1FHXA

Structure of the pleckstrin homology domain from grp1 in complex with inositol 1,3,4,5-tetrakisphosphate
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
123
structure length
123
Chain Sequence
b'NPDREGWLLKLGGRVKTWKRRWFILTDNCLYYFEYTTDKEPRGIIPLENLSIREVEDPRKPNCFELYNPSHKGQVIKACKTEADGRVVEGNHVVYRISAPSPEEKEEWMKSIKASISRDPFYD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords GUANINE NUCLEOTIDE EXCHANGE FACTOR AND INTEGRIN BINDING PROT
publication title Structural basis for discrimination of 3-phosphoinositides by pleckstrin homology domains
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
total genus 17
structure length 123
sequence length 123
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1fhxA00
1NTVA 3M1IB 1I7AA 2OTXA 4TKNA 1ZSQA 2VRWB 4F7HA 2YVCA 4WJ7A 5KQ1A 4C0AA 2RVBB 1RRPB 4EJNA 5JHGA 4GPTB 5LONB 1PLSA 1QC6A 3FEHA 3LJUX 4GMXB 3V5WA 3G9WA 3PZDA 5C5BA 2R0DA 3TFMA 1U5DA 3AU5A 2J0JA 2BCJA 1Y19B 1U29A 4L6EA 4P7IA 3ODOA 4KAXB 5J3QA 1AWEA 2DX1A 5DH9B 2P0HA 2MKRA 4KHOA 1NU2A 2RGNB 3PVUA 2IYBA 4EMOA 1E5WA 3TW1A 3HW2B 2LG1A 4Z2MB 1DROA 5KQ4A 4WSFA 1MPHA 2MFQA 5FI0A 4K2OA 1EAZA 4Z2NA 3MDBC 2D2QA 4MY6A 5D3VA 2ELBA 2D11A 2COAA 2J0KA 1N3HA 1MKEA 2DKQA 2CAYA 3SV1A 3IVFA 2DTCA 2DHIA 2Z0PA 4IOYX 2ZPYA 2D10A 4HHVA 4A6HA 1UNQA 2GCLA 2HTHB 2KUPA 2DYQA 1GG3A 2EMSA 1LB1A 2AL6A 5C6RA 2Y8FA 2YS5A 3D8FA 5C5BB 5C79A 1WJMA 2KGXB 1X11A 2ELAA 1K5DB 1UNRA 1UPRA 1RJ2A 4GMVA 2RUKB 2LKOA 2DX5A 4NY0A 1LW3A 3F0WA 5EFXA 1MIXA 3F5RA 4HATB 3KZ1A 2K2UA 5JP4A 2Y7BA 1U2BA 2COFA 1V5PA 3ZDTA 5J3YA 4CHMA 1H4RA 2YT1A 2DA0A 2N23A 2VSZA 5FI1A 3UZTA 2D9ZA 1X1FA 1TJ6A 3A8QA 1V88A 1U5EA 4HAYB 2ROZB 4B6HA 1M7EA 1Q67A 3SNHA 1SGHA 3D8DA 4XWXA 1NI2A 1XD4A 1P5TA 2EJ8A 1MAIA 3DXDA 5D3YA 1FAOA 3AJ4A 1BTNA 1P3RA 4GN1A 3ODWA 4PQ0A 1P6SA 3TCAA 2VKIA 3PP2A 1EF1A 2Z0QA 4A6FA 2I1JA 2GJYA 1IRSA 3QBVB 4BBKA 5KCVA 3ZVRA 1X86A 2YS3A 5J3TA 1XCGA 1UEFA 1TQZA 3CIKA 2P0DA 5GOWB 2P0FA 1XODA 1OY2A 5L81A 1QQGA 2I5FA 4HAVB 1WI1A 3A98B 1KZGA 1W1GA 2ROVA 4F7UP 1PFJA 2YSZA 1SHCA 3FSSA 4HDOA 1ZC3B 2DFKA 5DHFB 4TYZA 5HE1A 4KVGB 1B55A 4GXBA 1V5MA 2YF0A 3SUZA 1BWNA 3ML4A 5HE0A 3TO1A 3A8PA 5DI9B 4CHJA 2EMTA 4NSWA 2UVMA 5JHHA 2GS0A 1MK9B 4HAWB 1FHOA 2KCJA 4KHBB 3MPXA 1GC6A 1J19A 3D8EA 1AQCA 1FGYA 2N0YA 4IAPA 4MK0A 5HE2A 1DYNA 3X23A 5DIFB 4KHAA 2CRFA 2HE7A 5DHAB 2R09A 4A6KA 1FHWA 2K2JA 3PEGA 1OMWA 1U5FA 3NSUA 4IFSA 1KZ7A 2LOZA 2E2XA 2L2IA 2CY5A 3TVVA 3BINA 4K17A 2W2XD 4ZRIA 4HB2B 1WJ1A 3AU4A 1DDVA 1WG7A 2DHJA 2DYNA 1NTYA 3P6AA 3PG7A 2LYDA 3FM8C 3ODXA 3HK0A 2L1CA 4A5KA 2UZRA 1DDWA 1X05A 5CLQB 3T06A 3SO6A 3HQCA 1MIZB 4DXAB 2P8VA 4MT7A 1V61A 4DX90 2I1KA 1PMSA 1W1DA 2G35A 4DX8A 2DLWA 2AEHA 2IFSA 1ISNA 1FOEA 5C16A 4K81A 1GC7A 2Q13A 3PSCA 2CODA 1WVHA 2YS1A 1FGZA 1K5GB 1U27A 1WGQA 3KRXA 3P7ZA 2YT0A 3DXCA 4YONA 4ZRKA 2OQBA 2J0MA 4HB0B 3U8ZA 2COCA 1Z87A 5LOPB 1TXDA 3ULCA 2W2WA 1XR0B 2QKLA 4F7GA 3VIAA 3QIJA 3WYFB 5CLLB 2UZSA 