1P6SA

Solution structure of the pleckstrin homology domain of human protein kinase b beta (pkb/akt)
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
111
structure length
111
Chain Sequence
MNEVSVIKEGWLHKRGEYIKTWRPRYFLLKSDGSFIGYKERPEAPDQTLPPLNNFSVAECQLMKTERPRPNTFVIRCLQWTTVIERTFHVDSPDEREEWMRAIQMVANSLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure and backbone dynamics of the pleckstrin homology domain of the human protein kinase B (PKB/Akt). Interaction with inositol phosphates.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords RAC-beta serine/threonine protein kinase
total genus 17
structure length 111
sequence length 111
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2003-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1p6sA00
2N23A 3F0WA 2D10A 2H7DA 2L1CA 4DX90 5D3XA 1MKEA 2IFSA 1WGUA 3V5WA 2GS0A 1J0WA 1ZC3B 4YL8A 2FJLA 2EC1A 4Y94A 2M38A 3KSYA 1GC6A 1EGXA 3G9WA 5DI9B 4WSFA 4KHAA 3D8EA 2OTXA 1KZGA 2DFKA 1RRPB 1FB8A 3FSSA 3HK0A 1NI2A 1TJ6A 1U5EA 2AL6A 1EAZA 1GC7A 3AU4A 1XR0B 3HQCA 1FAOA 3PSCA 1LB1A 4A6KA 2IYBA 1Y5OA 4WJ7A 3VIAA 2J59M 4EJNA 2RVBB 5DHFB 5JLJB 2KCJA 2Y7BA 3U7DA 3RCPA 3A8QA 1B55A 4A6FB 1V5PA 2OQBA 2RNRB 2MWNB 2HE7A 4CYEA 2UZRA 1BTKA 2J0MA 4A6HA 5CLLB 2XQNM 4HATB 1MK9B 3SYXA 1H10A 1ZM0A 3PVLA 2K2JA 5EFXA 1WVHA 2D11A 2DN6A 4GN1A 5J3YA 4HAYB 4Z2NA 2BCJA 2LG1A 1XX0A 2LULA 4HB0B 1ISNA 5JP4A 3O96A 1AQCA 2RUKB 3HW2B 1V88A 4DX8A 1NTVA 1E5WA 1SGHA 1UPRA 1FGYA 2D9VA 2Z0QA 3PEGA 1FGZA 4XWXA 1WG7A 2W2XC 2YVCA 4KVGB 2YS5A 1QC6A 3TCAA 4HAUB 4CHMA 1WI1A 3D8DA 4ZRJA 1ZC4B 2I1JA 4B6HA 4WVFB 3BJIA 3WYFB 2MDXA 2ZPYA 2YRYA 2YS3A 2YS1A 3FM8C 5DH9B 1OQNA 3VOQA 3ULCA 5D3YA 4F7GA 3CIKA 4YONA 1V61A 3WA0A 3IVFA 5JHGA 1UNRA 2LKOA 3BINA 4NY0A 2GJYA 2ELBA 1FHWA 5L81A 4GZUA 2YT1A 2COFA 5J3QA 5FI1A 1BTNA 3A8PA 1W1HA 5HE3A 1X86A 1DDWA 2CAYA 2NZ8B 1ZSQA 1DDMA 3PVUA 2CODA 3T06A 5D3WA 1PMSA 3ODWA 5GOWB 4H8SA 2MFQA 3ZDTA 