3SYXA

Crystal structure of the wh1 domain from human sprouty-related, evh1 domain-containing protein. northeast structural genomics consortium target hr5538b.
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
118
structure length
118
Chain Sequence
SHMSYARVRAVVMTRDDSSGGWLPLGGSGLSSVTVFKVPHQEENGCADFFIRGERLRDKMVVLECMLKKDLIYNKVTPTFHHWKIDDKKFGLTFQSPADARAFDRGIRRAIEDISQGC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Sprouty-related, EVH1 domain-containing protein 1
publication title Crystal Structure of the WH1 domain from human sprouty-related, EVH1 domain-containing protein.
rcsb
source organism Homo sapiens
total genus 20
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2011-07-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3syxA00
4ZRKA 1ZSQA 2NMBA 3FEHA 3D8DA 4DXAB 4EJNA 4KHOA 1H4RA 1EAZA 2RNRB 1V5PA 2Q13A 3F0WA 2RGNB 4GN1A 2MFQA 2RLOA 4HDOA 4L6EA 2ADZA 3NSUA 2RUKB 4YL8A 3V5WA 3O96A 1MIXA 2G35A 4P7IA 2LG1A 1X1FA 5L81A 2I5CA 2KUPA 2EMSA 1FOEA 4F7HA 3QWMA 2I1JA 3PVWA 1DYNA 1X1GA 3CIKA 1X11A 5D3VA 2COAA 1I7AA 4CYEA 2K2JA 2K2UA 2L1CA 1XKEA 1PFJA 2DHJA 1GG3A 5FI1A 2D10A 3HQCA 1W1DA 4K2PA 3VIAA 5CLLB 1DBHA 5DIFB 1DDMA 2YT1A 4HB4B 4KHBB 3PVUA 2DX1A 1WJMA 2Y8FA 2ELBA 2R0DA 5DHAB 2NZ8B 1TQZA 4K2OA 3AU5A 2J59M 1NTYA 3PSCA 1NTVA 4DX8A 3BJIA 3OANA 1FGZA 5D3XA 1KZGA 4Z2MB 5CLQB 3FSSA 3WA0A 2I5FA 4HB0B 5J3QA 1WI1A 2GCLA 3G9WA 3GYPA 1KZ7A 2KCJA 5J3TA 4H8SA 1XX0A 3SO6A 2OTXA 4HAZB 3PZDA 1RRPB 5HE3A 4F7GA 1N3HA 2CRFA 1K5DB 3DXDA 4A5KA 1BWNA 3TW1A 5C6RA 1OMWA 1U5DA 1Y19B 2P8VA 3FM8C 5HE2A 4ZRJA 5KQ1A 5D3YA 2J0JA 1UPRA 2BCJA 1W1GA 2EC1A 1V5MA 4K17A 4HB3B 2AL6A 4K81A 4CHJA 2DN6A 4KHAA 3SYXA 2MDXA 1Z87A 2LULA 1ZVRA 5KCVA 2LOXA 2MWNB 2HE7A 1ZM0A 3GYOA 2K00A 1PMSA 3CXBB 3DXEA 1U5GA 4CHMA 1V88A 3DXCA 5LOPB 5C5BB 4HAVB 4DBBA 2ROZB 4BBKA 5JHGA 1E5WA 5C5BA 2Y7BA 2DX5A 1V89A 1X86A 4Z2NA 1XODA 1P3RA 1Q67A 1DDVA 4NY0A 2ROVA 3HK0A 4PQ0A 4HAUB 5DHFB 3TCAA 2GCJA 1UNRA 4WJ7A 1OY2A 5JLJB 1IRSA 2D9VA 1BTNA 4YONA 3P7ZA 1DDWA 4TKNA 4HDQA 1FHXA 2I1KA 4GMVA 5GOWB 3P6AA 1QQGA 2D2QA 3T06A 3SNHA 3KRXA 1H10A 2R09A 2D9WA 1XR0B 1V5UA 2VKIA 2D9XA 4C0AA 3A98B 3ODXA 2DKPA 3MPXA 1W1HA 3ML4A 3VOQA 1M7EA 2DYQA 2UZSA 3ULBA 4GXBA 2P0DA 2YSZA 1WG7A 1UEFA 3MDBC 4PNKA 5FI0A 1KI1B 4A6FB 3X23A 4HB2B 2XQNM 1MIZB 2YS5A 4GZUA 4A6FA 2CAYA 1FGYA 2GJYA 3SUZA 1ZC3B 2EJ8A 1QC6A 5DI9B 2RSGA 1MK7B 1OQNA 4D0NB 3RCPA 1DROA 2J0KA 2M14A 2PZ1A 3HW2B 4A6KA 2LYDA 1MPHA 2M38A 3TO1A 5JP4A 2QKMA 2CODA 1U5FA 2D4QA 3KY9A 1U5EA 3KZ1A 2D9ZA 3BINA 3KSYA 2VSZA 2DLWA 2MKRA 4EKUA 4HATB 2DTCA 4HAYB 2P0HA 2X18A 1P6SA 1ZC4B 4A6HA 4HAXB 1WGUA 2E2XA 3M1IB 1U29A 5EFXA 1FAOA 1ISNA 1AQCA 2J0MA 1AWEA 1BAKA 2CY4A 5DH9B 1U2BA 5LONB 3ZDTA 4EMOA 1I2HA 1UPQA 1XCGA 3PP2A 3ULCA 1TXDA 5KQ4A 2D11A 1BTKA 2RVBB 3IVFA 2HTHB 1MK9B 1J0WA 2V76A 4WSFA 2DFKA 2L2IA 3AJ4A 4MK0A 1K5GB 2DHIA 2GS0A 3SV1A 3N7CA 3ZVRA 4NSWA 1LB1A 2W2WA 3U8ZA 3UZTA 5D27A 1MKEA 