1XX0A 4YL8A 2XQNM 3RCPA 5D27A 3U7DA 5D3XA 2QKMA 2Y8GA 4HB4B 3PVLA 1DBHA 2NMBA 3WA0A 2DHKA 1KI1B 4WVFB 1X1GA 2M38A 3KY9A 1V89A 5JLJB 2D4QA 1EVHA 3ULBA 2RSGA 4GZUA 2JP2A 4DBBA 1J0WA 4HDQA 2DKPA 2LULA 1ZC4B 2V76A 4H8SA 1ZVRA 1H10A 3QWMA 1XKEA 3OANA 1ZM0A 1BAKA 4A6FB 2RNRB 1I2HA 1OQNA 1BTKA 1FB8A 3BJIA 1Y5OA 2Z0OA 2DN6A 3VOQA 4D0NB 1DDMA 1UNPA 3KSYA 1MK7B 3SYXA 2FJLA 2D9XA 1WGUA 2W2XC 4EKUA 2MDXA 3GYPA 5HE3A 3DXEA 2PZ1A 2NZ8B 4CYEA 2D9WA 4HB3B 2CY4A 2H7DA 1W1HA 3O96A 2D9VA 1U5GA 3KRWA 4ZRJA 2MWNB 1UPQA 4PNKA 1EGXA 1M7RA 2D9YA 1FHXA 2I5CA 4K2PA 2YRYA 3PVWA 4Y94A 2K00A 2ADZA 2LOXA 2RLOA 2EC1A 5D3WA 2GCJA 3GYOA 4HAUB 2X18A 2M14A 2H7EA 4HAXB 1V5UA 2J59M 3CXBB 4HAZB 3N7CA
chains in the Genus database with same CATH superfamily
1NTVA 3M1IB 1I7AA 2OTXA 4TKNA 1ZSQA 5I2MA 2VRWB 4F7HA 2YVCA 4WJ7A 5KQ1A 4C0AA 2RVBB 3HIEA 1MI1A 1RRPB 4EJNA 5JHGA 4CSQA 4GPTB 5LONB 1PLSA 1QC6A 3FEHA 3LJUX 4GMXB 3V5WA 3G9WA 3PZDA 5C5BA 2R0DA 3TFMA 1U5DA 3AU5A 4HSIA 2J0JA 2BCJA 1Y19B 1U29A 4L6EA 4P7IA 3ODOA 3OHMB 4KAXB 5J3QA 1AWEA 2DX1A 5DH9B 2P0HA 2MKRA 4KHOA 1NU2A 2NBVA 2RGNB 3PVUA 2IYBA 4EMOA 1E5WA 3TW1A 3HW2B 2LG1A 4Z2MB 1DROA 5KQ4A 4WSFA 1MPHA 2MFQA 5FI0A 4K2OA 1EAZA 4Z2NA 3MDBC 2D2QA 4MY6A 5D3VA 2ELBA 2D11A 2COAA 2J0KA 1N3HA 1MKEA 2DKQA 2CAYA 3SV1A 3IVFA 2DTCA 2DHIA 2Z0PA 4IOYX 2ZPYA 2D10A 3NW8A 4HHVA 4A6HA 1UNQA 2GCLA 2HTHB 2KUPA 2DYQA 1GG3A 3NWAA 2EMSA 1LB1A 2AL6A 5C6RA 2Y8FA 2Z13A 2YS5A 4D6WA 3D8FA 2GUMA 5C5BB 5C79A 1WJMA 2KGXB 1X11A 2ELAA 1K5DB 1UNRA 3A58A 1UPRA 1RJ2A 4GMVA 2RUKB 5LG4B 2LKOA 2DX5A 4NY0A 1LW3A 3F0WA 5EFXA 1MIXA 3F5RA 4HATB 3KZ1A 2K2UA 5JP4A 2Y7BA 1U2BA 2COFA 1V5PA 3ZDTA 4QXAB 5J3YA 4CHMA 1H4RA 2YT1A 2DA0A 2N23A 2VSZA 5FI1A 2YT2A 2D9ZA 3UZTA 1X1FA 1TJ6A 3A8QA 1V88A 1U5EA 4HAYB 2ROZB 4B6HA 1T77A 1M7EA 1Q67A 3SNHA 1SGHA 3D8DA 4XWXA 1NI2A 1XD4A 1P5TA 2EJ8A 1MAIA 2KIGA 3DXDA 1FAOA 3AJ4A 2Z4DA 5D3YA 2ZKMX 1BTNA 1P3RA 4GN1A 3ODWA 4PQ0A 1P6SA 3TCAA 2VKIA 3PP2A 4KHBA 1EF1A 2Z0QA 4A6FA 2FJUB 2I1JA 2GJYA 1IRSA 3QBVB 4BBKA 5KCVA 2KIEA 3ZVRA 1X86A 2YS3A 5J3TA 1XCGA 1UEFA 1TQZA 4GNKB 3CIKA 2P0DA 5GOWB 2P0FA 2K49A 1XODA 3U12A 1OY2A 5L81A 1QQGA 2I5FA 4HAVB 1WI1A 3A98B 1KZGA 1W1GA 2ROVA 4F7UP 1PFJA 4GOUA 2YSZA 1SHCA 3B77A 5I2SA 3FSSA 4HDOA 1ZC3B 2DFKA 5DHFB 4DIXA 4TYZA 5HE1A 4KVGB 1B55A 4GXBA 1V5MA 2YF0A 3SUZA 1BWNA 3ML4A 5HE0A 3TO1A 3A8PA 5DI9B 4CHJA 2EMTA 4NSWA 2UVMA 5JHHA 2GS0A 1MK9B 4OT1A 4HAWB 1FHOA 2KCJA 4KHBB 3MPXA 1GC6A 1J19A 3D8EA 1AQCA 1FGYA 2N0YA 4IAPA 2R2YA 4MK0A 5HE2A 1DYNA 3X23A 5DIFB 5IRSA 4KHAA 2CRFA 2HE7A 5DHAB 2Z14A 2R09A 4A6KA 1FHWA 2K2JA 3PEGA 1OMWA 1U5FA 3NSUA 4IFSA 1KZ7A 3DCXA 2LOZA 2E2XA 2L2IA 2CY5A 3TVVA 2Z59A 3BINA 4K17A 2W2XD 4ZRIA 4HB2B 1WJ1A 3AU4A 1DDVA 1WG7A 2DHJA 2DYNA 1NTYA 3P6AA 4QJ3B 3PG7A 2LYDA 3FM8C 3ODXA 3FVCA 3HK0A 4QJ5B 2L1CA 4A5KA 2UZRA 1DDWA 2KUQA 1X05A 5CLQB 3T06A 3SO6A 3HQCA 1MIZB 4DXAB 2P8VA 4MT7A 1V61A 4DX90 2I1KA 1PMSA 1W1DA 2G35A 4DX8A 