2X18A 1XODA 4HAVB 4PQ0A 1P6SA 2K2UA 4HHVA 4L6EA 1P3RA 1TQZA 5HE2A 1EVHA 3DXDA 3QBVB 1XCGA 2H7EA 3PG7A 1N3HA 2L2IA 2QKLA 4KHOA 2Z0OA 2DX1A 3D8FA 2GCLA 2DHIA 3UZTA 1WJMA 1NU2A 2P0HA 1EF1A 3PVWA 1UEFA 2KUPA 3KRXA 4GXBA 2E2XA 1UPQA 5LONB 3PZDA 2CY4A 3FEHA 2P0FA 1I7AA 2HTHB 4F7HA 2D9WA 2J0KA 2YSZA 2I5CA 2EMTA 3MDBC 2VRWB 1H4RA 2YF0A 2ELAA 2G35A 1U5DA 3A98B 2M14A 3N7CA 2COCA 3U8ZA 4HB2B 4D0NB 1BAKA 2UVMA 1GG3A 4HAXB 2D9ZA 3GYPA 3TO1A 4NSWA 2EJ8A 4TYZA 4PNKA 3KY9A 2DHJA 4K17A 4MK0A 3ULBA 5C5BB 1W1GA 5C6RA 1TXDA 3SNHA 4HB4B 5KQ1A 2DLWA 2CY5A 5HE1A 2PZ1A 4BBKA 1V5MA 4MT7A 1KI1B 2D9XA 3PP2A 3MPXA 2DKQA 3AJ4A 4HDOA 3AU5A 2V76A 4ZRIA 1FHOA 5FI0A 1Z87A 3F5RA 5KCVA 1XKEA 1NTYA 1WGQA 5DHAB 5KQ4A 2DKPA 2KGXB 1V5UA 2R0DA 1BWNA 2RGNB 3QWMA 2N0YA 1WJ1A 1MPHA 2Y8GA 1MIXA 1X05A 1DBHA 4C0AA 5DIFB 3NSUA 1K5GB 2YT0A 4F7UP 1U27A 2QKMA 4MY6A 1DYNA 1DDVA 4K81A 1PFJA 1OY2A 4EKUA 1X1GA 2Q13A 2W2WA 4GPTB 4GMXB 3OANA 4A5KA 1KZ7A 2D4QA 1FOEA 2Z0PA 5D27A 1QQGA 2DA0A 2VKIA 1K5DB 2EMSA 2DX5A 1OMWA 2D2QA 4K2OA 2I1KA 1U2BA 4HDQA 4IFSA 2DHKA 1U29A 4DBBA 1U5FA 3TFMA 5C79A 2W2XD 3LJUX 2NMBA 3TW1A 5J3TA 5HE0A 5C16A 5D3VA 1UNQA 2Y8FA 2DTCA 1Y19B 2ROZB 3DXEA 4Z2MB 1MK7B 3GYOA 4HAWB 2I5FA 2COAA 1P5TA 1X11A 4IAPA 1X1FA 2MKRA 3M1IB 4DXAB 2GCJA 2R09A 4P7IA 1UNPA 3ML4A 1J19A 1U5GA 3KRWA 2ROVA 5C5BA 4EMOA 3QIJA 4CHJA 2P8VA 1MIZB 2P0DA 3ODXA 1MAIA 1DROA 1IRSA 2DYQA 4HB3B 2AEHA 2CRFA 3KZ1A 4K2PA 3SO6A 4ZRKA 4IOYX 2ADZA 4GMVA 3CXBB 3ODOA 1PLSA 5JHHA 4TKNA 3SV1A 1Q67A 3X23A 1FHXA 1I2HA 2UZSA 5CLQB 3SUZA 3DXCA 1ZVRA 2LOZA 1SHCA 2JP2A 4HAZB 4KHBB 1XD4A 5LOPB 2RLOA 1AWEA 2J0JA 2DYNA 2D9YA 1W1DA 4KAXB 1M7RA 1V89A 3TVVA 4A6FA 1RJ2A 2VSZA 1M7EA 2RSGA 2K00A 3P7ZA 2LOXA 3P6AA 1LW3A 3ZVRA 2LYDA
chains in the Genus database with same CATH superfamily