3A8PA 3PEGA 2W2XD 1WGQA 1B55A 3LJUX 2VRWB 3KRWA 1EGXA 5C79A 1UNPA 5HE0A 1NU2A 1V61A 2Z0PA 2DYNA 2FJLA 4GPTB 1FHWA 2LKOA 4IAPA 3QIJA 2W2XC 1EF1A 2UZRA 4KAXB 4HAWB 1SGHA 2YVCA 4F7UP 2IYBA 4KVGB 2YRYA 3D8EA 4ZRIA 5HE1A 1SHCA 5C16A 3PG7A 1TJ6A 1GC7A 5J3YA 1MAIA 2DA0A 2IFSA 4IFSA 2COFA 2N23A 1M7RA 4XWXA 1WJ1A 3A8QA 3QBVB 4IOYX 2DKQA 1FHOA 2YS3A 1XD4A 2CY5A 1UNQA 2KGXB 2LOZA 3AU4A 4HHVA 2QKLA 2YF0A 2YT0A 4B6HA 2AEHA 1U27A 4WVFB 1FB8A 1WVHA 2H7EA 1GC6A 2H7DA 1EVHA 2UVMA 3TVVA 2OQBA 1PLSA 1Y5OA 2Z0OA 2COCA 4MT7A 1RJ2A 4DX90 4MY6A 1NI2A 2D9YA 2JP2A 2Z0QA 2N0YA 3PVLA 2Y8GA 3WYFB 4Y94A 2ELAA 1X05A 2YS1A 4GMXB 4TYZA 5JHHA 2EMTA 2P0FA 3TFMA 1J19A 1P5TA 3ODWA 3U7DA 2ZPYA 1LW3A 3D8FA 2DHKA 5D3WA 3F5RA 3ODOA
chains in the Genus database with same CATH superfamily
4ZRKA 1ZSQA 2NMBA 3FEHA 3D8DA 4DXAB 4EJNA 4KHOA 1H4RA 1EAZA 2RNRB 1V5PA 2Q13A 3F0WA 2RGNB 2RRFA 4GN1A 2MFQA 2RLOA 4HDOA 4L6EA 2ADZA 3NSUA 2RUKB 4YL8A 3V5WA 3O96A 1MIXA 2G35A 4P7IA 2LG1A 1X1FA 5L81A 2I5CA 3FVCA 2KUPA 2EMSA 1FOEA 4F7HA 3QWMA 2I1JA 3PVWA 1DYNA 1X1GA 3CIKA 4QXAB 1X11A 5D3VA 2COAA 1I7AA 4CYEA 2K2JA 2K2UA 2L1CA 1XKEA 1PFJA 2DHJA 1GG3A 5FI1A 2D10A 3HQCA 1W1DA 4K2PA 3VIAA 5CLLB 1DBHA 4QJ3B 5DIFB 1DDMA 2YT1A 4HB4B 4KHBB 3PVUA 2DX1A 1WJMA 2Y8FA 2ELBA 2R0DA 4KHBA 2KUQA 5DHAB 2NZ8B 1TQZA 4K2OA 3AU5A 2J59M 1NTYA 3NWDA 3PSCA 1NTVA 4DX8A 3BJIA 3OANA 1FGZA 5D3XA 1KZGA 4Z2MB 5CLQB 3FSSA 3WA0A 2I5FA 4HB0B 5J3QA 1T77A 1WI1A 2GCLA 3G9WA 3GYPA 1KZ7A 2KCJA 1ZYIA 4H8SA 1XX0A 3NW8A 5J3TA 3SO6A 2OTXA 4HAZB 3PZDA 1RRPB 5HE3A 4OT1A 4F7GA 1N3HA 2CRFA 1K5DB 3DXDA 4A5KA 1BWNA 3TW1A 5C6RA 1OMWA 1U5DA 4QJ4B 3U12A 1Y19B 2P8VA 3FM8C 5HE2A 4ZRJA 5KQ1A 5D3YA 2J0JA 1UPRA 2BCJA 1W1GA 2EC1A 1V5MA 4K17A 4HB3B 2AL6A 4K81A 4CHJA 2DN6A 4KHAA 3SYXA 2MDXA 1Z87A 4DIXA 2LULA 1ZVRA 5KCVA 2LOXA 2MWNB 2HE7A 1ZM0A 3GYOA 2K00A 1PMSA 3CXBB 3DXEA 1U5GA 4CHMA 1V88A 3DXCA 5LOPB 5C5BB 4HAVB 4DBBA 2ROZB 4BBKA 2FJUB 5JHGA 1E5WA 5C5BA 2Y7BA 2DX5A 1V89A 1X86A 4Z2NA 1XODA 1P3RA 1Q67A 1DDVA 4NY0A 2ROVA 5LG4B 3HK0A 4PQ0A 4HAUB 5DHFB 3TCAA 2GCJA 1UNRA 2KR0A 4WJ7A 1OY2A 5JLJB 1IRSA 2D9VA 1BTNA 4YONA 3P7ZA 2Z14A 1DDWA 4TKNA 4HDQA 1FHXA 2I1KA 4GMVA 5GOWB 3P6AA 1QQGA 2D2QA 3T06A 3SNHA 4D6WA 3KRXA 1H10A 5M4YB 2R09A 2D9WA 1XR0B 1V5UA 2KIEA 2VKIA 3A58A 2D9XA 4C0AA 3OHMB 3A98B 3ODXA 2DKPA 3MPXA 1W1HA 3ML4A 3VOQA 1M7EA 2DYQA 2UZSA 3ULBA 4GXBA 2P0DA 2YSZA 1WG7A 1UEFA 3MDBC 4PNKA 5FI0A 1KI1B 4A6FB 3X23A 4HB2B 2XQNM 1MIZB 2YS5A 4GNKB 4GZUA 2CAYA 4A6FA 1FGYA 2GJYA 3SUZA 1ZC3B 2EJ8A 1QC6A 5DI9B 2RSGA 1MK7B 1OQNA 4D0NB 3RCPA 1DROA 4L1RA 2J0KA 2M14A 2PZ1A 3HW2B 4A6KA 2LYDA 1MPHA 2M38A 3TO1A 3NWFA 5JP4A 2QKMA 2CODA 1U5FA 2R2YA 2D4QA 3KY9A 2GUMA 1U5EA 3KZ1A 3NWAA 3HIEA 2D9ZA 3BINA 3KSYA 2VSZA 2DLWA 4OSNA 2MKRA 4EKUA 4HATB 2DTCA 2NBVA 4HAYB 2P0HA 2X18A 2ZKMX 2K8EA 1P6SA 1ZC4B 4A6HA 4HAXB 1WGUA 2E2XA 3M1IB 1U29A 5EFXA 1FAOA 1ISNA 1AQCA 2J0MA 1AWEA 1BAKA 2CY4A 5DH9B 1U2BA 3DCXA 3ZDTA 