHFB 4PNKA 2D10A 3ULCA 4HB4B 1QQGA 3ULBA 2CAYA 3DXCA 1B55A 5EFXA 3X23A 1KZ7A 5DH9B 1U5DA 2MDXA 4XWXA 2DYQA 3WA0A 1Z87A 1WGUA 4WSFA 2LG1A 3D8DA 3TCAA 5J3QA 3UZTA 5KCVA 2N0YA 2W2WA 5D3WA 1AQCA 2IFSA 2GJYA 2EJ8A 4DXAB 2VSZA 4P7IA 3WYFB 1H10A 1PLSA 4DX90 3ODOA 3ZDTA 4MK0A 1MAIA 2IYBA 3KY9A 4TYZA 3CXBB 2W2XC 3LJUX 5C5BA 2Z0OA 1XCGA 3BJIA 1K5DB 1BWNA 2CY4A 4A6HA 1FGZA 3SNHA 4PQ0A 5GOWB 2YF0A 2ROZB 2I5CA 3G9WA 2GS0A 2J0JA 1P6SA 3PVUA 4IAPA 1DDWA 2ZPYA 1DDMA 3U8ZA 4ZRKA 3PG7A 2D9YA 3AU4A 2L1CA 2LOXA 3T06A 2XQNM 2J0KA 1U2BA 1BTNA 2D2QA 2VKIA 5JHHA 2P0DA 3F5RA 2HE7A 2HTHB 2YT0A 5JHGA 2R09A 3IVFA 5JP4A 2DFKA 1UNQA 4A5KA 1EAZA 1GC7A 2DTCA 4KHAA 2R0DA 1W1DA 5LOPB 4HAUB 4DBBA 1KZGA 4HDQA 1EF1A 1FOEA 1OY2A 1X05A 4HAYB 1V89A 2KUPA 3BINA 1UNRA 3SYXA 2Y8FA 1MPHA 2D11A 2DKQA 4MT7A 2PZ1A 3GYPA 3ZVRA 2M14A 1ISNA 2G35A 5HE3A 4CHJA 1WJMA 5HE0A 2E2XA 2Q13A 4Z2NA 1FHOA 1XKEA 4K2OA 1XD4A 4EKUA 2CY5A 1WI1A 4HB2B 3P6AA 2H7EA 1OMWA 2LOZA 4TKNA 3VIAA 4H8SA 5C5BB 3TVVA 2DX1A 5FI0A 3PVWA 2ROVA 3ML4A 3ODWA 2I1KA 3PVLA 2LKOA 3PEGA 4CYEA 2I5FA 4GN1A 4A6FB 3QIJA 2W2XD 1BAKA 4K81A 2COFA 3TW1A 2NZ8B 2DYNA 1U5FA 3KRWA 4HDOA 2ELBA 1M7EA 2YT1A 1ZC3B 4NSWA 1DBHA 4CHMA 2COCA 3PSCA 4GMXB 1X1FA 3SO6A 4F7UP 1WGQA 1UPQA 5J3YA 3MDBC 5LONB 1Q67A 1XODA 4Z2MB 2UZSA 3O96A 2D4QA 2EMTA 2K2UA 5CLQB 1EGXA 1FGYA 3A98B 4HAWB 4HAVB 4WJ7A 1RJ2A 1P5TA 3CIKA 1GG3A 4F7GA 1V5MA 1X86A 1LW3A 1UPRA 3QWMA 2L2IA 1Y19B 2N23A 3RCPA 1MK9B 5CLLB 5FI1A 3SV1A 1IRSA 1XR0B 2DX5A 3FEHA 5HE1A 1FAOA 1SHCA 4EJNA 3NSUA 2RLOA 5JLJB 2LULA 4YONA 2CODA 2LYDA 1V5PA 3HW2B 2YS1A 3GYOA 1BTKA 4GZUA 4ZRIA 4GXBA 3HK0A 1KI1B 3QBVB 2DLWA 1MIXA 1OQNA 1V5UA 5KQ1A 3TO1A 2MFQA 3AU5A 4L6EA 4HHVA 4A6KA 1W1HA 2RSGA 2RGNB 1GC6A 4EMOA 4KHOA 2QKLA 2YS5A 2AEHA 1TXDA 3MPXA 2UVMA 5C79A 1U5GA 1WJ1A 3KSYA 2KCJA 1X1GA 4B6HA 1NI2A 5KQ4A 2Z0PA 4IFSA 2I1JA 3KZ1A 1H4RA 2OQBA 2RVBB 5D3XA 1PMSA 1MIZB 3N7CA 1EVHA 1TQZA 1MKEA 4HAXB 1RRPB 2ADZA 2Z0QA 1NU2A 3A8QA 2DHJA 1ZVRA 1ZSQA 2VRWB 2YS3A 1I7AA 3FSSA 4K17A 2V76A 2DHIA 2JP2A 1WG7A 4HB3B 1AWEA 3A8PA 4HAZB 5D3VA 4ZRJA 2GCLA 2D9XA 1X11A 5DHAB 1J19A 2P0FA 3P7ZA 4KHBB 2MKRA 4KVGB 1V61A 1DROA 3VOQA 3KRXA 1K5GB 3DXDA 2UZRA 3V5WA 2QKMA 3OANA 2OTXA 4DX8A 1WVHA 2NMBA 5C16A 2COAA 4HB0B 4YL8A 1QC6A 2P8VA 2YVCA 2D9WA 1FB8A 2K2JA 2YRYA 1ZC4B 1Y5OA
chains in the Genus database with same CATH superfamily