2N23A 3F0WA 2D10A 2H7DA 2L1CA 2FJUB 4DX90 5D3XA 1MKEA 2IFSA 1WGUA 3V5WA 2GS0A 1J0WA 1ZC3B 4YL8A 2FJLA 2EC1A 4Y94A 2M38A 3KSYA 1GC6A 1EGXA 3G9WA 5DI9B 4WSFA 4KHAA 3D8EA 2OTXA 1KZGA 3NWDA 2DFKA 1RRPB 1FB8A 3FSSA 3HK0A 1NI2A 1TJ6A 1U5EA 2AL6A 2Z59A 1EAZA 1GC7A 3AU4A 1XR0B 3HQCA 1FAOA 3PSCA 1LB1A 4A6KA 2IYBA 1Y5OA 4WJ7A 3VIAA 2J59M 4EJNA 2RVBB 5DHFB 5JLJB 2KCJA 2R2YA 2Y7BA 3RCPA 3U7DA 3A8QA 1B55A 1MI1A 4A6FB 1V5PA 2OQBA 2RNRB 2MWNB 4GNKB 2HE7A 4CYEA 2UZRA 1BTKA 2J0MA 4A6HA 5CLLB 2XQNM 4HATB 1MK9B 3SYXA 1H10A 1ZM0A 3PVLA 2K2JA 5EFXA 1WVHA 2D11A 2DN6A 4GN1A 5J3YA 4HAYB 4Z2NA 2BCJA 2LG1A 1XX0A 2LULA 4HB0B 1ISNA 5JP4A 3O96A 1AQCA 3U12A 2RUKB 3HW2B 1V88A 4DX8A 1NTVA 1E5WA 2KUQA 1SGHA 1UPRA 2Z4DA 1FGYA 3FVCA 2D9VA 2Z0QA 3PEGA 1FGZA 4XWXA 1WG7A 4CSQA 2W2XC 2YVCA 4KVGB 4GOUA 2YS5A 1QC6A 3TCAA 4HAUB 4CHMA 1WI1A 3D8DA 4ZRJA 1ZC4B 2I1JA 4B6HA 4WVFB 2Z13A 3BJIA 3WYFB 2MDXA 2ZPYA 2YRYA 2YS3A 2YS1A 3FM8C 5DH9B 1OQNA 2ZKMX 3VOQA 3ULCA 5D3YA 4F7GA 3CIKA 4YONA 1V61A 3WA0A 3IVFA 5JHGA 1UNRA 2LKOA 3BINA 4QXAB 4NY0A 2GJYA 2ELBA 1FHWA 4QJ5B 5L81A 4GZUA 2YT1A 5M4YB 2COFA 5J3QA 5FI1A 1BTNA 3A8PA 1W1HA 5HE3A 1X86A 2Z14A 1DDWA 2CAYA 2NZ8B 5I2MA 1ZSQA 1DDMA 2RRFA 3PVUA 2CODA 3T06A 5D3WA 1PMSA 4DIXA 3ODWA 5GOWB 4H8SA 2MFQA 3ZDTA 2X18A 1XODA 4HAVB 4PQ0A 1P6SA 2K2UA 4HHVA 4L6EA 1P3RA 1TQZA 5HE2A 1EVHA 4OSNA 3DXDA 3QBVB 1XCGA 2H7EA 3PG7A 1N3HA 2L2IA 2QKLA 4KHOA 2Z0OA 2DX1A 3D8FA 2GCLA 2DHIA 3UZTA 1WJMA 1NU2A 2P0HA 1EF1A 3PVWA 1UEFA 2KUPA 3KRXA 4GXBA 4D6WA 2KIEA 2E2XA 1UPQA 5LONB 3PZDA 2CY4A 3FEHA 2P0FA 3NW8A 1I7AA 2HTHB 4F7HA 2D9WA 2J0KA 2YSZA 2I5CA 2EMTA 4QJ3B 3MDBC 2VRWB 1H4RA 2YF0A 2ELAA 2G35A 1U5DA 3A98B 2M14A 3N7CA 2COCA 3U8ZA 4HB2B 4D0NB 1BAKA 2UVMA 1GG3A 4HAXB 2D9ZA 3GYPA 3TO1A 4NSWA 2EJ8A 4TYZA 4PNKA 2KIGA 3KY9A 2DHJA 4K17A 4MK0A 3ULBA 5C5BB 1W1GA 5C6RA 1TXDA 3SNHA 4HB4B 5KQ1A 2DLWA 5LG4B 2CY5A 5HE1A 2PZ1A 4BBKA 1V5MA 4MT7A 1KI1B 2D9XA 3PP2A 3MPXA 2DKQA 3AJ4A 4HDOA 3AU5A 2V76A 4ZRIA 1FHOA 5FI0A 3DCXA 1Z87A 3F5RA 5KCVA 1XKEA 1NTYA 1WGQA 5DHAB 5KQ4A 2DKPA 2KGXB 1V5UA 2R0DA 1BWNA 2RGNB 3HSAA 