4EMOA 5LONB 1I2HA 1UPQA 2YT2A 1XCGA 3PP2A 3ULCA 1TXDA 5KQ4A 2D11A 1BTKA 2RVBB 3IVFA 2HTHB 1MK9B 1J0WA 2V76A 4WSFA 2DFKA 2L2IA 3AJ4A 4MK0A 1K5GB 2DHIA 2GS0A 3SV1A 3N7CA 3ZVRA 4NSWA 1LB1A 2W2WA 3U8ZA 3UZTA 5D27A 1MKEA 3A8PA 3PEGA 2W2XD 1WGQA 1B55A 3LJUX 2VRWB 3KRWA 1EGXA 5C79A 4CSQA 1UNPA 2Z4DA 1NU2A 1V61A 2Z0PA 5HE0A 2DYNA 2FJLA 2K49A 2Z59A 4GPTB 1FHWA 2LKOA 4IAPA 3QIJA 2W2XC 1EF1A 2UZRA 4KAXB 2KIGA 4HAWB 1SGHA 2YVCA 4F7UP 2IYBA 4KVGB 2YRYA 3D8EA 4ZRIA 5HE1A 1SHCA 5C16A 3PG7A 1TJ6A 1GC7A 5J3YA 1MAIA 2DA0A 4GOUA 5I2SA 2IFSA 2Z13A 4IFSA 3HSAA 2COFA 2N23A 1M7RA 4XWXA 1WJ1A 3A8QA 3QBVB 4IOYX 2DKQA 5I2MA 5IRSA 1FHOA 2YS3A 1XD4A 2CY5A 1UNQA 2KGXB 2LOZA 3AU4A 4HHVA 2QKLA 2YF0A 4HSIA 2YT0A 4B6HA 2AEHA 1U27A 4WVFB 1FB8A 1WVHA 2H7EA 1GC6A 2H7DA 1EVHA 2UVMA 3TVVA 2OQBA 1PLSA 1Y5OA 1MI1A 2Z0OA 2COCA 4MT7A 1RJ2A 4DX90 4MY6A 1NI2A 2D9YA 2JP2A 4QJ5B 2Z0QA 2N0YA 3PVLA 3B77A 2Y8GA 3WYFB 4Y94A 2ELAA 1X05A 2YS1A 4GMXB 4TYZA 5JHHA 2EMTA 2P0FA 3TFMA 1J19A 1P5TA 3ODWA 3U7DA 2ZPYA 1LW3A 3D8FA 2DHKA 5D3WA 3F5RA 3ODOA
chains in the Genus database with same CATH topology
4ZRKA 1ZSQA 2NMBA 3FEHA 3D8DA 4DXAB 4EJNA 4KHOA 1H4RA 1EAZA 2RNRB 1V5PA 2Q13A 3F0WA 2RGNB 4GN1A 2MFQA 2RLOA 4HDOA 4L6EA 2ADZA 3NSUA 2RUKB 4YL8A 3V5WA 3O96A 1MIXA 2G35A 4P7IA 2LG1A 1X1FA 5L81A 2I5CA 2KUPA 2EMSA 1FOEA 4F7HA 3QWMA 2I1JA 3PVWA 1DYNA 1X1GA 3CIKA 1X11A 5D3VA 2COAA 1I7AA 4CYEA 2K2JA 2K2UA 2L1CA 1XKEA 1PFJA 2DHJA 1GG3A 5FI1A 2D10A 3HQCA 1W1DA 4K2PA 3VIAA 5CLLB 1DBHA 5DIFB 1DDMA 2YT1A 4HB4B 4KHBB 3PVUA 2DX1A 1WJMA 2Y8FA 2ELBA 2R0DA 5DHAB 2NZ8B 1TQZA 4K2OA 3AU5A 2J59M 1NTYA 3PSCA 1NTVA 4DX8A 3BJIA 3OANA 1FGZA 5D3XA 1KZGA 4Z2MB 5CLQB 3FSSA 3WA0A 2I5FA 4HB0B 5J3QA 1WI1A 2GCLA 3G9WA 3GYPA 1KZ7A 2KCJA 5J3TA 4H8SA 1XX0A 3SO6A 2OTXA 4HAZB 3PZDA 1RRPB 5HE3A 4F7GA 1N3HA 2CRFA 1K5DB 3DXDA 4A5KA 1BWNA 3TW1A 5C6RA 1OMWA 1U5DA 1Y19B 2P8VA 3FM8C 5HE2A 4ZRJA 5KQ1A 5D3YA 2J0JA 1UPRA 2BCJA 1W1GA 2EC1A 1V5MA 4K17A 4HB3B 2AL6A 4K81A 4CHJA 2DN6A 4KHAA 3SYXA 2MDXA 1Z87A 2LULA 1ZVRA 5KCVA 2LOXA 2MWNB 2HE7A 1ZM0A 3GYOA 2K00A 1PMSA 3CXBB 3DXEA 1U5GA 4CHMA 1V88A 3DXCA 5LOPB 5C5BB 4HAVB 4DBBA 2ROZB 4BBKA 5JHGA 1E5WA 5C5BA 2Y7BA 2DX5A 1V89A 1X86A 4Z2NA 1XODA 1P3RA 1Q67A 1DDVA 4NY0A 2ROVA 3HK0A 4PQ0A 4HAUB 5DHFB 3TCAA 2GCJA 1UNRA 4WJ7A 1OY2A 5JLJB 1IRSA 2D9VA 1BTNA 4YONA 3P7ZA 1DDWA 4TKNA 4HDQA 1FHXA 2I1KA 4GMVA 5GOWB 3P6AA 1QQGA 2D2QA 3T06A 3SNHA 3KRXA 1H10A 2R09A 2D9WA 1XR0B 1V5UA 2VKIA 2D9XA 4C0AA 3A98B 3ODXA 2DKPA 3MPXA 1W1HA 3ML4A 3VOQA 1M7EA 2DYQA 2UZSA 3ULBA 4GXBA 2P0DA 2YSZA 1WG7A 1UEFA 3MDBC 4PNKA 5FI0A 1KI1B 4A6FB 3X23A 4HB2B 2XQNM 1MIZB 2YS5A 4GZUA 4A6FA 2CAYA 1FGYA 2GJYA 3SUZA 1ZC3B 2EJ8A 1QC6A 5DI9B 2RSGA 1MK7B 1OQNA 4D0NB 3RCPA 1DROA 2J0KA 2M14A 2PZ1A 3HW2B 4A6KA 2LYDA 1MPHA 2M38A 3TO1A 5JP4A 2QKMA 2CODA 1U5FA 2D4QA 3KY9A 1U5EA 3KZ1A 2D9ZA 3BINA 3KSYA 2VSZA 2DLWA 2MKRA 4EKUA 4HATB 2DTCA 4HAYB 2P0HA 2X18A 1P6SA 1ZC4B 4A6HA 4HAXB 