1U5EA 4GPTB 5HE2A 2P0HA 3D8FA 1NTYA 2Y7BA 5L81A 1N3HA 1PFJA 3F0WA 1TJ6A 1E5WA 4A6FA 5DIFB 1P3RA 2Y8GA 1U27A 2DN6A 2J0MA 3DCXA 4Y94A 3DXEA 2KGXB 3FVCA 1MI1A 4MY6A 2M38A 3D8EA 5DI9B 1UEFA 2RNRB 2DHKA 1LB1A 1V88A 2D9ZA 2GCJA 3HQCA 5D3YA 4D0NB 1SGHA 2BCJA 4IOYX 1XX0A 2H7DA 3M1IB 4K2PA 3PP2A 1FHWA 1UNPA 1J0WA 4BBKA 2CRFA 1DYNA 2X18A 2AL6A 1MK7B 2MWNB 5C6RA 3TFMA 2J59M 4C0AA 3ODXA 2DKPA 4WVFB 4HATB 1DDVA 2EC1A 2FJLA 3FM8C 1M7RA 2YSZA 1ZM0A 2EMSA 2D9VA 1I2HA 4NY0A 2ELAA 5D27A 2RUKB 1NTVA 1U29A 4KAXB 4F7HA 3SUZA 2K00A 2DA0A 3PZDA 3U7DA 2Z4DA 3AJ4A 1W1GA 4GMVA 5J3TA 1FHXA 5DHFB 4PNKA 2D10A 3ULCA 4HB4B 1QQGA 3ULBA 2CAYA 3DXCA 1B55A 5EFXA 3X23A 1KZ7A 4QJ3B 5DH9B 1U5DA 2MDXA 4XWXA 2DYQA 3NWFA 3WA0A 1Z87A 1WGUA 4WSFA 2LG1A 3D8DA 3TCAA 5J3QA 3UZTA 5KCVA 2N0YA 2W2WA 5D3WA 1AQCA 2IFSA 2GJYA 2EJ8A 4DXAB 2VSZA 4P7IA 3WYFB 1H10A 1PLSA 4DX90 3HIEA 3ODOA 3ZDTA 4MK0A 1MAIA 2IYBA 2Z59A 3KY9A 4TYZA 2GUMA 3CXBB 2W2XC 3LJUX 5I2MA 5C5BA 2Z0OA 1XCGA 3BJIA 1K5DB 1BWNA 2CY4A 4A6HA 1FGZA 3SNHA 4PQ0A 5GOWB 2YF0A 2ROZB 2I5CA 3G9WA 2GS0A 2J0JA 1P6SA 3PVUA 4KHBA 4IAPA 1DDWA 2ZPYA 1DDMA 3U8ZA 4ZRKA 3PG7A 2D9YA 3AU4A 2L1CA 2LOXA 3T06A 5M4YB 2XQNM 2J0KA 4OT1A 2RRFA 1U2BA 1BTNA 2D2QA 4D6WA 2VKIA 5JHHA 4HSIA 2P0DA 3F5RA 2HE7A 2HTHB 2NBVA 2YT0A 5JHGA 4GOUA 2R09A 3IVFA 5JP4A 2DFKA 1UNQA 4A5KA 1EAZA 1GC7A 2DTCA 4KHAA 2R0DA 1W1DA 5LOPB 4HAUB 4DBBA 1KZGA 4HDQA 1EF1A 1FOEA 1OY2A 1X05A 2KUQA 4HAYB 1V89A 2KUPA 3BINA 1UNRA 3SYXA 2Y8FA 1MPHA 2D11A 2DKQA 4MT7A 4QJ5B 1T77A 2PZ1A 4L1RA 3GYPA 3ZVRA 2M14A 1ISNA 2G35A 5HE3A 4CHJA 1WJMA 2K8EA 5HE0A 1ZYIA 2E2XA 2Q13A 4Z2NA 1FHOA 1XKEA 4K2OA 1XD4A 4EKUA 2CY5A 1WI1A 2ZKMX 4HB2B 3P6AA 2H7EA 1OMWA 2LOZA 4TKNA 3VIAA 4H8SA 5C5BB 3TVVA 2DX1A 5FI0A 3PVWA 2ROVA 3ML4A 3ODWA 2I1KA 3PVLA 2LKOA 4DIXA 3PEGA 4CYEA 2I5FA 4GN1A 4A6FB 3QIJA 2W2XD 1BAKA 4K81A 2COFA 3TW1A 2NZ8B 2DYNA 1U5FA 3KRWA 4HDOA 2ELBA 1M7EA 2YT1A 1ZC3B 4NSWA 1DBHA 4CHMA 3A58A 2COCA 3PSCA 4GMXB 1X1FA 2FJUB 3SO6A 2KR0A 4F7UP 1WGQA 1UPQA 3NWDA 5J3YA 3MDBC 5LONB 1Q67A 1XODA 4Z2MB 5I2SA 2UZSA 3O96A 2D4QA 2EMTA 2K2UA 5CLQB 1EGXA 1FGYA 3A98B 3HSAA 4HAWB 4HAVB 4WJ7A 1RJ2A 1P5TA 3CIKA 1GG3A 4F7GA 1V5MA 1X86A 1LW3A 1UPRA 3QWMA 5IRSA 2L2IA 3B77A 1Y19B 2N23A 3RCPA 1MK9B 5LG4B 5CLLB 5FI1A 3SV1A 1IRSA 1XR0B 2DX5A 3FEHA 5HE1A 1FAOA 1SHCA 4EJNA 3U12A 3NSUA 2RLOA 5JLJB 2LULA 4YONA 2CODA 2LYDA 1V5PA 3HW2B 2YS1A 3GYOA 1BTKA 4GZUA 4ZRIA 4GXBA 3HK0A 1KI1B 3QBVB 2DLWA 1MIXA 1OQNA 1V5UA 5KQ1A 3TO1A 2MFQA 3AU5A 3NWAA 4L6EA 4HHVA 4A6KA 1W1HA 2RSGA 2RGNB 1GC6A 4EMOA 4KHOA 2QKLA 2KIEA 2YS5A 3OHMB 2AEHA 1TXDA 3NW8A 4QXAB 2Z14A 3MPXA 2KIGA 2UVMA 5C79A 1U5GA 1WJ1A 3KSYA 2KCJA 1X1GA 4B6HA 1NI2A 5KQ4A 2Z0PA 4IFSA 2I1JA 3KZ1A 1H4RA 2OQBA 2RVBB 4GNKB 5D3XA 1PMSA 1MIZB 2K49A 3N7CA 1EVHA 1TQZA 4OSNA 2R2YA 4QJ4B 1MKEA 4HAXB 1RRPB 2ADZA 2Z0QA 2Z13A 1NU2A 3A8QA 2DHJA 1ZVRA 1ZSQA 2VRWB 2YS3A 1I7AA 3FSSA 4K17A 2V76A 2DHIA 2JP2A 1WG7A 4HB3B 1AWEA 3A8PA 4HAZB 5D3VA 4ZRJA 2GCLA 2D9XA 1X11A 5DHAB 1J19A 2P0FA 3P7ZA 4KHBB 2MKRA 4KVGB 2YT2A 1V61A 1DROA 3VOQA 3KRXA 1K5GB 3DXDA 2UZRA 3V5WA 2QKMA 3OANA 2OTXA 4DX8A 1WVHA 2NMBA 5C16A 2COAA 4HB0B 4YL8A 1QC6A 2P8VA 4CSQA 2YVCA 2D9WA 1FB8A 2K2JA 2YRYA 1ZC4B 1Y5OA