3QWMA 2N0YA 1WJ1A 1MPHA 4KHBA 2Y8GA 4QJ4B 1MIXA 5IRSA 1X05A 1T77A 1DBHA 4C0AA 5DIFB 3NSUA 1K5GB 2YT0A 4F7UP 4L1RA 1U27A 2QKMA 4MY6A 1DYNA 1DDVA 4K81A 1PFJA 1OY2A 2GUMA 4EKUA 1X1GA 2Q13A 2W2WA 4GPTB 4GMXB 3OANA 4A5KA 1KZ7A 2D4QA 1FOEA 2Z0PA 5D27A 1QQGA 2DA0A 2VKIA 1K5DB 2EMSA 2DX5A 2NBVA 1OMWA 1ZYIA 2D2QA 4K2OA 2I1KA 1U2BA 4HDQA 4IFSA 3A58A 2DHKA 2KR0A 1U29A 4DBBA 1U5FA 3TFMA 5C79A 2W2XD 3LJUX 2NMBA 3TW1A 5J3TA 5HE0A 5C16A 5D3VA 1UNQA 2Y8FA 2DTCA 1Y19B 2ROZB 3DXEA 4Z2MB 1MK7B 3GYOA 4HAWB 2I5FA 2COAA 1P5TA 5I2SA 1X11A 4IAPA 1X1FA 2MKRA 3M1IB 4DXAB 2GCJA 2R09A 4P7IA 1UNPA 3ML4A 1J19A 1U5GA 3KRWA 2ROVA 5C5BA 4EMOA 3QIJA 4CHJA 2P8VA 1MIZB 2P0DA 3ODXA 1MAIA 1DROA 1IRSA 2DYQA 4HB3B 2AEHA 2CRFA 2K49A 3KZ1A 4K2PA 3NWFA 3SO6A 4ZRKA 4IOYX 2ADZA 3B77A 4GMVA 3HIEA 3CXBB 3ODOA 1PLSA 5JHHA 4TKNA 3SV1A 1Q67A 4HSIA 3X23A 1FHXA 3NWAA 1I2HA 2UZSA 2YT2A 5CLQB 2K8EA 3SUZA 3DXCA 1ZVRA 2LOZA 1SHCA 2JP2A 4HAZB 4OT1A 4KHBB 1XD4A 3OHMB 5LOPB 2RLOA 1AWEA 2J0JA 2DYNA 2D9YA 1W1DA 4KAXB 1M7RA 1V89A 3TVVA 4A6FA 1RJ2A 2VSZA 1M7EA 2RSGA 2K00A 3P7ZA 2LOXA 3P6AA 1LW3A 3ZVRA 2LYDA
chains in the Genus database with same CATH topology
2N23A 3F0WA 2D10A 2H7DA 2L1CA 4DX90 5D3XA 1MKEA 2IFSA 1WGUA 3V5WA 2GS0A 1J0WA 1ZC3B 4YL8A 2FJLA 2EC1A 4Y94A 2M38A 3KSYA 1GC6A 1EGXA 3G9WA 5DI9B 4WSFA 4KHAA 3D8EA 2OTXA 1KZGA 2DFKA 1RRPB 1FB8A 3FSSA 3HK0A 1NI2A 1TJ6A 1U5EA 2AL6A 1EAZA 1GC7A 3AU4A 1XR0B 3HQCA 1FAOA 3PSCA 1LB1A 4A6KA 2IYBA 1Y5OA 4WJ7A 3VIAA 2J59M 4EJNA 2RVBB 5DHFB 5JLJB 2KCJA 2Y7BA 3U7DA 3RCPA 3A8QA 1B55A 4A6FB 1V5PA 2OQBA 2RNRB 2MWNB 2HE7A 4CYEA 2UZRA 1BTKA 2J0MA 4A6HA 5CLLB 2XQNM 4HATB 1MK9B 3SYXA 1H10A 1ZM0A 3PVLA 2K2JA 5EFXA 1WVHA 2D11A 2DN6A 4GN1A 5J3YA 4HAYB 4Z2NA 2BCJA 2LG1A 1XX0A 2LULA 4HB0B 1ISNA 5JP4A 3O96A 1AQCA 2RUKB 3HW2B 1V88A 4DX8A 1NTVA 1E5WA 1SGHA 1UPRA 1FGYA 2D9VA 2Z0QA 3PEGA 1FGZA 4XWXA 1WG7A 2W2XC 2YVCA 4KVGB 2YS5A 1QC6A 3TCAA 4HAUB 4CHMA 1WI1A 3D8DA 