2DLWA 2AEHA 2IFSA 1ISNA 1FOEA 5C16A 4K81A 1GC7A 2Q13A 3PSCA 2CODA 1WVHA 3NWDA 2YS1A 2RRFA 1FGZA 1K5GB 1U27A 1WGQA 3KRXA 3P7ZA 2YT0A 3DXCA 4YONA 4ZRKA 2OQBA 2J0MA 3HSAA 4HB0B 3U8ZA 2COCA 4L1RA 1Z87A 5LOPB 1TXDA 3ULCA 2W2WA 1XR0B 2QKLA 4F7GA 3VIAA 3QIJA 3WYFB 5CLLB 2UZSA 1XX0A 4YL8A 2XQNM 3RCPA 5D27A 3U7DA 5D3XA 2QKMA 2Y8GA 4HB4B 3PVLA 1DBHA 2NMBA 3WA0A 2DHKA 1KI1B 4WVFB 1X1GA 2M38A 3KY9A 1V89A 5JLJB 2D4QA 1EVHA 3ULBA 2RSGA 4GZUA 2JP2A 4DBBA 1J0WA 4HDQA 2DKPA 2LULA 1ZC4B 2V76A 4H8SA 1ZVRA 1H10A 3QWMA 1XKEA 3OANA 1ZM0A 1BAKA 4A6FB 2RNRB 2KR0A 1I2HA 1OQNA 1BTKA 1FB8A 3BJIA 1Y5OA 2Z0OA 2DN6A 3VOQA 3NWFA 4D0NB 1DDMA 1UNPA 3KSYA 4OSNA 1MK7B 3SYXA 2FJLA 2D9XA 1WGUA 2K8EA 2W2XC 4EKUA 2MDXA 5M4YB 3GYPA 5HE3A 3DXEA 2PZ1A 2NZ8B 4CYEA 2D9WA 4HB3B 2CY4A 2H7DA 1W1HA 3O96A 2D9VA 1U5GA 3KRWA 4ZRJA 2MWNB 1UPQA 4PNKA 1EGXA 1M7RA 2D9YA 1FHXA 2I5CA 4K2PA 2YRYA 3PVWA 4Y94A 2K00A 1ZYIA 2ADZA 2LOXA 2RLOA 2EC1A 5D3WA 2GCJA 3GYOA 4HAUB 2X18A 2M14A 2H7EA 4HAXB 1V5UA 2J59M 3CXBB 4QJ4B 4HAZB 3N7CA
chains in the Genus database with same CATH topology
1NTVA 3M1IB 1I7AA 2OTXA 4TKNA 1ZSQA 2VRWB 4F7HA 2YVCA 4WJ7A 5KQ1A 4C0AA 2RVBB 1RRPB 4EJNA 5JHGA 4GPTB 5LONB 1PLSA 1QC6A 3FEHA 3LJUX 4GMXB 3V5WA 3G9WA 3PZDA 5C5BA 2R0DA 3TFMA 1U5DA 3AU5A 2J0JA 2BCJA 1Y19B 1U29A 4L6EA 4P7IA 3ODOA 4KAXB 5J3QA 1AWEA 2DX1A 5DH9B 2P0HA 2MKRA 4KHOA 1NU2A 2RGNB 3PVUA 2IYBA 4EMOA 1E5WA 3TW1A 3HW2B 2LG1A 4Z2MB 1DROA 5KQ4A 4WSFA 1MPHA 2MFQA 5FI0A 4K2OA 1EAZA 4Z2NA 3MDBC 2D2QA 4MY6A 5D3VA 2ELBA 2D11A 2COAA 2J0KA 1N3HA 1MKEA 2DKQA 2CAYA 3SV1A 3IVFA 2DTCA 2DHIA 2Z0PA 4IOYX 2ZPYA 2D10A 4HHVA 4A6HA 1UNQA 2GCLA 2HTHB 2KUPA 2DYQA 1GG3A 2EMSA 1LB1A 2AL6A 5C6RA 2Y8FA 2YS5A 3D8FA 5C5BB 5C79A 1WJMA 2KGXB 1X11A 2ELAA 1K5DB 1UNRA 1UPRA 1RJ2A 4GMVA 2RUKB 2LKOA 2DX5A 4NY0A 1LW3A 3F0WA 5EFXA 1MIXA 3F5RA 4HATB 3KZ1A 2K2UA 5JP4A 2Y7BA 1U2BA 2COFA 1V5PA 3ZDTA 5J3YA 4CHMA 1H4RA 2YT1A 2DA0A 2N23A 2VSZA 5FI1A 3UZTA 2D9ZA 1X1FA 1TJ6A 3A8QA 1V88A 1U5EA 4HAYB 2ROZB 4B6HA 1M7EA 1Q67A 3SNHA 1SGHA 3D8DA 4XWXA 1NI2A 1XD4A 1P5TA 2EJ8A 1MAIA 3DXDA 5D3YA 1FAOA 3AJ4A 1BTNA 1P3RA 4GN1A 3ODWA 4PQ0A 1P6SA 3TCAA 2VKIA 3PP2A 1EF1A 2Z0QA 4A6FA 2I1JA 2GJYA 1IRSA 3QBVB 4BBKA 5KCVA 3ZVRA 1X86A 2YS3A 5J3TA 1XCGA 1UEFA 1TQZA 3CIKA 2P0DA 5GOWB 2P0FA 1XODA 1OY2A 5L81A 1QQGA 2I5FA 4HAVB 1WI1A 3A98B 1KZGA 1W1GA 2ROVA 4F7UP 1PFJA 2YSZA 1SHCA 3FSSA 4HDOA 1ZC3B 2DFKA 5DHFB 4TYZA 5HE1A 4KVGB 1B55A 4GXBA 1V5MA 2YF0A 3SUZA 1BWNA 3ML4A 5HE0A 3TO1A 3A8PA 5DI9B 4CHJA 2EMTA 4NSWA 2UVMA 5JHHA 2GS0A 1MK9B 4HAWB 1FHOA 2KCJA 4KHBB 3MPXA 1GC6A 1J19A 3D8EA 1AQCA 1FGYA 2N0YA 4IAPA 4MK0A 5HE2A 1DYNA 3X23A 5DIFB 4KHAA 2CRFA 2HE7A 5DHAB 2R09A 4A6KA 1FHWA 2K2JA 3PEGA 1OMWA 1U5FA 3NSUA 4IFSA 1KZ7A 2LOZA 2E2XA 2L2IA 2CY5A 3TVVA 3BINA 4K17A 2W2XD 4ZRIA 4HB2B 1WJ1A 3AU4A 1DDVA 1WG7A 2DHJA 2DYNA 1NTYA 3P6AA 3PG7A 2LYDA 3FM8C 3ODXA 3HK0A 2L1CA 4A5KA 2UZRA 1DDWA 1X05A 5CLQB 3T06A 3SO6A 3HQCA 1MIZB 