chains in the Genus database with same CATH topology
1U5EA 4GPTB 5HE2A 2P0HA 3D8FA 1NTYA 2Y7BA 5L81A 1N3HA 1PFJA 3F0WA 1TJ6A 1E5WA 4A6FA 5DIFB 1P3RA 2Y8GA 1U27A 2DN6A 2J0MA 4Y94A 3DXEA 2KGXB 4MY6A 2M38A 3D8EA 5DI9B 1UEFA 2RNRB 2DHKA 1LB1A 1V88A 2D9ZA 2GCJA 3HQCA 5D3YA 4D0NB 1SGHA 2BCJA 4IOYX 1XX0A 2H7DA 3M1IB 4K2PA 3PP2A 1FHWA 1UNPA 1J0WA 4BBKA 2CRFA 1DYNA 2X18A 2AL6A 1MK7B 2MWNB 5C6RA 3TFMA 2J59M 4C0AA 3ODXA 2DKPA 4WVFB 4HATB 1DDVA 2EC1A 2FJLA 3FM8C 1M7RA 2YSZA 1ZM0A 2EMSA 2D9VA 1I2HA 4NY0A 2ELAA 5D27A 2RUKB 1NTVA 1U29A 4KAXB 4F7HA 3SUZA 2K00A 2DA0A 3PZDA 3U7DA 3AJ4A 1W1GA 4GMVA 5J3TA 1FHXA 5DHFB 4PNKA 2D10A 3ULCA 4HB4B 1QQGA 3ULBA 2CAYA 3DXCA 1B55A 5EFXA 3X23A 1KZ7A 5DH9B 1U5DA 2MDXA 4XWXA 2DYQA 3WA0A 1Z87A 1WGUA 4WSFA 2LG1A 3D8DA 3TCAA 5J3QA 3UZTA 5KCVA 2N0YA 2W2WA 5D3WA 1AQCA 2IFSA 2GJYA 2EJ8A 4DXAB 2VSZA 4P7IA 3WYFB 1H10A 1PLSA 4DX90 3ODOA 3ZDTA 4MK0A 1MAIA 2IYBA 3KY9A 4TYZA 3CXBB 2W2XC 3LJUX 5C5BA 2Z0OA 1XCGA 3BJIA 1K5DB 1BWNA 2CY4A 4A6HA 1FGZA 3SNHA 4PQ0A 5GOWB 2YF0A 2ROZB 2I5CA 3G9WA 2GS0A 2J0JA 1P6SA 3PVUA 4IAPA 1DDWA 2ZPYA 1DDMA 3U8ZA 4ZRKA 3PG7A 2D9YA 3AU4A 2L1CA 2LOXA 3T06A 2XQNM 2J0KA 1U2BA 1BTNA 2D2QA 2VKIA 5JHHA 2P0DA 3F5RA 2HE7A 2HTHB 2YT0A 5JHGA 2R09A 3IVFA 5JP4A 2DFKA 1UNQA 4A5KA 1EAZA 1GC7A 2DTCA 4KHAA 2R0DA 1W1DA 5LOPB 4HAUB 4DBBA 1KZGA 4HDQA 1EF1A 1FOEA 1OY2A 1X05A 4HAYB 1V89A 2KUPA 3BINA 1UNRA 3SYXA 2Y8FA 1MPHA 2D11A 2DKQA 4MT7A 2PZ1A 3GYPA 3ZVRA 2M14A 1ISNA 2G35A 5HE3A 4CHJA 1WJMA 5HE0A 2E2XA 2Q13A 4Z2NA 1FHOA 1XKEA 4K2OA 1XD4A 4EKUA 2CY5A 1WI1A 4HB2B 3P6AA 2H7EA 1OMWA 2LOZA 4TKNA 3VIAA 4H8SA 5C5BB 3TVVA 2DX1A 5FI0A 3PVWA 2ROVA 3ML4A 3ODWA 2I1KA 3PVLA 2LKOA 3PEGA 4CYEA 2I5FA 4GN1A 4A6FB 3QIJA 2W2XD 1BAKA 4K81A 2COFA 3TW1A 2NZ8B 2DYNA 1U5FA 3KRWA 4HDOA 2ELBA 1M7EA 2YT1A 1ZC3B 4NSWA 1DBHA 4CHMA 2COCA 3PSCA 4GMXB 1X1FA 3SO6A 4F7UP 1WGQA 1UPQA 5J3YA 3MDBC 5LONB 1Q67A 1XODA 4Z2MB 2UZSA 3O96A 2D4QA 2EMTA 2K2UA 5CLQB 1EGXA 1FGYA 3A98B 4HAWB 4HAVB 4WJ7A 1RJ2A 1P5TA 3CIKA 1GG3A 4F7GA 1V5MA 1X86A 1LW3A 1UPRA 3QWMA 2L2IA 1Y19B 2N23A 3RCPA 1MK9B 5CLLB 5FI1A 3SV1A 1IRSA 1XR0B 2DX5A 3FEHA 5HE1A 1FAOA 1SHCA 4EJNA 3NSUA 2RLOA 5JLJB 2LULA 4YONA 2CODA 2LYDA 1V5PA 3HW2B 2YS1A 3GYOA 1BTKA 4GZUA 4ZRIA 4GXBA 3HK0A 1KI1B 3QBVB 2DLWA 1MIXA 1OQNA 1V5UA 5KQ1A 3TO1A 2MFQA 3AU5A 4L6EA 4HHVA 4A6KA 1W1HA 2RSGA 2RGNB 1GC6A 4EMOA 4KHOA 2QKLA 2YS5A 2AEHA 1TXDA 3MPXA 2UVMA 5C79A 1U5GA 1WJ1A 3KSYA 2KCJA 1X1GA 4B6HA 1NI2A 5KQ4A 2Z0PA 4IFSA 2I1JA 3KZ1A 1H4RA 2OQBA 2RVBB 5D3XA 1PMSA 1MIZB 3N7CA 1EVHA 1TQZA 1MKEA 4HAXB 1RRPB 2ADZA 2Z0QA 1NU2A 3A8QA 2DHJA 1ZVRA 1ZSQA 2VRWB 2YS3A 1I7AA 3FSSA 4K17A 2V76A 2DHIA 2JP2A 1WG7A 4HB3B 1AWEA 3A8PA 4HAZB 5D3VA 4ZRJA 2GCLA 2D9XA 1X11A 5DHAB 1J19A 2P0FA 3P7ZA 