4ZRJA 1ZC4B 2I1JA 4B6HA 4WVFB 3BJIA 3WYFB 2MDXA 2ZPYA 2YRYA 2YS3A 2YS1A 3FM8C 5DH9B 1OQNA 3VOQA 3ULCA 5D3YA 4F7GA 3CIKA 4YONA 1V61A 3WA0A 3IVFA 5JHGA 1UNRA 2LKOA 3BINA 4NY0A 2GJYA 2ELBA 1FHWA 5L81A 4GZUA 2YT1A 2COFA 5J3QA 5FI1A 1BTNA 3A8PA 1W1HA 5HE3A 1X86A 1DDWA 2CAYA 2NZ8B 1ZSQA 1DDMA 3PVUA 2CODA 3T06A 5D3WA 1PMSA 3ODWA 5GOWB 4H8SA 2MFQA 3ZDTA 2X18A 1XODA 4HAVB 4PQ0A 1P6SA 2K2UA 4HHVA 4L6EA 1P3RA 1TQZA 5HE2A 1EVHA 3DXDA 3QBVB 1XCGA 2H7EA 3PG7A 1N3HA 2L2IA 2QKLA 4KHOA 2Z0OA 2DX1A 3D8FA 2GCLA 2DHIA 3UZTA 1WJMA 1NU2A 2P0HA 1EF1A 3PVWA 1UEFA 2KUPA 3KRXA 4GXBA 2E2XA 1UPQA 5LONB 3PZDA 2CY4A 3FEHA 2P0FA 1I7AA 2HTHB 4F7HA 2D9WA 2J0KA 2YSZA 2I5CA 2EMTA 3MDBC 2VRWB 1H4RA 2YF0A 2ELAA 2G35A 1U5DA 3A98B 2M14A 3N7CA 2COCA 3U8ZA 4HB2B 4D0NB 1BAKA 2UVMA 1GG3A 4HAXB 2D9ZA 3GYPA 3TO1A 4NSWA 2EJ8A 4TYZA 4PNKA 3KY9A 2DHJA 4K17A 4MK0A 3ULBA 5C5BB 1W1GA 5C6RA 1TXDA 3SNHA 4HB4B 5KQ1A 2DLWA 2CY5A 5HE1A 2PZ1A 4BBKA 1V5MA 4MT7A 1KI1B 2D9XA 3PP2A 3MPXA 2DKQA 3AJ4A 4HDOA 3AU5A 2V76A 4ZRIA 1FHOA 5FI0A 1Z87A 3F5RA 5KCVA 1XKEA 1NTYA 1WGQA 5DHAB 5KQ4A 2DKPA 2KGXB 1V5UA 2R0DA 1BWNA 2RGNB 3QWMA 2N0YA 1WJ1A 1MPHA 2Y8GA 1MIXA 1X05A 1DBHA 4C0AA 5DIFB 3NSUA 1K5GB 2YT0A 4F7UP 1U27A 2QKMA 4MY6A 1DYNA 1DDVA 4K81A 1PFJA 1OY2A 4EKUA 1X1GA 2Q13A 2W2WA 4GPTB 4GMXB 3OANA 4A5KA 1KZ7A 2D4QA 1FOEA 2Z0PA 5D27A 1QQGA 2DA0A 2VKIA 1K5DB 2EMSA 2DX5A 1OMWA 2D2QA 4K2OA 2I1KA 1U2BA 4HDQA 4IFSA 2DHKA 1U29A 4DBBA 1U5FA 3TFMA 5C79A 2W2XD 3LJUX 2NMBA 3TW1A 5J3TA 5HE0A 5C16A 5D3VA 1UNQA 2Y8FA 2DTCA 1Y19B 2ROZB 3DXEA 4Z2MB 1MK7B 3GYOA 4HAWB 2I5FA 2COAA 1P5TA 1X11A 4IAPA 1X1FA 2MKRA 3M1IB 4DXAB 2GCJA 2R09A 4P7IA 1UNPA 3ML4A 1J19A 1U5GA 3KRWA 2ROVA 5C5BA 4EMOA 3QIJA 4CHJA 2P8VA 1MIZB 2P0DA 3ODXA 1MAIA 1DROA 1IRSA 2DYQA 4HB3B 2AEHA 2CRFA 3KZ1A 4K2PA 3SO6A 4ZRKA 4IOYX 2ADZA 4GMVA 3CXBB 3ODOA 1PLSA 5JHHA 4TKNA 3SV1A 1Q67A 3X23A 1FHXA 1I2HA 2UZSA 5CLQB 3SUZA 3DXCA 1ZVRA 2LOZA 1SHCA 2JP2A 4HAZB 