4DXAB 2P8VA 4MT7A 1V61A 4DX90 2I1KA 1PMSA 1W1DA 2G35A 4DX8A 2DLWA 2AEHA 2IFSA 1ISNA 1FOEA 5C16A 4K81A 1GC7A 2Q13A 3PSCA 2CODA 1WVHA 2YS1A 1FGZA 1K5GB 1U27A 1WGQA 3KRXA 3P7ZA 2YT0A 3DXCA 4YONA 4ZRKA 2OQBA 2J0MA 4HB0B 3U8ZA 2COCA 1Z87A 5LOPB 1TXDA 3ULCA 2W2WA 1XR0B 2QKLA 4F7GA 3VIAA 3QIJA 3WYFB 5CLLB 2UZSA 1XX0A 4YL8A 2XQNM 3RCPA 5D27A 3U7DA 5D3XA 2QKMA 2Y8GA 4HB4B 3PVLA 1DBHA 2NMBA 3WA0A 2DHKA 1KI1B 4WVFB 1X1GA 2M38A 3KY9A 1V89A 5JLJB 2D4QA 1EVHA 3ULBA 2RSGA 4GZUA 2JP2A 4DBBA 1J0WA 4HDQA 2DKPA 2LULA 1ZC4B 2V76A 4H8SA 1ZVRA 1H10A 3QWMA 1XKEA 3OANA 1ZM0A 1BAKA 4A6FB 2RNRB 1I2HA 1OQNA 1BTKA 1FB8A 3BJIA 1Y5OA 2Z0OA 2DN6A 3VOQA 4D0NB 1DDMA 1UNPA 3KSYA 1MK7B 3SYXA 2FJLA 2D9XA 1WGUA 2W2XC 4EKUA 2MDXA 3GYPA 5HE3A 3DXEA 2PZ1A 2NZ8B 4CYEA 2D9WA 4HB3B 2CY4A 2H7DA 1W1HA 3O96A 2D9VA 1U5GA 3KRWA 4ZRJA 2MWNB 1UPQA 4PNKA 1EGXA 1M7RA 2D9YA 1FHXA 2I5CA 4K2PA 2YRYA 3PVWA 4Y94A 2K00A 2ADZA 2LOXA 2RLOA 2EC1A 5D3WA 2GCJA 3GYOA 4HAUB 2X18A 2M14A 2H7EA 4HAXB 1V5UA 2J59M 3CXBB 4HAZB 3N7CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NTV A;  3M1I B;  1I7A A;  2OTX A;  4TKN A;  1ZSQ A;  2VRW B;  4F7H A;  2YVC A;  4WJ7 A;  5KQ1 A;  4C0A A;  2RVB B;  1RRP B;  4EJN A;  5JHG A;  4GPT B;  5LON B;  1PLS A;  1QC6 A;  3FEH A;  3LJU X;  4GMX B;  3V5W A;  3G9W A;  3PZD A;  5C5B A;  2R0D A;  3TFM A;  1U5D A;  3AU5 A;  2J0J A;  2BCJ A;  1Y19 B;  1U29 A;  4L6E A;  4P7I A;  3ODO A;  4KAX B;  5J3Q A;  1AWE A;  2DX1 A;  5DH9 B;  2P0H A;  2MKR A;  4KHO A;  1NU2 A;  2RGN B;  3PVU A;  2IYB A;  4EMO A;  1E5W A;  3TW1 A;  3HW2 B;  2LG1 A;  4Z2M B;  1DRO A;  5KQ4 A;  4WSF A;  1MPH A;  2MFQ A;  5FI0 A;  4K2O A;  1EAZ A;  4Z2N A;  3MDB C;  2D2Q A;  4MY6 A;  5D3V A;  2ELB A;  2D11 A;  2COA A;  2J0K A;  1N3H A;  1MKE A;  2DKQ A;  2CAY A;  3SV1 A;  3IVF A;  2DTC A;  2DHI A;  2Z0P A;  4IOY X;  2ZPY A;  2D10 A;  4HHV A;  4A6H A;  1UNQ A;  2GCL A;  2HTH B;  2KUP A;  2DYQ A;  1GG3 A;  2EMS A;  1LB1 A;  2AL6 A;  5C6R A;  2Y8F A;  2YS5 A;  3D8F A;  5C5B B;  5C79 A;  1WJM A;  2KGX B;  1X11 A;  2ELA A;  1K5D B;  1UNR A;  1UPR A;  1RJ2 A;  4GMV A;  2RUK B;  2LKO A;  2DX5 A;  4NY0 A;  1LW3 A;  3F0W A;  5EFX A;  1MIX A;  3F5R A;  4HAT B;  3KZ1 A;  2K2U A;  5JP4 A;  2Y7B A;  1U2B A;  2COF A;  1V5P A;  3ZDT A;  5J3Y A;  4CHM A;  1H4R A;  2YT1 A;  2DA0 A;  2N23 A;  2VSZ A;  5FI1 A;  3UZT A;  2D9Z A;  1X1F A;  1TJ6 A;  3A8Q A;  1V88 A;  1U5E A;  4HAY B;  2ROZ B;  4B6H A;  1M7E A;  1Q67 A;  3SNH A;  1SGH A;  3D8D A;  4XWX A;  1NI2 A;  1XD4 A;  1P5T A;  2EJ8 A;  1MAI A;  3DXD A;  5D3Y A;  1FAO A;  3AJ4 A;  1BTN A;  1P3R A;  4GN1 A;  3ODW A;  4PQ0 A;  1P6S A;  3TCA A;  2VKI A;  3PP2 A;  1EF1 A;  2Z0Q A;  4A6F A;  2I1J A;  2GJY A;  1IRS A;  3QBV B;  4BBK A;  5KCV A;  3ZVR A;  1X86 A;  2YS3 A;  5J3T A;  1XCG A;  1UEF A;  1TQZ A;  3CIK A;  2P0D A;  5GOW B;  2P0F A;  1XOD A;  1OY2 A;  5L81 A;  1QQG A;  2I5F A;  4HAV B;  1WI1 