4KHBB 2MKRA 4KVGB 1V61A 1DROA 3VOQA 3KRXA 1K5GB 3DXDA 2UZRA 3V5WA 2QKMA 3OANA 2OTXA 4DX8A 1WVHA 2NMBA 5C16A 2COAA 4HB0B 4YL8A 1QC6A 2P8VA 2YVCA 2D9WA 1FB8A 2K2JA 2YRYA 1ZC4B 1Y5OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1U5E A;  4GPT B;  5HE2 A;  2P0H A;  3D8F A;  1NTY A;  2Y7B A;  5L81 A;  1N3H A;  1PFJ A;  3F0W A;  1TJ6 A;  1E5W A;  4A6F A;  5DIF B;  1P3R A;  2Y8G A;  1U27 A;  2DN6 A;  2J0M A;  4Y94 A;  3DXE A;  2KGX B;  4MY6 A;  2M38 A;  3D8E A;  5DI9 B;  1UEF A;  2RNR B;  2DHK A;  1LB1 A;  1V88 A;  2D9Z A;  2GCJ A;  3HQC A;  5D3Y A;  4D0N B;  1SGH A;  2BCJ A;  4IOY X;  1XX0 A;  2H7D A;  3M1I B;  4K2P A;  3PP2 A;  1FHW A;  1UNP A;  1J0W A;  4BBK A;  2CRF A;  1DYN A;  2X18 A;  2AL6 A;  1MK7 B;  2MWN B;  5C6R A;  3TFM A;  2J59 M;  4C0A A;  3ODX A;  2DKP A;  4WVF B;  4HAT B;  1DDV A;  2EC1 A;  2FJL A;  3FM8 C;  1M7R A;  2YSZ A;  1ZM0 A;  2EMS A;  2D9V A;  1I2H A;  4NY0 A;  2ELA A;  5D27 A;  2RUK B;  1NTV A;  1U29 A;  4KAX B;  4F7H A;  3SUZ A;  2K00 A;  2DA0 A;  3PZD A;  3U7D A;  3AJ4 A;  1W1G A;  4GMV A;  5J3T A;  1FHX A;  5DHF B;  4PNK A;  2D10 A;  3ULC A;  4HB4 B;  1QQG A;  3ULB A;  2CAY A;  3DXC A;  1B55 A;  5EFX A;  3X23 A;  1KZ7 A;  5DH9 B;  1U5D A;  2MDX A;  4XWX A;  2DYQ A;  3WA0 A;  1Z87 A;  1WGU A;  4WSF A;  2LG1 A;  3D8D A;  3TCA A;  5J3Q A;  3UZT A;  5KCV A;  2N0Y A;  2W2W A;  5D3W A;  1AQC A;  2IFS A;  2GJY A;  2EJ8 A;  4DXA B;  2VSZ A;  4P7I A;  3WYF B;  1H10 A;  1PLS A;  4DX9 0;  3ODO A;  3ZDT A;  4MK0 A;  1MAI A;  2IYB A;  3KY9 A;  4TYZ A;  3CXB B;  2W2X C;  3LJU X;  5C5B A;  2Z0O A;  1XCG A;  3BJI A;  1K5D B;  1BWN A;  2CY4 A;  4A6H A;  1FGZ A;  3SNH A;  4PQ0 A;  5GOW B;  2YF0 A;  2ROZ B;  2I5C A;  3G9W A;  2GS0 A;  2J0J A;  1P6S A;  3PVU A;  4IAP A;  1DDW A;  2ZPY A;  1DDM A;  3U8Z A;  4ZRK A;  3PG7 A;  2D9Y A;  3AU4 A;  2L1C A;  2LOX A;  3T06 A;  2XQN M;  2J0K A;  1U2B A;  1BTN A;  2D2Q A;  2VKI A;  5JHH A;  2P0D A;  3F5R A;  2HE7 A;  2HTH B;  2YT0 A;  5JHG A;  2R09 A;  3IVF A;  5JP4 A;  2DFK A;  1UNQ A;  4A5K A;  1EAZ A;  1GC7 A;  2DTC A;  4KHA A;  2R0D A;  1W1D A;  5LOP B;  4HAU B;  4DBB A;  1KZG A;  4HDQ A;  1EF1 A;  1FOE A;  1OY2 A;  1X05 A;  4HAY B;  1V89 A;  2KUP A;  3BIN A;  1UNR A;  3SYX A;  2Y8F A;  1MPH A;  2D11 A;  2DKQ A;  4MT7 A;  2PZ1 A;  3GYP A;  3ZVR A;  2M14 A;  1ISN A;  2G35 A;  5HE3 A;  4CHJ A;  1WJM A;  5HE0 A;  2E2X A;  2Q13 A;  4Z2N A;  1FHO A;  1XKE A;  4K2O A;  1XD4 A;  4EKU A;  2CY5 A;  1WI1 A;  4HB2 B;  3P6A A;  2H7E A;  1OMW A;  2LOZ A;  4TKN A;  3VIA A;  4H8S A;  5C5B B;  3TVV A;  2DX1 A;  5FI0 A;  3PVW A;  2ROV A;  3ML4 A;  3ODW A;  2I1K A;  3PVL A;  2LKO A;  3PEG A;  4CYE A;  2I5F A;  4GN1 A;  4A6F B;  3QIJ A;  2W2X D;  1BAK A;  4K81 A;  2COF