1WGUA 2E2XA 3M1IB 1U29A 5EFXA 1FAOA 1ISNA 1AQCA 2J0MA 1AWEA 1BAKA 2CY4A 5DH9B 1U2BA 5LONB 3ZDTA 4EMOA 1I2HA 1UPQA 1XCGA 3PP2A 3ULCA 1TXDA 5KQ4A 2D11A 1BTKA 2RVBB 3IVFA 2HTHB 1MK9B 1J0WA 2V76A 4WSFA 2DFKA 2L2IA 3AJ4A 4MK0A 1K5GB 2DHIA 2GS0A 3SV1A 3N7CA 3ZVRA 4NSWA 1LB1A 2W2WA 3U8ZA 3UZTA 5D27A 1MKEA 3A8PA 3PEGA 2W2XD 1WGQA 1B55A 3LJUX 2VRWB 3KRWA 1EGXA 5C79A 1UNPA 5HE0A 1NU2A 1V61A 2Z0PA 2DYNA 2FJLA 4GPTB 1FHWA 2LKOA 4IAPA 3QIJA 2W2XC 1EF1A 2UZRA 4KAXB 4HAWB 1SGHA 2YVCA 4F7UP 2IYBA 4KVGB 2YRYA 3D8EA 4ZRIA 5HE1A 1SHCA 5C16A 3PG7A 1TJ6A 1GC7A 5J3YA 1MAIA 2DA0A 2IFSA 4IFSA 2COFA 2N23A 1M7RA 4XWXA 1WJ1A 3A8QA 3QBVB 4IOYX 2DKQA 1FHOA 2YS3A 1XD4A 2CY5A 1UNQA 2KGXB 2LOZA 3AU4A 4HHVA 2QKLA 2YF0A 2YT0A 4B6HA 2AEHA 1U27A 4WVFB 1FB8A 1WVHA 2H7EA 1GC6A 2H7DA 1EVHA 2UVMA 3TVVA 2OQBA 1PLSA 1Y5OA 2Z0OA 2COCA 4MT7A 1RJ2A 4DX90 4MY6A 1NI2A 2D9YA 2JP2A 2Z0QA 2N0YA 3PVLA 2Y8GA 3WYFB 4Y94A 2ELAA 1X05A 2YS1A 4GMXB 4TYZA 5JHHA 2EMTA 2P0FA 3TFMA 1J19A 1P5TA 3ODWA 3U7DA 2ZPYA 1LW3A 3D8FA 2DHKA 5D3WA 3F5RA 3ODOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZRK A;  1ZSQ A;  2NMB A;  3FEH A;  3D8D A;  4DXA B;  4EJN A;  4KHO A;  1H4R A;  1EAZ A;  2RNR B;  1V5P A;  2Q13 A;  3F0W A;  2RGN B;  4GN1 A;  2MFQ A;  2RLO A;  4HDO A;  4L6E A;  2ADZ A;  3NSU A;  2RUK B;  4YL8 A;  3V5W A;  3O96 A;  1MIX A;  2G35 A;  4P7I A;  2LG1 A;  1X1F A;  5L81 A;  2I5C A;  2KUP A;  2EMS A;  1FOE A;  4F7H A;  3QWM A;  2I1J A;  3PVW A;  1DYN A;  1X1G A;  3CIK A;  1X11 A;  5D3V A;  2COA A;  1I7A A;  4CYE A;  2K2J A;  2K2U A;  2L1C A;  1XKE A;  1PFJ A;  2DHJ A;  1GG3 A;  5FI1 A;  2D10 A;  3HQC A;  1W1D A;  4K2P A;  3VIA A;  5CLL B;  1DBH A;  5DIF B;  1DDM A;  2YT1 A;  4HB4 B;  4KHB B;  3PVU A;  2DX1 A;  1WJM A;  2Y8F A;  2ELB A;  2R0D A;  5DHA B;  2NZ8 B;  1TQZ A;  4K2O A;  3AU5 A;  2J59 M;  1NTY A;  3PSC A;  1NTV A;  4DX8 A;  3BJI A;  3OAN A;  1FGZ A;  5D3X A;  1KZG A;  4Z2M B;  5CLQ B;  3FSS A;  3WA0 A;  2I5F A;  4HB0 B;  5J3Q A;  1WI1 A;  2GCL A;  3G9W A;  3GYP A;  1KZ7 A;  2KCJ A;  5J3T A;  4H8S A;  1XX0 A;  3SO6 A;  2OTX A;  4HAZ B;  3PZD A;  1RRP B;  5HE3 A;  4F7G A;  1N3H A;  2CRF A;  1K5D B;  3DXD A;  4A5K A;  1BWN A;  3TW1 A;  5C6R A;  1OMW A;  1U5D A;  1Y19 B;  2P8V A;  3FM8 C;  5HE2 A;  4ZRJ A;  5KQ1 A;  5D3Y A;  2J0J A;  1UPR A;  2BCJ A;  1W1G A;  2EC1 A;  1V5M A;  4K17 A;  4HB3 B;  2AL6 A;  4K81 A;  4CHJ A;  2DN6 A;  4KHA A;  3SYX A;  2MDX A;  1Z87 A;  2LUL A;  1ZVR A;  5KCV A;  2LOX A;  2MWN B;  2HE7 A;  1ZM0 A;  3GYO A;  2K00 A;  1PMS A;  3CXB B;  3DXE A;  1U5G A;  4CHM A;  1V88 A;  3DXC A;  5LOP B;  5C5B B;  4HAV B;  4DBB A;  2ROZ B;  4BBK A;  5JHG A;  1E5W A;  5C5B A;  2Y7B A;  2DX5 A;  1V89 A;  1X86 A;  4Z2N A;  1XOD A;  1P3R A;  1Q67 A;  1DDV A;  4NY0 A;  2ROV A;  3HK0 A;  4PQ0 A;  4HAU B;  5DHF B;  3TCA A;  2GCJ A;  1UNR A;  4WJ7 A;  1OY2 A;  5JLJ B;  1IRS A;  2D9V A;  1BTN A;  4YON A;  3P7Z A;  