A;  3A98 B;  1KZG A;  1W1G A;  2ROV A;  4F7U P;  1PFJ A;  2YSZ A;  1SHC A;  3FSS A;  4HDO A;  1ZC3 B;  2DFK A;  5DHF B;  4TYZ A;  5HE1 A;  4KVG B;  1B55 A;  4GXB A;  1V5M A;  2YF0 A;  3SUZ A;  1BWN A;  3ML4 A;  5HE0 A;  3TO1 A;  3A8P A;  5DI9 B;  4CHJ A;  2EMT A;  4NSW A;  2UVM A;  5JHH A;  2GS0 A;  1MK9 B;  4HAW B;  1FHO A;  2KCJ A;  4KHB B;  3MPX A;  1GC6 A;  1J19 A;  3D8E A;  1AQC A;  1FGY A;  2N0Y A;  4IAP A;  4MK0 A;  5HE2 A;  1DYN A;  3X23 A;  5DIF B;  4KHA A;  2CRF A;  2HE7 A;  5DHA B;  2R09 A;  4A6K A;  1FHW A;  2K2J A;  3PEG A;  1OMW A;  1U5F A;  3NSU A;  4IFS A;  1KZ7 A;  2LOZ A;  2E2X A;  2L2I A;  2CY5 A;  3TVV A;  3BIN A;  4K17 A;  2W2X D;  4ZRI A;  4HB2 B;  1WJ1 A;  3AU4 A;  1DDV A;  1WG7 A;  2DHJ A;  2DYN A;  1NTY A;  3P6A A;  3PG7 A;  2LYD A;  3FM8 C;  3ODX A;  3HK0 A;  2L1C A;  4A5K A;  2UZR A;  1DDW A;  1X05 A;  5CLQ B;  3T06 A;  3SO6 A;  3HQC A;  1MIZ B;  4DXA B;  2P8V A;  4MT7 A;  1V61 A;  4DX9 0;  2I1K A;  1PMS A;  1W1D A;  2G35 A;  4DX8 A;  2DLW A;  2AEH A;  2IFS A;  1ISN A;  1FOE A;  5C16 A;  4K81 A;  1GC7 A;  2Q13 A;  3PSC A;  2COD A;  1WVH A;  2YS1 A;  1FGZ A;  1K5G B;  1U27 A;  1WGQ A;  3KRX A;  3P7Z A;  2YT0 A;  3DXC A;  4YON A;  4ZRK A;  2OQB A;  2J0M A;  4HB0 B;  3U8Z A;  2COC A;  1Z87 A;  5LOP B;  1TXD A;  3ULC A;  2W2W A;  1XR0 B;  2QKL A;  4F7G A;  3VIA A;  3QIJ A;  3WYF B;  5CLL B;  2UZS A;  1XX0 A;  4YL8 A;  2XQN M;  3RCP A;  5D27 A;  3U7D A;  5D3X A;  2QKM A;  2Y8G A;  4HB4 B;  3PVL A;  1DBH A;  2NMB A;  3WA0 A;  2DHK A;  1KI1 B;  4WVF B;  1X1G A;  2M38 A;  3KY9 A;  1V89 A;  5JLJ B;  2D4Q A;  1EVH A;  3ULB A;  2RSG A;  4GZU A;  2JP2 A;  4DBB A;  1J0W A;  4HDQ A;  2DKP A;  2LUL A;  1ZC4 B;  2V76 A;  4H8S A;  1ZVR A;  1H10 A;  3QWM A;  1XKE A;  3OAN A;  1ZM0 A;  1BAK A;  4A6F B;  2RNR B;  1I2H A;  1OQN A;  1BTK A;  1FB8 A;  3BJI A;  1Y5O A;  2Z0O A;  2DN6 A;  3VOQ A;  4D0N B;  1DDM A;  1UNP A;  3KSY A;  1MK7 B;  3SYX A;  2FJL A;  2D9X A;  1WGU A;  2W2X C;  4EKU A;  2MDX A;  3GYP A;  5HE3 A;  3DXE A;  2PZ1 A;  2NZ8 B;  4CYE A;  2D9W A;  4HB3 B;  2CY4 A;  2H7D A;  1W1H A;  3O96 A;  2D9V A;  1U5G A;  3KRW A;  4ZRJ A;  2MWN B;  1UPQ A;  4PNK A;  1EGX A;  1M7R A;  2D9Y A;  1FHX A;  2I5C A;  4K2P A;  2YRY A;  3PVW A;  4Y94 A;  2K00 A;  2ADZ A;  2LOX A;  2RLO A;  2EC1 A;  5D3W A;  2GCJ A;  3GYO A;  4HAU B;  2X18 A;  2M14 A;  2H7E A;  4HAX B;  1V5U A;  2J59 M;  3CXB B;  4HAZ B;  3N7C A; 
#chains in the Genus database with same CATH topology