A;  3TW1 A;  2NZ8 B;  2DYN A;  1U5F A;  3KRW A;  4HDO A;  2ELB A;  1M7E A;  2YT1 A;  1ZC3 B;  4NSW A;  1DBH A;  4CHM A;  2COC A;  3PSC A;  4GMX B;  1X1F A;  3SO6 A;  4F7U P;  1WGQ A;  1UPQ A;  5J3Y A;  3MDB C;  5LON B;  1Q67 A;  1XOD A;  4Z2M B;  2UZS A;  3O96 A;  2D4Q A;  2EMT A;  2K2U A;  5CLQ B;  1EGX A;  1FGY A;  3A98 B;  4HAW B;  4HAV B;  4WJ7 A;  1RJ2 A;  1P5T A;  3CIK A;  1GG3 A;  4F7G A;  1V5M A;  1X86 A;  1LW3 A;  1UPR A;  3QWM A;  2L2I A;  1Y19 B;  2N23 A;  3RCP A;  1MK9 B;  5CLL B;  5FI1 A;  3SV1 A;  1IRS A;  1XR0 B;  2DX5 A;  3FEH A;  5HE1 A;  1FAO A;  1SHC A;  4EJN A;  3NSU A;  2RLO A;  5JLJ B;  2LUL A;  4YON A;  2COD A;  2LYD A;  1V5P A;  3HW2 B;  2YS1 A;  3GYO A;  1BTK A;  4GZU A;  4ZRI A;  4GXB A;  3HK0 A;  1KI1 B;  3QBV B;  2DLW A;  1MIX A;  1OQN A;  1V5U A;  5KQ1 A;  3TO1 A;  2MFQ A;  3AU5 A;  4L6E A;  4HHV A;  4A6K A;  1W1H A;  2RSG A;  2RGN B;  1GC6 A;  4EMO A;  4KHO A;  2QKL A;  2YS5 A;  2AEH A;  1TXD A;  3MPX A;  2UVM A;  5C79 A;  1U5G A;  1WJ1 A;  3KSY A;  2KCJ A;  1X1G A;  4B6H A;  1NI2 A;  5KQ4 A;  2Z0P A;  4IFS A;  2I1J A;  3KZ1 A;  1H4R A;  2OQB A;  2RVB B;  5D3X A;  1PMS A;  1MIZ B;  3N7C A;  1EVH A;  1TQZ A;  1MKE A;  4HAX B;  1RRP B;  2ADZ A;  2Z0Q A;  1NU2 A;  3A8Q A;  2DHJ A;  1ZVR A;  1ZSQ A;  2VRW B;  2YS3 A;  1I7A A;  3FSS A;  4K17 A;  2V76 A;  2DHI A;  2JP2 A;  1WG7 A;  4HB3 B;  1AWE A;  3A8P A;  4HAZ B;  5D3V A;  4ZRJ A;  2GCL A;  2D9X A;  1X11 A;  5DHA B;  1J19 A;  2P0F A;  3P7Z A;  4KHB B;  2MKR A;  4KVG B;  1V61 A;  1DRO A;  3VOQ A;  3KRX A;  1K5G B;  3DXD A;  2UZR A;  3V5W A;  2QKM A;  3OAN A;  2OTX A;  4DX8 A;  1WVH A;  2NMB A;  5C16 A;  2COA A;  4HB0 B;  4YL8 A;  1QC6 A;  2P8V A;  2YVC A;  2D9W A;  1FB8 A;  2K2J A;  2YRY A;  1ZC4 B;  1Y5O A; 
#chains in the Genus database with same CATH topology
 1U5E A;  4GPT B;  5HE2 A;  2P0H A;  3D8F A;  1NTY A;  2Y7B A;  5L81 A;  1N3H A;  1PFJ A;  3F0W A;  1TJ6 A;  1E5W A;  4A6F A;  5DIF B;  1P3R A;  2Y8G A;  1U27 A;  2DN6 A;  2J0M A;  3DCX A;  4Y94 A;  3DXE A;  2KGX B;  3FVC A;  1MI1 A;  4MY6 A;  2M38 A;  3D8E A;  5DI9 B;  1UEF A;  2RNR B;  2DHK A;  1LB1 A;  1V88 A;  2D9Z A;  2GCJ A;  3HQC A;  5D3Y A;  4D0N B;  1SGH A;  2BCJ A;  4IOY X;  1XX0 A;  2H7D A;  3M1I B;  4K2P A;  3PP2 A;  1FHW A;  1UNP A;  1J0W A;  4BBK A;  2CRF A;  1DYN A;  2X18 A;  2AL6 A;  1MK7 B;  2MWN B;  5C6R A;  3TFM A;  2J59 M;  4C0A A;  3ODX A;  2DKP A;  4WVF B;  4HAT B;  1DDV A;  2EC1 A;  2FJL A;  3FM8 C;  1M7R A;  2YSZ A;  1ZM0 A;  2EMS A;  2D9V A;  1I2H A;  4NY0 A;  2ELA A;  5D27 A;  2RUK B;  1NTV A;  1U29 A;  4KAX B;  4F7H A;  3SUZ A;  2K00 A;  2DA0 A;  3PZD A;  3U7D A;  2Z4D A;  3AJ4 A;  1W1G A;  4GMV A;  5J3T A;  1FHX A;  5DHF B;  4PNK A;  2D10 