1DDW A;  4TKN A;  4HDQ A;  1FHX A;  2I1K A;  4GMV A;  5GOW B;  3P6A A;  1QQG A;  2D2Q A;  3T06 A;  3SNH A;  3KRX A;  1H10 A;  2R09 A;  2D9W A;  1XR0 B;  1V5U A;  2VKI A;  2D9X A;  4C0A A;  3A98 B;  3ODX A;  2DKP A;  3MPX A;  1W1H A;  3ML4 A;  3VOQ A;  1M7E A;  2DYQ A;  2UZS A;  3ULB A;  4GXB A;  2P0D A;  2YSZ A;  1WG7 A;  1UEF A;  3MDB C;  4PNK A;  5FI0 A;  1KI1 B;  4A6F B;  3X23 A;  4HB2 B;  2XQN M;  1MIZ B;  2YS5 A;  4GZU A;  4A6F A;  2CAY A;  1FGY A;  2GJY A;  3SUZ A;  1ZC3 B;  2EJ8 A;  1QC6 A;  5DI9 B;  2RSG A;  1MK7 B;  1OQN A;  4D0N B;  3RCP A;  1DRO A;  2J0K A;  2M14 A;  2PZ1 A;  3HW2 B;  4A6K A;  2LYD A;  1MPH A;  2M38 A;  3TO1 A;  5JP4 A;  2QKM A;  2COD A;  1U5F A;  2D4Q A;  3KY9 A;  1U5E A;  3KZ1 A;  2D9Z A;  3BIN A;  3KSY A;  2VSZ A;  2DLW A;  2MKR A;  4EKU A;  4HAT B;  2DTC A;  4HAY B;  2P0H A;  2X18 A;  1P6S A;  1ZC4 B;  4A6H A;  4HAX B;  1WGU A;  2E2X A;  3M1I B;  1U29 A;  5EFX A;  1FAO A;  1ISN A;  1AQC A;  2J0M A;  1AWE A;  1BAK A;  2CY4 A;  5DH9 B;  1U2B A;  5LON B;  3ZDT A;  4EMO A;  1I2H A;  1UPQ A;  1XCG A;  3PP2 A;  3ULC A;  1TXD A;  5KQ4 A;  2D11 A;  1BTK A;  2RVB B;  3IVF A;  2HTH B;  1MK9 B;  1J0W A;  2V76 A;  4WSF A;  2DFK A;  2L2I A;  3AJ4 A;  4MK0 A;  1K5G B;  2DHI A;  2GS0 A;  3SV1 A;  3N7C A;  3ZVR A;  4NSW A;  1LB1 A;  2W2W A;  3U8Z A;  3UZT A;  5D27 A;  1MKE A;  3A8P A;  3PEG A;  2W2X D;  1WGQ A;  1B55 A;  3LJU X;  2VRW B;  3KRW A;  1EGX A;  5C79 A;  1UNP A;  5HE0 A;  1NU2 A;  1V61 A;  2Z0P A;  2DYN A;  2FJL A;  4GPT B;  1FHW A;  2LKO A;  4IAP A;  3QIJ A;  2W2X C;  1EF1 A;  2UZR A;  4KAX B;  4HAW B;  1SGH A;  2YVC A;  4F7U P;  2IYB A;  4KVG B;  2YRY A;  3D8E A;  4ZRI A;  5HE1 A;  1SHC A;  5C16 A;  3PG7 A;  1TJ6 A;  1GC7 A;  5J3Y A;  1MAI A;  2DA0 A;  2IFS A;  4IFS A;  2COF A;  2N23 A;  1M7R A;  4XWX A;  1WJ1 A;  3A8Q A;  3QBV B;  4IOY X;  2DKQ A;  1FHO A;  2YS3 A;  1XD4 A;  2CY5 A;  1UNQ A;  2KGX B;  2LOZ A;  3AU4 A;  4HHV A;  2QKL A;  2YF0 A;  2YT0 A;  4B6H A;  2AEH A;  1U27 A;  4WVF B;  1FB8 A;  1WVH A;  2H7E A;  1GC6 A;  2H7D A;  1EVH A;  2UVM A;  3TVV A;  2OQB A;  1PLS A;  1Y5O A;  2Z0O A;  2COC A;  4MT7 A;  1RJ2 A;  4DX9 0;  4MY6 A;  1NI2 A;  2D9Y A;  2JP2 A;  2Z0Q A;  2N0Y A;  3PVL A;  2Y8G A;  3WYF B;  4Y94 A;  2ELA A;  1X05 A;  2YS1 A;  4GMX B;  4TYZ A;  5JHH A;  2EMT A;  2P0F A;  3TFM A;  1J19 A;  1P5T A;  3ODW A;  3U7D A;  2ZPY A;  1LW3 A;  3D8F A;  2DHK A;  5D3W A;  3F5R A;  3ODO A; 
#chains in the Genus database with same CATH topology