4KHBB 1XD4A 5LOPB 2RLOA 1AWEA 2J0JA 2DYNA 2D9YA 1W1DA 4KAXB 1M7RA 1V89A 3TVVA 4A6FA 1RJ2A 2VSZA 1M7EA 2RSGA 2K00A 3P7ZA 2LOXA 3P6AA 1LW3A 3ZVRA 2LYDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2N23 A;  3F0W A;  2D10 A;  2H7D A;  2L1C A;  4DX9 0;  5D3X A;  1MKE A;  2IFS A;  1WGU A;  3V5W A;  2GS0 A;  1J0W A;  1ZC3 B;  4YL8 A;  2FJL A;  2EC1 A;  4Y94 A;  2M38 A;  3KSY A;  1GC6 A;  1EGX A;  3G9W A;  5DI9 B;  4WSF A;  4KHA A;  3D8E A;  2OTX A;  1KZG A;  2DFK A;  1RRP B;  1FB8 A;  3FSS A;  3HK0 A;  1NI2 A;  1TJ6 A;  1U5E A;  2AL6 A;  1EAZ A;  1GC7 A;  3AU4 A;  1XR0 B;  3HQC A;  1FAO A;  3PSC A;  1LB1 A;  4A6K A;  2IYB A;  1Y5O A;  4WJ7 A;  3VIA A;  2J59 M;  4EJN A;  2RVB B;  5DHF B;  5JLJ B;  2KCJ A;  2Y7B A;  3U7D A;  3RCP A;  3A8Q A;  1B55 A;  4A6F B;  1V5P A;  2OQB A;  2RNR B;  2MWN B;  2HE7 A;  4CYE A;  2UZR A;  1BTK A;  2J0M A;  4A6H A;  5CLL B;  2XQN M;  4HAT B;  1MK9 B;  3SYX A;  1H10 A;  1ZM0 A;  3PVL A;  2K2J A;  5EFX A;  1WVH A;  2D11 A;  2DN6 A;  4GN1 A;  5J3Y A;  4HAY B;  4Z2N A;  2BCJ A;  2LG1 A;  1XX0 A;  2LUL A;  4HB0 B;  1ISN A;  5JP4 A;  3O96 A;  1AQC A;  2RUK B;  3HW2 B;  1V88 A;  4DX8 A;  1NTV A;  1E5W A;  1SGH A;  1UPR A;  1FGY A;  2D9V A;  2Z0Q A;  3PEG A;  1FGZ A;  4XWX A;  1WG7 A;  2W2X C;  2YVC A;  4KVG B;  2YS5 A;  1QC6 A;  3TCA A;  4HAU B;  4CHM A;  1WI1 A;  3D8D A;  4ZRJ A;  1ZC4 B;  2I1J A;  4B6H A;  4WVF B;  3BJI A;  3WYF B;  2MDX A;  2ZPY A;  2YRY A;  2YS3 A;  2YS1 A;  3FM8 C;  5DH9 B;  1OQN A;  3VOQ A;  3ULC A;  5D3Y A;  4F7G A;  3CIK A;  4YON A;  1V61 A;  3WA0 A;  3IVF A;  5JHG A;  1UNR A;  2LKO A;  3BIN A;  4NY0 A;  2GJY A;  2ELB A;  1FHW A;  5L81 A;  4GZU A;  2YT1 A;  2COF A;  5J3Q A;  5FI1 A;  1BTN A;  3A8P A;  1W1H A;  5HE3 A;  1X86 A;  1DDW A;  2CAY A;  2NZ8 B;  1ZSQ A;  1DDM A;  3PVU A;  2COD A;  3T06 A;  5D3W A;  1PMS A;  3ODW A;  5GOW B;  4H8S A;  2MFQ A;  3ZDT A;  2X18 A;  1XOD A;  4HAV