 1NTV A;  3M1I B;  1I7A A;  2OTX A;  4TKN A;  1ZSQ A;  5I2M A;  2VRW B;  4F7H A;  2YVC A;  4WJ7 A;  5KQ1 A;  4C0A A;  2RVB B;  3HIE A;  1MI1 A;  1RRP B;  4EJN A;  5JHG A;  4CSQ A;  4GPT B;  5LON B;  1PLS A;  1QC6 A;  3FEH A;  3LJU X;  4GMX B;  3V5W A;  3G9W A;  3PZD A;  5C5B A;  2R0D A;  3TFM A;  1U5D A;  3AU5 A;  4HSI A;  2J0J A;  2BCJ A;  1Y19 B;  1U29 A;  4L6E A;  4P7I A;  3ODO A;  3OHM B;  4KAX B;  5J3Q A;  1AWE A;  2DX1 A;  5DH9 B;  2P0H A;  2MKR A;  4KHO A;  1NU2 A;  2NBV A;  2RGN B;  3PVU A;  2IYB A;  4EMO A;  1E5W A;  3TW1 A;  3HW2 B;  2LG1 A;  4Z2M B;  1DRO A;  5KQ4 A;  4WSF A;  1MPH A;  2MFQ A;  5FI0 A;  4K2O A;  1EAZ A;  4Z2N A;  3MDB C;  2D2Q A;  4MY6 A;  5D3V A;  2ELB A;  2D11 A;  2COA A;  2J0K A;  1N3H A;  1MKE A;  2DKQ A;  2CAY A;  3SV1 A;  3IVF A;  2DTC A;  2DHI A;  2Z0P A;  4IOY X;  2ZPY A;  2D10 A;  3NW8 A;  4HHV A;  4A6H A;  1UNQ A;  2GCL A;  2HTH B;  2KUP A;  2DYQ A;  1GG3 A;  3NWA A;  2EMS A;  1LB1 A;  2AL6 A;  5C6R A;  2Y8F A;  2Z13 A;  2YS5 A;  4D6W A;  3D8F A;  2GUM A;  5C5B B;  5C79 A;  1WJM A;  2KGX B;  1X11 A;  2ELA A;  1K5D B;  1UNR A;  3A58 A;  1UPR A;  1RJ2 A;  4GMV A;  2RUK B;  5LG4 B;  2LKO A;  2DX5 A;  4NY0 A;  1LW3 A;  3F0W A;  5EFX A;  1MIX A;  3F5R A;  4HAT B;  3KZ1 A;  2K2U A;  5JP4 A;  2Y7B A;  1U2B A;  2COF A;  1V5P A;  3ZDT A;  4QXA B;  5J3Y A;  4CHM A;  1H4R A;  2YT1 A;  2DA0 A;  2N23 A;  2VSZ A;  5FI1 A;  2YT2 A;  2D9Z A;  3UZT A;  1X1F A;  1TJ6 A;  3A8Q A;  1V88 A;  1U5E A;  4HAY B;  2ROZ B;  4B6H A;  1T77 A;  1M7E A;  1Q67 A;  3SNH A;  1SGH A;  3D8D A;  4XWX A;  1NI2 A;  1XD4 A;  1P5T A;  2EJ8 A;  1MAI A;  2KIG A;  3DXD A;  1FAO A;  3AJ4 A;  2Z4D A;  5D3Y A;  2ZKM X;  1BTN A;  1P3R A;  4GN1 A;  3ODW A;  4PQ0 A;  1P6S A;  3TCA A;  2VKI A;  3PP2 A;  4KHB A;  1EF1 A;  2Z0Q A;  4A6F A;  2FJU B;  2I1J A;  2GJY A;  1IRS A;  3QBV B;  4BBK A;  5KCV A;  2KIE A;  3ZVR A;  1X86 A;  2YS3 A;  5J3T A;  1XCG A;  1UEF A;  1TQZ A;  4GNK B;  3CIK A;  2P0D A;  5GOW B;  2P0F A;  2K49 A;  1XOD A;  3U12 A;  1OY2 A;  5L81 A;  1QQG A;  2I5F A;  4HAV B;  1WI1 A;  3A98 B;  1KZG A;  1W1G A;  2ROV A;  4F7U P;  1PFJ A;  4GOU A;  2YSZ A;  1SHC A;  3B77 A;  5I2S A;  3FSS A;  4HDO A;  1ZC3 B;  2DFK A;  5DHF B;  4DIX A;  4TYZ A;  5HE1 A;  4KVG B;  1B55 A;  4GXB A;  1V5M A;  2YF0 A;  3SUZ A;  1BWN A;  3ML4 A;  5HE0 A;  3TO1 A;  3A8P A;  5DI9 B;  4CHJ A;  2EMT A;  4NSW A;  2UVM A;  5JHH A;  2GS0 A;  1MK9 B;  4OT1 A;  4HAW B;  1FHO A;  2KCJ A;  4KHB B;  3MPX A;  1GC6 A;  1J19 A;  3D8E A;  1AQC A;  1FGY A;  2N0Y A;  4IAP A;  2R2Y A;  4MK0 A;  5HE2 A;  1DYN A;  3X23 A;  5DIF B;  5IRS A;  4KHA A;  2CRF A;  2HE7 A;  5DHA B;  2Z14 A;  2R09 A;  4A6K A;  1FHW A;  2K2J A;  3PEG A;  1OMW A;  1U5F A;  3NSU A;  4IFS A;  1KZ7 A;  3DCX A;  2LOZ A;  2E2X A;  2L2I A;  2CY5 A;  3TVV A;  2Z59 A;  3BIN A;  4K17 A;  2W2X D;  4ZRI A;  4HB2 B;  1WJ1 A;  3AU4 A;  1DDV A;  1WG7 A;  2DHJ A;  2DYN A;  1NTY A;  3P6A A;  4QJ3 B;  3PG7 A;  2LYD A;  3FM8 C;  3ODX A;  3FVC A;  3HK0 A;  4QJ5 B;  2L1C A;  4A5K A;  2UZR A;  1DDW A;  2KUQ A;  1X05 A;  5CLQ B;  3T06 A;  3SO6 A;  3HQC A;  1MIZ B;  4DXA B;  2P8V A;  4MT7 A;  1V61 A;  4DX9 0;  2I1K A;  1PMS A;  1W1D A;  2G35 A;  4DX8 A;  2DLW A;  2AEH A;  2IFS A;  1ISN A;  1FOE A;  5C16 A;  4K81 A;  1GC7 A;  2Q13 A;  3PSC A;  2COD