 4ZRK A;  1ZSQ A;  2NMB A;  3FEH A;  3D8D A;  4DXA B;  4EJN A;  4KHO A;  1H4R A;  1EAZ A;  2RNR B;  1V5P A;  2Q13 A;  3F0W A;  2RGN B;  2RRF A;  4GN1 A;  2MFQ A;  2RLO A;  4HDO A;  4L6E A;  2ADZ A;  3NSU A;  2RUK B;  4YL8 A;  3V5W A;  3O96 A;  1MIX A;  2G35 A;  4P7I A;  2LG1 A;  1X1F A;  5L81 A;  2I5C A;  3FVC A;  2KUP A;  2EMS A;  1FOE A;  4F7H A;  3QWM A;  2I1J A;  3PVW A;  1DYN A;  1X1G A;  3CIK A;  4QXA B;  1X11 A;  5D3V A;  2COA A;  1I7A A;  4CYE A;  2K2J A;  2K2U A;  2L1C A;  1XKE A;  1PFJ A;  2DHJ A;  1GG3 A;  5FI1 A;  2D10 A;  3HQC A;  1W1D A;  4K2P A;  3VIA A;  5CLL B;  1DBH A;  4QJ3 B;  5DIF B;  1DDM A;  2YT1 A;  4HB4 B;  4KHB B;  3PVU A;  2DX1 A;  1WJM A;  2Y8F A;  2ELB A;  2R0D A;  4KHB A;  2KUQ A;  5DHA B;  2NZ8 B;  1TQZ A;  4K2O A;  3AU5 A;  2J59 M;  1NTY A;  3NWD A;  3PSC A;  1NTV A;  4DX8 A;  3BJI A;  3OAN A;  1FGZ A;  5D3X A;  1KZG A;  4Z2M B;  5CLQ B;  3FSS A;  3WA0 A;  2I5F A;  4HB0 B;  5J3Q A;  1T77 A;  1WI1 A;  2GCL A;  3G9W A;  3GYP A;  1KZ7 A;  2KCJ A;  1ZYI A;  4H8S A;  1XX0 A;  3NW8 A;  5J3T A;  3SO6 A;  2OTX A;  4HAZ B;  3PZD A;  1RRP B;  5HE3 A;  4OT1 A;  4F7G A;  1N3H A;  2CRF A;  1K5D B;  3DXD A;  4A5K A;  1BWN A;  3TW1 A;  5C6R A;  1OMW A;  1U5D A;  4QJ4 B;  3U12 A;  1Y19 B;  2P8V A;  3FM8 C;  5HE2 A;  4ZRJ A;  5KQ1 A;  5D3Y A;  2J0J A;  1UPR A;  2BCJ A;  1W1G A;  2EC1 A;  1V5M A;  4K17 A;  4HB3 B;  2AL6 A;  4K81 A;  4CHJ A;  2DN6 A;  4KHA A;  3SYX A;  2MDX A;  1Z87 A;  4DIX A;  2LUL A;  1ZVR A;  5KCV A;  2LOX A;  2MWN B;  2HE7 A;  1ZM0 A;  3GYO A;  2K00 A;  1PMS A;  3CXB B;  3DXE A;  1U5G A;  4CHM A;  1V88 A;  3DXC A;  5LOP B;  5C5B B;  4HAV B;  4DBB A;  2ROZ B;  4BBK A;  2FJU B;  5JHG A;  1E5W A;  5C5B A;  2Y7B A;  2DX5 A;  1V89 A;  1X86 A;  4Z2N A;  1XOD A;  1P3R A;  1Q67 A;  1DDV A;  4NY0 A;  2ROV A;  5LG4 B;  3HK0 A;  4PQ0 A;  4HAU B;  5DHF B;  3TCA A;  2GCJ A;  1UNR A;  2KR0 A;  4WJ7 A;  1OY2 A;  5JLJ B;  1IRS A;  2D9V A;  1BTN A;  4YON A;  3P7Z A;  2Z14 A;  1DDW A;  4TKN A;  4HDQ A;  1FHX A;  2I1K A;  4GMV A;  5GOW B;  3P6A A;  1QQG A;  2D2Q A;  3T06 A;  3SNH A;  4D6W A;  3KRX A;  1H10 A;  5M4Y B;  2R09 A;  2D9W A;  1XR0 B;  1V5U A;  2KIE A;  2VKI A;  3A58 A;  2D9X A;  4C0A A;  3OHM B;  3A98 B;  3ODX A;  2DKP A;  3MPX A;  1W1H A;  3ML4 A;  3VOQ A;  1M7E A;  2DYQ A;  2UZS A;  3ULB A;  4GXB A;  2P0D A;  2YSZ A;  1WG7 A;  1UEF A;  3MDB C;  4PNK A;  5FI0 A;  1KI1 B;  4A6F B;  3X23 A;  4HB2 B;  2XQN M;  1MIZ B;  2YS5 A;  4GNK B;  4GZU A;  2CAY A;  4A6F A;  1FGY A;  2GJY A;  3SUZ A;  1ZC3 B;  2EJ8 A;  1QC6 A;  5DI9 B;  2RSG A;  1MK7 B;  1OQN A;  4D0N B;  3RCP A;  1DRO A;  4L1R A;  2J0K A;  2M14 A;  2PZ1 A;  3HW2 B;  4A6K A;  2LYD A;  1MPH A;  2M38 A;  3TO1 A;  3NWF A;  5JP4 A;  2QKM A;  2COD A;  1U5F A;  2R2Y A;  2D4Q A;  3KY9 A;  2GUM A;  1U5E A;  3KZ1 A;  3NWA A;  3HIE A;  2D9Z A;  3BIN A;  3KSY A;  2VSZ A;  2DLW A;  4OSN A;  2MKR A;  4EKU A;  4HAT B;  2DTC A;  2NBV A;  4HAY B;  2P0H A;  2X18 A;  2ZKM X;  2K8E A;  1P6S A;  1ZC4 B;  4A6H A;  4HAX B;  1WGU A;  2E2X A;  3M1I B;  1U29 A;  5EFX A;  1FAO A;  1ISN A;  1AQC A;  2J0M A;  1AWE A;  1BAK A;  2CY4 A;  5DH9 B;  1U2B A;  3DCX A;  3ZDT A;  4EMO A;  5LON B;  1I2H A;  1UPQ A;  2YT2 A;  1XCG A;  3PP2 A;  3ULC A;  1TXD A;  5KQ4 A;  2D11 A;  1BTK A;  2RVB B;  3IVF