A;  3ULC A;  4HB4 B;  1QQG A;  3ULB A;  2CAY A;  3DXC A;  1B55 A;  5EFX A;  3X23 A;  1KZ7 A;  4QJ3 B;  5DH9 B;  1U5D A;  2MDX A;  4XWX A;  2DYQ A;  3NWF A;  3WA0 A;  1Z87 A;  1WGU A;  4WSF A;  2LG1 A;  3D8D A;  3TCA A;  5J3Q A;  3UZT A;  5KCV A;  2N0Y A;  2W2W A;  5D3W A;  1AQC A;  2IFS A;  2GJY A;  2EJ8 A;  4DXA B;  2VSZ A;  4P7I A;  3WYF B;  1H10 A;  1PLS A;  4DX9 0;  3HIE A;  3ODO A;  3ZDT A;  4MK0 A;  1MAI A;  2IYB A;  2Z59 A;  3KY9 A;  4TYZ A;  2GUM A;  3CXB B;  2W2X C;  3LJU X;  5I2M A;  5C5B A;  2Z0O A;  1XCG A;  3BJI A;  1K5D B;  1BWN A;  2CY4 A;  4A6H A;  1FGZ A;  3SNH A;  4PQ0 A;  5GOW B;  2YF0 A;  2ROZ B;  2I5C A;  3G9W A;  2GS0 A;  2J0J A;  1P6S A;  3PVU A;  4KHB A;  4IAP A;  1DDW A;  2ZPY A;  1DDM A;  3U8Z A;  4ZRK A;  3PG7 A;  2D9Y A;  3AU4 A;  2L1C A;  2LOX A;  3T06 A;  5M4Y B;  2XQN M;  2J0K A;  4OT1 A;  2RRF A;  1U2B A;  1BTN A;  2D2Q A;  4D6W A;  2VKI A;  5JHH A;  4HSI A;  2P0D A;  3F5R A;  2HE7 A;  2HTH B;  2NBV A;  2YT0 A;  5JHG A;  4GOU A;  2R09 A;  3IVF A;  5JP4 A;  2DFK A;  1UNQ A;  4A5K A;  1EAZ A;  1GC7 A;  2DTC A;  4KHA A;  2R0D A;  1W1D A;  5LOP B;  4HAU B;  4DBB A;  1KZG A;  4HDQ A;  1EF1 A;  1FOE A;  1OY2 A;  1X05 A;  2KUQ A;  4HAY B;  1V89 A;  2KUP A;  3BIN A;  1UNR A;  3SYX A;  2Y8F A;  1MPH A;  2D11 A;  2DKQ A;  4MT7 A;  4QJ5 B;  1T77 A;  2PZ1 A;  4L1R A;  3GYP A;  3ZVR A;  2M14 A;  1ISN A;  2G35 A;  5HE3 A;  4CHJ A;  1WJM A;  2K8E A;  5HE0 A;  1ZYI A;  2E2X A;  2Q13 A;  4Z2N A;  1FHO A;  1XKE A;  4K2O A;  1XD4 A;  4EKU A;  2CY5 A;  1WI1 A;  2ZKM X;  4HB2 B;  3P6A A;  2H7E A;  1OMW A;  2LOZ A;  4TKN A;  3VIA A;  4H8S A;  5C5B B;  3TVV A;  2DX1 A;  5FI0 A;  3PVW A;  2ROV A;  3ML4 A;  3ODW A;  2I1K A;  3PVL A;  2LKO A;  4DIX A;  3PEG A;  4CYE A;  2I5F A;  4GN1 A;  4A6F B;  3QIJ A;  2W2X D;  1BAK A;  4K81 A;  2COF A;  3TW1 A;  2NZ8 B;  2DYN A;  1U5F A;  3KRW A;  4HDO A;  2ELB A;  1M7E A;  2YT1 A;  1ZC3 B;  4NSW A;  1DBH A;  4CHM A;  3A58 A;  2COC A;  3PSC A;  4GMX B;  1X1F A;  2FJU B;  3SO6 A;  2KR0 A;  4F7U P;  1WGQ A;  1UPQ A;  3NWD A;  5J3Y A;  3MDB C;  5LON B;  1Q67 A;  1XOD A;  4Z2M B;  5I2S A;  2UZS A;  3O96 A;  2D4Q A;  2EMT A;  2K2U A;  5CLQ B;  1EGX A;  1FGY A;  3A98 B;  3HSA A;  4HAW B;  4HAV B;  4WJ7 A;  1RJ2 A;  1P5T A;  3CIK A;  1GG3 A;  4F7G A;  1V5M A;  1X86 A;  1LW3 A;  1UPR A;  3QWM A;  5IRS A;  2L2I A;  3B77 A;  1Y19 B;  2N23 A;  3RCP A;  1MK9 B;  5LG4 B;  5CLL B;  5FI1 A;  3SV1 A;  1IRS A;  1XR0 B;  2DX5 A;  3FEH A;  5HE1 A;  1FAO A;  1SHC A;  4EJN A;  3U12 A;  3NSU A;  2RLO A;  5JLJ B;  2LUL A;  4YON A;  2COD A;  2LYD A;  1V5P A;  3HW2 B;  2YS1 A;  3GYO A;  1BTK A;  4GZU A;  4ZRI A;  4GXB A;  3HK0 A;  1KI1 B;  3QBV B;  2DLW A;  1MIX A;  1OQN A;  1V5U A;  