B;  4PQ0 A;  1P6S A;  2K2U A;  4HHV A;  4L6E A;  1P3R A;  1TQZ A;  5HE2 A;  1EVH A;  3DXD A;  3QBV B;  1XCG A;  2H7E A;  3PG7 A;  1N3H A;  2L2I A;  2QKL A;  4KHO A;  2Z0O A;  2DX1 A;  3D8F A;  2GCL A;  2DHI A;  3UZT A;  1WJM A;  1NU2 A;  2P0H A;  1EF1 A;  3PVW A;  1UEF A;  2KUP A;  3KRX A;  4GXB A;  2E2X A;  1UPQ A;  5LON B;  3PZD A;  2CY4 A;  3FEH A;  2P0F A;  1I7A A;  2HTH B;  4F7H A;  2D9W A;  2J0K A;  2YSZ A;  2I5C A;  2EMT A;  3MDB C;  2VRW B;  1H4R A;  2YF0 A;  2ELA A;  2G35 A;  1U5D A;  3A98 B;  2M14 A;  3N7C A;  2COC A;  3U8Z A;  4HB2 B;  4D0N B;  1BAK A;  2UVM A;  1GG3 A;  4HAX B;  2D9Z A;  3GYP A;  3TO1 A;  4NSW A;  2EJ8 A;  4TYZ A;  4PNK A;  3KY9 A;  2DHJ A;  4K17 A;  4MK0 A;  3ULB A;  5C5B B;  1W1G A;  5C6R A;  1TXD A;  3SNH A;  4HB4 B;  5KQ1 A;  2DLW A;  2CY5 A;  5HE1 A;  2PZ1 A;  4BBK A;  1V5M A;  4MT7 A;  1KI1 B;  2D9X A;  3PP2 A;  3MPX A;  2DKQ A;  3AJ4 A;  4HDO A;  3AU5 A;  2V76 A;  4ZRI A;  1FHO A;  5FI0 A;  1Z87 A;  3F5R A;  5KCV A;  1XKE A;  1NTY A;  1WGQ A;  5DHA B;  5KQ4 A;  2DKP A;  2KGX B;  1V5U A;  2R0D A;  1BWN A;  2RGN B;  3QWM A;  2N0Y A;  1WJ1 A;  1MPH A;  2Y8G A;  1MIX A;  1X05 A;  1DBH A;  4C0A A;  5DIF B;  3NSU A;  1K5G B;  2YT0 A;  4F7U P;  1U27 A;  2QKM A;  4MY6 A;  1DYN A;  1DDV A;  4K81 A;  1PFJ A;  1OY2 A;  4EKU A;  1X1G A;  2Q13 A;  2W2W A;  4GPT B;  4GMX B;  3OAN A;  4A5K A;  1KZ7 A;  2D4Q A;  1FOE A;  2Z0P A;  5D27 A;  1QQG A;  2DA0 A;  2VKI A;  1K5D B;  2EMS A;  2DX5 A;  1OMW A;  2D2Q A;  4K2O A;  2I1K A;  1U2B A;  4HDQ A;  4IFS A;  2DHK A;  1U29 A;  4DBB A;  1U5F A;  3TFM A;  5C79 A;  2W2X D;  3LJU X;  2NMB A;  3TW1 A;  5J3T A;  5HE0 A;  5C16 A;  5D3V A;  1UNQ A;  2Y8F A;  2DTC A;  1Y19 B;  2ROZ B;  3DXE A;  4Z2M B;  1MK7 B;  3GYO A;  4HAW B;  2I5F A;  2COA A;  1P5T A;  1X11 A;  4IAP A;  1X1F A;  2MKR A;  3M1I B;  4DXA B;  2GCJ A;  2R09 A;  4P7I A;  1UNP A;  3ML4 A;  1J19 A;  1U5G A;  