A;  2HTH B;  1MK9 B;  1J0W A;  2V76 A;  4WSF A;  2DFK A;  2L2I A;  3AJ4 A;  4MK0 A;  1K5G B;  2DHI A;  2GS0 A;  3SV1 A;  3N7C A;  3ZVR A;  4NSW A;  1LB1 A;  2W2W A;  3U8Z A;  3UZT A;  5D27 A;  1MKE A;  3A8P A;  3PEG A;  2W2X D;  1WGQ A;  1B55 A;  3LJU X;  2VRW B;  3KRW A;  1EGX A;  5C79 A;  4CSQ A;  1UNP A;  2Z4D A;  1NU2 A;  1V61 A;  2Z0P A;  5HE0 A;  2DYN A;  2FJL A;  2K49 A;  2Z59 A;  4GPT B;  1FHW A;  2LKO A;  4IAP A;  3QIJ A;  2W2X C;  1EF1 A;  2UZR A;  4KAX B;  2KIG A;  4HAW B;  1SGH A;  2YVC A;  4F7U P;  2IYB A;  4KVG B;  2YRY A;  3D8E A;  4ZRI A;  5HE1 A;  1SHC A;  5C16 A;  3PG7 A;  1TJ6 A;  1GC7 A;  5J3Y A;  1MAI A;  2DA0 A;  4GOU A;  5I2S A;  2IFS A;  2Z13 A;  4IFS A;  3HSA A;  2COF A;  2N23 A;  1M7R A;  4XWX A;  1WJ1 A;  3A8Q A;  3QBV B;  4IOY X;  2DKQ A;  5I2M A;  5IRS A;  1FHO A;  2YS3 A;  1XD4 A;  2CY5 A;  1UNQ A;  2KGX B;  2LOZ A;  3AU4 A;  4HHV A;  2QKL A;  2YF0 A;  4HSI A;  2YT0 A;  4B6H A;  2AEH A;  1U27 A;  4WVF B;  1FB8 A;  1WVH A;  2H7E A;  1GC6 A;  2H7D A;  1EVH A;  2UVM A;  3TVV A;  2OQB A;  1PLS A;  1Y5O A;  1MI1 A;  2Z0O A;  2COC A;  4MT7 A;  1RJ2 A;  4DX9 0;  4MY6 A;  1NI2 A;  2D9Y A;  2JP2 A;  4QJ5 B;  2Z0Q A;  2N0Y A;  3PVL A;  3B77 A;  2Y8G A;  3WYF B;  4Y94 A;  2ELA A;  1X05 A;  2YS1 A;  4GMX B;  4TYZ A;  5JHH A;  2EMT A;  2P0F A;  3TFM A;  1J19 A;  1P5T A;  3ODW A;  3U7D A;  2ZPY A;  1LW3 A;  3D8F A;  2DHK A;  5D3W A;  3F5R A;  3ODO A; 
#chains in the Genus database with same CATH homology
 4ZRK A;  1ZSQ A;  2NMB A;  3FEH A;  3D8D A;  4DXA B;  4EJN A;  4KHO A;  1H4R A;  1EAZ A;  2RNR B;  1V5P A;  2Q13 A;  3F0W A;  2RGN B;  4GN1 A;  2MFQ A;  2RLO A;  4HDO A;  4L6E A;  2ADZ A;  3NSU A;  2RUK B;  4YL8 A;  3V5W A;  3O96 A;  1MIX A;  2G35 A;  4P7I A;  2LG1 A;  1X1F A;  5L81 A;  2I5C A;  2KUP A;  2EMS A;  1FOE A;  4F7H A;  3QWM A;  2I1J A;  3PVW A;  1DYN A;  1X1G A;  3CIK A;  1X11 A;  5D3V A;  2COA A;  1I7A A;  4CYE A;  2K2J A;  2K2U A;  2L1C A;  1XKE A;  1PFJ A;  2DHJ A;  1GG3 A;  5FI1 A;  2D10 A;  3HQC A;  1W1D A;  4K2P A;  3VIA A;  5CLL B;  1DBH A;  5DIF B;  1DDM A;  2YT1 A;  4HB4 B;  4KHB B;  3PVU A;  2DX1 A;  1WJM A;  2Y8F A;  2ELB A;  2R0D A;  5DHA B;  2NZ8 B;  1TQZ A;  4K2O A;  3AU5 A;  2J59 M;  1NTY A;  3PSC A;  1NTV A;  4DX8 A;  3BJI A;  3OAN A;  1FGZ A;  5D3X A;  1KZG A;  4Z2M B;  5CLQ B;  3FSS A;  3WA0 A;  2I5F A;  4HB0 B;  5J3Q A;  1WI1 A;  2GCL A;  3G9W A;  3GYP A;  1KZ7 A;  2KCJ A;  5J3T A;  4H8S A;  1XX0 A;  3SO6 A;  2OTX A;  4HAZ B;  3PZD A;  1RRP B;  5HE3 A;  4F7G A;  1N3H A;  2CRF A;  1K5D B;  3DXD A;  4A5K A;  1BWN A;  3TW1 A;  5C6R A;  1OMW A;  1U5D A;  1Y19 B;  2P8V A;  3FM8 C;  5HE2 A;  4ZRJ A;  5KQ1 A;  5D3Y A;  2J0J A;  1UPR A;  2BCJ A;  1W1G A;  2EC1 A;  1V5M A;  4K17 A;  4HB3 B;  2AL6 A;  4K81 A;  4CHJ A;  2DN6 A;  4KHA A;  3SYX A;  2MDX A;  1Z87 A;  2LUL A;  1ZVR A;  5KCV A;  2LOX A;  2MWN B;  2HE7 A;  1ZM0 A;  