5KQ1 A;  3TO1 A;  2MFQ A;  3AU5 A;  3NWA A;  4L6E A;  4HHV A;  4A6K A;  1W1H A;  2RSG A;  2RGN B;  1GC6 A;  4EMO A;  4KHO A;  2QKL A;  2KIE A;  2YS5 A;  3OHM B;  2AEH A;  1TXD A;  3NW8 A;  4QXA B;  2Z14 A;  3MPX A;  2KIG A;  2UVM A;  5C79 A;  1U5G A;  1WJ1 A;  3KSY A;  2KCJ A;  1X1G A;  4B6H A;  1NI2 A;  5KQ4 A;  2Z0P A;  4IFS A;  2I1J A;  3KZ1 A;  1H4R A;  2OQB A;  2RVB B;  4GNK B;  5D3X A;  1PMS A;  1MIZ B;  2K49 A;  3N7C A;  1EVH A;  1TQZ A;  4OSN A;  2R2Y A;  4QJ4 B;  1MKE A;  4HAX B;  1RRP B;  2ADZ A;  2Z0Q A;  2Z13 A;  1NU2 A;  3A8Q A;  2DHJ A;  1ZVR A;  1ZSQ A;  2VRW B;  2YS3 A;  1I7A A;  3FSS A;  4K17 A;  2V76 A;  2DHI A;  2JP2 A;  1WG7 A;  4HB3 B;  1AWE A;  3A8P A;  4HAZ B;  5D3V A;  4ZRJ A;  2GCL A;  2D9X A;  1X11 A;  5DHA B;  1J19 A;  2P0F A;  3P7Z A;  4KHB B;  2MKR A;  4KVG B;  2YT2 A;  1V61 A;  1DRO A;  3VOQ A;  3KRX A;  1K5G B;  3DXD A;  2UZR A;  3V5W A;  2QKM A;  3OAN A;  2OTX A;  4DX8 A;  1WVH A;  2NMB A;  5C16 A;  2COA A;  4HB0 B;  4YL8 A;  1QC6 A;  2P8V A;  4CSQ A;  2YVC A;  2D9W A;  1FB8 A;  2K2J A;  2YRY A;  1ZC4 B;  1Y5O A; 
#chains in the Genus database with same CATH homology
 1U5E A;  4GPT B;  5HE2 A;  2P0H A;  3D8F A;  1NTY A;  2Y7B A;  5L81 A;  1N3H A;  1PFJ A;  3F0W A;  1TJ6 A;  1E5W A;  4A6F A;  5DIF B;  1P3R A;  2Y8G A;  1U27 A;  2DN6 A;  2J0M A;  4Y94 A;  3DXE A;  2KGX B;  4MY6 A;  2M38 A;  3D8E A;  5DI9 B;  1UEF A;  2RNR B;  2DHK A;  1LB1 A;  1V88 A;  2D9Z A;  2GCJ A;  3HQC A;  5D3Y A;  4D0N B;  1SGH A;  2BCJ A;  4IOY X;  1XX0 A;  2H7D A;  3M1I B;  4K2P A;  3PP2 A;  1FHW A;  1UNP A;  1J0W A;  4BBK A;  2CRF A;  1DYN A;  2X18 A;  2AL6 A;  1MK7 B;  2MWN B;  5C6R A;  3TFM A;  2J59 M;  4C0A A;  3ODX A;  2DKP A;  4WVF B;  4HAT B;  1DDV A;  2EC1 A;  2FJL A;  3FM8 C;  1M7R A;  2YSZ A;  1ZM0 A;  2EMS A;  2D9V A;  1I2H A;  4NY0 A;  2ELA A;  5D27 A;  2RUK B;  1NTV A;  1U29 A;  4KAX B;  4F7H A;  3SUZ A;  2K00 A;  2DA0 A;  3PZD A;  3U7D A;  3AJ4 A;  1W1G A;  4GMV A;  5J3T A;  1FHX A;  5DHF B;  4PNK A;  2D10 A;  3ULC A;  4HB4 B;  1QQG A;  3ULB A;  2CAY A;  3DXC A;  1B55 A;  5EFX A;  3X23 A;  1KZ7 A;  5DH9 B;  1U5D A;  2MDX A;  4XWX A;  2DYQ A;  3WA0 A;  1Z87 A;  1WGU A;  4WSF A;  2LG1 A;  3D8D A;  3TCA A;  5J3Q A;  3UZT A;  5KCV A;  2N0Y A;  2W2W A;  5D3W A;  1AQC A;  2IFS A;  2GJY A;  2EJ8 A;  4DXA B;  2VSZ A;  4P7I A;  3WYF B;  1H10 A;  1PLS A;  4DX9 0;  3ODO A;  3ZDT A;  4MK0 A;  1MAI A;  2IYB A;  3KY9 A;  4TYZ A;  3CXB B;  2W2X C;  3LJU X;  5C5B A;  2Z0O A;  1XCG A;  3BJI A;  1K5D B;  1BWN A;  2CY4 A;  4A6H A;  1FGZ A;  3SNH A;  4PQ0 A;  5GOW B;  2YF0 A;  2ROZ B;  2I5C A;  3G9W A;  2GS0 A;  2J0J A;  1P6S A;  3PVU A;  4IAP A;  1DDW A;  2ZPY A;  1DDM A;  3U8Z A;  4ZRK A;  3PG7 A;  2D9Y