A;  1WVH A;  3NWD A;  2YS1 A;  2RRF A;  1FGZ A;  1K5G B;  1U27 A;  1WGQ A;  3KRX A;  3P7Z A;  2YT0 A;  3DXC A;  4YON A;  4ZRK A;  2OQB A;  2J0M A;  3HSA A;  4HB0 B;  3U8Z A;  2COC A;  4L1R A;  1Z87 A;  5LOP B;  1TXD A;  3ULC A;  2W2W A;  1XR0 B;  2QKL A;  4F7G A;  3VIA A;  3QIJ A;  3WYF B;  5CLL B;  2UZS A;  1XX0 A;  4YL8 A;  2XQN M;  3RCP A;  5D27 A;  3U7D A;  5D3X A;  2QKM A;  2Y8G A;  4HB4 B;  3PVL A;  1DBH A;  2NMB A;  3WA0 A;  2DHK A;  1KI1 B;  4WVF B;  1X1G A;  2M38 A;  3KY9 A;  1V89 A;  5JLJ B;  2D4Q A;  1EVH A;  3ULB A;  2RSG A;  4GZU A;  2JP2 A;  4DBB A;  1J0W A;  4HDQ A;  2DKP A;  2LUL A;  1ZC4 B;  2V76 A;  4H8S A;  1ZVR A;  1H10 A;  3QWM A;  1XKE A;  3OAN A;  1ZM0 A;  1BAK A;  4A6F B;  2RNR B;  2KR0 A;  1I2H A;  1OQN A;  1BTK A;  1FB8 A;  3BJI A;  1Y5O A;  2Z0O A;  2DN6 A;  3VOQ A;  3NWF A;  4D0N B;  1DDM A;  1UNP A;  3KSY A;  4OSN A;  1MK7 B;  3SYX A;  2FJL A;  2D9X A;  1WGU A;  2K8E A;  2W2X C;  4EKU A;  2MDX A;  5M4Y B;  3GYP A;  5HE3 A;  3DXE A;  2PZ1 A;  2NZ8 B;  4CYE A;  2D9W A;  4HB3 B;  2CY4 A;  2H7D A;  1W1H A;  3O96 A;  2D9V A;  1U5G A;  3KRW A;  4ZRJ A;  2MWN B;  1UPQ A;  4PNK A;  1EGX A;  1M7R A;  2D9Y A;  1FHX A;  2I5C A;  4K2P A;  2YRY A;  3PVW A;  4Y94 A;  2K00 A;  1ZYI A;  2ADZ A;  2LOX A;  2RLO A;  2EC1 A;  5D3W A;  2GCJ A;  3GYO A;  4HAU B;  2X18 A;  2M14 A;  2H7E A;  4HAX B;  1V5U A;  2J59 M;  3CXB B;  4QJ4 B;  4HAZ B;  3N7C A; 
#chains in the Genus database with same CATH homology
 1NTV A;  3M1I B;  1I7A A;  2OTX A;  4TKN A;  1ZSQ A;  2VRW B;  4F7H A;  2YVC A;  4WJ7 A;  5KQ1 A;  4C0A A;  2RVB B;  1RRP B;  4EJN A;  5JHG A;  4GPT B;  5LON B;  1PLS A;  1QC6 A;  3FEH A;  3LJU X;  4GMX B;  3V5W A;  3G9W A;  3PZD A;  5C5B A;  2R0D A;  3TFM A;  1U5D A;  3AU5 A;  2J0J A;  2BCJ A;  1Y19 B;  1U29 A;  4L6E A;  4P7I A;  3ODO A;  4KAX B;  5J3Q A;  1AWE A;  2DX1 A;  5DH9 B;  2P0H A;  2MKR A;  4KHO A;  1NU2 A;  2RGN B;  3PVU A;  2IYB A;  4EMO A;  1E5W A;  3TW1 A;  3HW2 B;  2LG1 A;  4Z2M B;  1DRO A;  5KQ4 A;  4WSF A;  1MPH A;  2MFQ A;  5FI0 A;  4K2O A;  1EAZ A;  4Z2N A;  3MDB C;  2D2Q A;  4MY6 A;  5D3V A;  2ELB A;  2D11 A;  2COA A;  2J0K A;  1N3H A;  1MKE A;  2DKQ A;  2CAY A;  3SV1 A;  3IVF A;  2DTC A;  2DHI A;  2Z0P A;  4IOY X;  2ZPY A;  2D10 A;  4HHV A;  4A6H A;  1UNQ A;  2GCL A;  2HTH B;  2KUP A;  2DYQ A;  1GG3 A;  2EMS A;  1LB1 A;  2AL6 A;  5C6R A;  2Y8F A;  2YS5 A;  3D8F A;  5C5B B;  5C79 A;  1WJM A;  2KGX B;  1X11 A;  2ELA A;  1K5D B;  1UNR A;  1UPR A;  1RJ2 A;  4GMV A;  2RUK B;  2LKO A;  2DX5 A;  4NY0 A;  1LW3 A;  3F0W A;  5EFX A;  1MIX A;  3F5R A;  4HAT B;  3KZ1 A;  2K2U A;  5JP4 A;  2Y7B A;  1U2B A;  2COF A;  1V5P A;  3ZDT A;  5J3Y A;  4CHM A;  1H4R A;  2YT1 A;  2DA0 A;  2N23 A;  2VSZ A;  5FI1 A;  3UZT A;  2D9Z A;  1X1F A;  1TJ6 A;  3A8Q A;  1V88 A;  1U5E A;  4HAY B;  2ROZ B;  4B6H A;  1M7E A;  1Q67 A;  3SNH A;  1SGH A;  3D8D A;  4XWX