3GYO A;  2K00 A;  1PMS A;  3CXB B;  3DXE A;  1U5G A;  4CHM A;  1V88 A;  3DXC A;  5LOP B;  5C5B B;  4HAV B;  4DBB A;  2ROZ B;  4BBK A;  5JHG A;  1E5W A;  5C5B A;  2Y7B A;  2DX5 A;  1V89 A;  1X86 A;  4Z2N A;  1XOD A;  1P3R A;  1Q67 A;  1DDV A;  4NY0 A;  2ROV A;  3HK0 A;  4PQ0 A;  4HAU B;  5DHF B;  3TCA A;  2GCJ A;  1UNR A;  4WJ7 A;  1OY2 A;  5JLJ B;  1IRS A;  2D9V A;  1BTN A;  4YON A;  3P7Z A;  1DDW A;  4TKN A;  4HDQ A;  1FHX A;  2I1K A;  4GMV A;  5GOW B;  3P6A A;  1QQG A;  2D2Q A;  3T06 A;  3SNH A;  3KRX A;  1H10 A;  2R09 A;  2D9W A;  1XR0 B;  1V5U A;  2VKI A;  2D9X A;  4C0A A;  3A98 B;  3ODX A;  2DKP A;  3MPX A;  1W1H A;  3ML4 A;  3VOQ A;  1M7E A;  2DYQ A;  2UZS A;  3ULB A;  4GXB A;  2P0D A;  2YSZ A;  1WG7 A;  1UEF A;  3MDB C;  4PNK A;  5FI0 A;  1KI1 B;  4A6F B;  3X23 A;  4HB2 B;  2XQN M;  1MIZ B;  2YS5 A;  4GZU A;  4A6F A;  2CAY A;  1FGY A;  2GJY A;  3SUZ A;  1ZC3 B;  2EJ8 A;  1QC6 A;  5DI9 B;  2RSG A;  1MK7 B;  1OQN A;  4D0N B;  3RCP A;  1DRO A;  2J0K A;  2M14 A;  2PZ1 A;  3HW2 B;  4A6K A;  2LYD A;  1MPH A;  2M38 A;  3TO1 A;  5JP4 A;  2QKM A;  2COD A;  1U5F A;  2D4Q A;  3KY9 A;  1U5E A;  3KZ1 A;  2D9Z A;  3BIN A;  3KSY A;  2VSZ A;  2DLW A;  2MKR A;  4EKU A;  4HAT B;  2DTC A;  4HAY B;  2P0H A;  2X18 A;  1P6S A;  1ZC4 B;  4A6H A;  4HAX B;  1WGU A;  2E2X A;  3M1I B;  1U29 A;  5EFX A;  1FAO A;  1ISN A;  1AQC A;  2J0M A;  1AWE A;  1BAK A;  2CY4 A;  5DH9 B;  1U2B A;  5LON B;  3ZDT A;  4EMO A;  1I2H A;  1UPQ A;  1XCG A;  3PP2 A;  3ULC A;  1TXD A;  5KQ4 A;  2D11 A;  1BTK A;  2RVB B;  3IVF A;  2HTH B;  1MK9 B;  1J0W A;  2V76 A;  4WSF A;  2DFK A;  2L2I A;  3AJ4 A;  4MK0 A;  1K5G B;  2DHI A;  2GS0 A;  3SV1 A;  3N7C A;  3ZVR A;  4NSW A;  1LB1 A;  2W2W A;  3U8Z A;  3UZT A;  5D27 A;  1MKE A;  3A8P A;  3PEG A;  2W2X D;  1WGQ A;  1B55 A;  3LJU X;  2VRW B;  3KRW A;  1EGX A;  5C79 A;  1UNP A;  5HE0 A;  1NU2 A;  1V61 A;  2Z0P A;  2DYN A;  2FJL A;  4GPT B;  1FHW A;  2LKO A;  4IAP A;  3QIJ A;  2W2X C;  1EF1 A;  2UZR A;  4KAX B;  4HAW B;  1SGH A;  2YVC A;  4F7U P;  2IYB A;  4KVG B;  2YRY A;  3D8E A;  4ZRI A;  5HE1 A;  1SHC A;  5C16 A;  3PG7 A;  1TJ6 A;  1GC7 A;  5J3Y A;  1MAI A;  2DA0 A;  2IFS A;  4IFS A;  2COF A;  2N23 A;  1M7R A;  4XWX A;  1WJ1 A;  3A8Q A;  3QBV B;  4IOY X;  2DKQ A;  1FHO A;  2YS3 A;  1XD4 A;  2CY5 A;  1UNQ A;  2KGX B;  2LOZ A;  3AU4 A;  4HHV A;  2QKL A;  2YF0 A;  2YT0 A;  4B6H A;  2AEH A;  1U27 A;  4WVF B;  1FB8 A;  1WVH A;  2H7E A;  1GC6 A;  2H7D A;  1EVH A;  2UVM A;  3TVV A;  2OQB A;  1PLS A;  1Y5O A;  2Z0O A;  2COC A;  4MT7 A;  1RJ2 A;  4DX9 0;  4MY6 A;  1NI2 A;  2D9Y A;  2JP2 A;  2Z0Q A;  2N0Y A;  3PVL A;  2Y8G A;  3WYF B;  4Y94 A;  2ELA A;  1X05 A;  2YS1 A;  4GMX B;  4TYZ A;  5JHH A;  2EMT A;  2P0F A;  3TFM A;  1J19 A;  1P5T A;  3ODW A;  3U7D A;  2ZPY A;  1LW3 A;  3D8F A;  2DHK A;  5D3W A;  3F5R A;  3ODO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...