A;  3AU4 A;  2L1C A;  2LOX A;  3T06 A;  2XQN M;  2J0K A;  1U2B A;  1BTN A;  2D2Q A;  2VKI A;  5JHH A;  2P0D A;  3F5R A;  2HE7 A;  2HTH B;  2YT0 A;  5JHG A;  2R09 A;  3IVF A;  5JP4 A;  2DFK A;  1UNQ A;  4A5K A;  1EAZ A;  1GC7 A;  2DTC A;  4KHA A;  2R0D A;  1W1D A;  5LOP B;  4HAU B;  4DBB A;  1KZG A;  4HDQ A;  1EF1 A;  1FOE A;  1OY2 A;  1X05 A;  4HAY B;  1V89 A;  2KUP A;  3BIN A;  1UNR A;  3SYX A;  2Y8F A;  1MPH A;  2D11 A;  2DKQ A;  4MT7 A;  2PZ1 A;  3GYP A;  3ZVR A;  2M14 A;  1ISN A;  2G35 A;  5HE3 A;  4CHJ A;  1WJM A;  5HE0 A;  2E2X A;  2Q13 A;  4Z2N A;  1FHO A;  1XKE A;  4K2O A;  1XD4 A;  4EKU A;  2CY5 A;  1WI1 A;  4HB2 B;  3P6A A;  2H7E A;  1OMW A;  2LOZ A;  4TKN A;  3VIA A;  4H8S A;  5C5B B;  3TVV A;  2DX1 A;  5FI0 A;  3PVW A;  2ROV A;  3ML4 A;  3ODW A;  2I1K A;  3PVL A;  2LKO A;  3PEG A;  4CYE A;  2I5F A;  4GN1 A;  4A6F B;  3QIJ A;  2W2X D;  1BAK A;  4K81 A;  2COF A;  3TW1 A;  2NZ8 B;  2DYN A;  1U5F A;  3KRW A;  4HDO A;  2ELB A;  1M7E A;  2YT1 A;  1ZC3 B;  4NSW A;  1DBH A;  4CHM A;  2COC A;  3PSC A;  4GMX B;  1X1F A;  3SO6 A;  4F7U P;  1WGQ A;  1UPQ A;  5J3Y A;  3MDB C;  5LON B;  1Q67 A;  1XOD A;  4Z2M B;  2UZS A;  3O96 A;  2D4Q A;  2EMT A;  2K2U A;  5CLQ B;  1EGX A;  1FGY A;  3A98 B;  4HAW B;  4HAV B;  4WJ7 A;  1RJ2 A;  1P5T A;  3CIK A;  1GG3 A;  4F7G A;  1V5M A;  1X86 A;  1LW3 A;  1UPR A;  3QWM A;  2L2I A;  1Y19 B;  2N23 A;  3RCP A;  1MK9 B;  5CLL B;  5FI1 A;  3SV1 A;  1IRS A;  1XR0 B;  2DX5 A;  3FEH A;  5HE1 A;  1FAO A;  1SHC A;  4EJN A;  3NSU A;  2RLO A;  5JLJ B;  2LUL A;  4YON A;  2COD A;  2LYD A;  1V5P A;  3HW2 B;  2YS1 A;  3GYO A;  1BTK A;  4GZU A;  4ZRI A;  4GXB A;  3HK0 A;  1KI1 B;  3QBV B;  2DLW A;  1MIX A;  1OQN A;  1V5U A;  5KQ1 A;  3TO1 A;  2MFQ A;  3AU5 A;  4L6E A;  4HHV A;  4A6K A;  1W1H A;  2RSG A;  2RGN B;  1GC6 A;  4EMO A;  4KHO A;  2QKL A;  2YS5 A;  2AEH A;  1TXD A;  3MPX A;  2UVM A;  5C79 A;  1U5G A;  1WJ1 A;  3KSY A;  2KCJ A;  1X1G A;  4B6H A;  1NI2 A;  5KQ4 A;  2Z0P A;  4IFS A;  2I1J A;  3KZ1 A;  1H4R A;  2OQB A;  2RVB B;  5D3X A;  1PMS A;  1MIZ B;  3N7C A;  1EVH A;  1TQZ A;  1MKE A;  4HAX B;  1RRP B;  2ADZ A;  2Z0Q A;  1NU2 A;  3A8Q A;  2DHJ A;  1ZVR A;  1ZSQ A;  2VRW B;  2YS3 A;  1I7A A;  3FSS A;  4K17 A;  2V76 A;  2DHI A;  2JP2 A;  1WG7 A;  4HB3 B;  1AWE A;  3A8P A;  4HAZ B;  5D3V A;  4ZRJ A;  2GCL A;  2D9X A;  1X11 A;  5DHA B;  1J19 A;  2P0F A;  3P7Z A;  4KHB B;  2MKR A;  4KVG B;  1V61 A;  1DRO A;  3VOQ A;  3KRX A;  1K5G B;  3DXD A;  2UZR A;  3V5W A;  2QKM A;  3OAN A;  2OTX A;  4DX8 A;  1WVH A;  2NMB A;  5C16 A;  2COA A;  4HB0 B;  4YL8 A;  1QC6 A;  2P8V A;  2YVC A;  2D9W A;  1FB8 A;  2K2J A;  2YRY A;  1ZC4 B;  1Y5O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...