A;  1NI2 A;  1XD4 A;  1P5T A;  2EJ8 A;  1MAI A;  3DXD A;  5D3Y A;  1FAO A;  3AJ4 A;  1BTN A;  1P3R A;  4GN1 A;  3ODW A;  4PQ0 A;  1P6S A;  3TCA A;  2VKI A;  3PP2 A;  1EF1 A;  2Z0Q A;  4A6F A;  2I1J A;  2GJY A;  1IRS A;  3QBV B;  4BBK A;  5KCV A;  3ZVR A;  1X86 A;  2YS3 A;  5J3T A;  1XCG A;  1UEF A;  1TQZ A;  3CIK A;  2P0D A;  5GOW B;  2P0F A;  1XOD A;  1OY2 A;  5L81 A;  1QQG A;  2I5F A;  4HAV B;  1WI1 A;  3A98 B;  1KZG A;  1W1G A;  2ROV A;  4F7U P;  1PFJ A;  2YSZ A;  1SHC A;  3FSS A;  4HDO A;  1ZC3 B;  2DFK A;  5DHF B;  4TYZ A;  5HE1 A;  4KVG B;  1B55 A;  4GXB A;  1V5M A;  2YF0 A;  3SUZ A;  1BWN A;  3ML4 A;  5HE0 A;  3TO1 A;  3A8P A;  5DI9 B;  4CHJ A;  2EMT A;  4NSW A;  2UVM A;  5JHH A;  2GS0 A;  1MK9 B;  4HAW B;  1FHO A;  2KCJ A;  4KHB B;  3MPX A;  1GC6 A;  1J19 A;  3D8E A;  1AQC A;  1FGY A;  2N0Y A;  4IAP A;  4MK0 A;  5HE2 A;  1DYN A;  3X23 A;  5DIF B;  4KHA A;  2CRF A;  2HE7 A;  5DHA B;  2R09 A;  4A6K A;  1FHW A;  2K2J A;  3PEG A;  1OMW A;  1U5F A;  3NSU A;  4IFS A;  1KZ7 A;  2LOZ A;  2E2X A;  2L2I A;  2CY5 A;  3TVV A;  3BIN A;  4K17 A;  2W2X D;  4ZRI A;  4HB2 B;  1WJ1 A;  3AU4 A;  1DDV A;  1WG7 A;  2DHJ A;  2DYN A;  1NTY A;  3P6A A;  3PG7 A;  2LYD A;  3FM8 C;  3ODX A;  3HK0 A;  2L1C A;  4A5K A;  2UZR A;  1DDW A;  1X05 A;  5CLQ B;  3T06 A;  3SO6 A;  3HQC A;  1MIZ B;  4DXA B;  2P8V A;  4MT7 A;  1V61 A;  4DX9 0;  2I1K A;  1PMS A;  1W1D A;  2G35 A;  4DX8 A;  2DLW A;  2AEH A;  2IFS A;  1ISN A;  1FOE A;  5C16 A;  4K81 A;  1GC7 A;  2Q13 A;  3PSC A;  2COD A;  1WVH A;  2YS1 A;  1FGZ A;  1K5G B;  1U27 A;  1WGQ A;  3KRX A;  3P7Z A;  2YT0 A;  3DXC A;  4YON A;  4ZRK A;  2OQB A;  2J0M A;  4HB0 B;  3U8Z A;  2COC A;  1Z87 A;  5LOP B;  1TXD A;  3ULC A;  2W2W A;  1XR0 B;  2QKL A;  4F7G A;  3VIA A;  3QIJ A;  3WYF B;  5CLL B;  2UZS A;  1XX0 A;  4YL8 A;  2XQN M;  3RCP A;  5D27 A;  3U7D A;  5D3X A;  2QKM A;  2Y8G A;  4HB4 B;  3PVL A;  1DBH A;  2NMB A;  3WA0 A;  2DHK A;  1KI1 B;  4WVF B;  1X1G A;  2M38 A;  3KY9 A;  1V89 A;  5JLJ B;  2D4Q A;  1EVH A;  3ULB A;  2RSG A;  4GZU A;  2JP2 A;  4DBB A;  1J0W A;  4HDQ A;  2DKP A;  2LUL A;  1ZC4 B;  2V76 A;  4H8S A;  1ZVR A;  1H10 A;  3QWM A;  1XKE A;  3OAN A;  1ZM0 A;  1BAK A;  4A6F B;  2RNR B;  1I2H A;  1OQN A;  1BTK A;  1FB8 A;  3BJI A;  1Y5O A;  2Z0O A;  2DN6 A;  3VOQ A;  4D0N B;  1DDM A;  1UNP A;  3KSY A;  1MK7 B;  3SYX A;  2FJL A;  2D9X A;  1WGU A;  2W2X C;  4EKU A;  2MDX A;  3GYP A;  5HE3 A;  3DXE A;  2PZ1 A;  2NZ8 B;  4CYE A;  2D9W A;  4HB3 B;  2CY4 A;  2H7D A;  1W1H A;  3O96 A;  2D9V A;  1U5G A;  3KRW A;  4ZRJ A;  2MWN B;  1UPQ A;  4PNK A;  1EGX A;  1M7R A;  2D9Y A;  1FHX A;  2I5C A;  4K2P A;  2YRY A;  3PVW A;  4Y94 A;  2K00 A;  2ADZ A;  2LOX A;  2RLO A;  2EC1 A;  5D3W A;  2GCJ A;  3GYO A;  4HAU B;  2X18 A;  2M14 A;  2H7E A;  4HAX B;  1V5U A;  2J59 M;  3CXB B;  4HAZ B;  3N7C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...