3KRW A;  2ROV A;  5C5B A;  4EMO A;  3QIJ A;  4CHJ A;  2P8V A;  1MIZ B;  2P0D A;  3ODX A;  1MAI A;  1DRO A;  1IRS A;  2DYQ A;  4HB3 B;  2AEH A;  2CRF A;  3KZ1 A;  4K2P A;  3SO6 A;  4ZRK A;  4IOY X;  2ADZ A;  4GMV A;  3CXB B;  3ODO A;  1PLS A;  5JHH A;  4TKN A;  3SV1 A;  1Q67 A;  3X23 A;  1FHX A;  1I2H A;  2UZS A;  5CLQ B;  3SUZ A;  3DXC A;  1ZVR A;  2LOZ A;  1SHC A;  2JP2 A;  4HAZ B;  4KHB B;  1XD4 A;  5LOP B;  2RLO A;  1AWE A;  2J0J A;  2DYN A;  2D9Y A;  1W1D A;  4KAX B;  1M7R A;  1V89 A;  3TVV A;  4A6F A;  1RJ2 A;  2VSZ A;  1M7E A;  2RSG A;  2K00 A;  3P7Z A;  2LOX A;  3P6A A;  1LW3 A;  3ZVR A;  2LYD A; 
#chains in the Genus database with same CATH topology
 2N23 A;  3F0W A;  2D10 A;  2H7D A;  2L1C A;  2FJU B;  4DX9 0;  5D3X A;  1MKE A;  2IFS A;  1WGU A;  3V5W A;  2GS0 A;  1J0W A;  1ZC3 B;  4YL8 A;  2FJL A;  2EC1 A;  4Y94 A;  2M38 A;  3KSY A;  1GC6 A;  1EGX A;  3G9W A;  5DI9 B;  4WSF A;  4KHA A;  3D8E A;  2OTX A;  1KZG A;  3NWD A;  2DFK A;  1RRP B;  1FB8 A;  3FSS A;  3HK0 A;  1NI2 A;  1TJ6 A;  1U5E A;  2AL6 A;  2Z59 A;  1EAZ A;  1GC7 A;  3AU4 A;  1XR0 B;  3HQC A;  1FAO A;  3PSC A;  1LB1 A;  4A6K A;  2IYB A;  1Y5O A;  4WJ7 A;  3VIA A;  2J59 M;  4EJN A;  2RVB B;  5DHF B;  5JLJ B;  2KCJ A;  2R2Y A;  2Y7B A;  3RCP A;  3U7D A;  3A8Q A;  1B55 A;  1MI1 A;  4A6F B;  1V5P A;  2OQB A;  2RNR B;  2MWN B;  4GNK B;  2HE7 A;  4CYE A;  2UZR A;  1BTK A;  2J0M A;  4A6H A;  5CLL B;  2XQN M;  4HAT B;  1MK9 B;  3SYX A;  1H10 A;  1ZM0 A;  3PVL A;  2K2J A;  5EFX A;  1WVH A;  2D11 A;  2DN6 A;  4GN1 A;  5J3Y A;  4HAY B;  4Z2N A;  2BCJ A;  2LG1 A;  1XX0 A;  2LUL A;  4HB0 B;  1ISN A;  5JP4 A;  3O96 A;  1AQC A;  3U12 A;  2RUK B;  3HW2 B;  1V88 A;  4DX8 A;  1NTV A;  1E5W A;  2KUQ A;  1SGH A;  1UPR A;  2Z4D A;  1FGY A;  3FVC A;  2D9V A;  2Z0Q A;  3PEG A;  1FGZ A;  4XWX A;  1WG7 A;  4CSQ A;  2W2X C;  2YVC A;  4KVG B;  4GOU A;  2YS5 A;  1QC6 A;  3TCA A;  4HAU B;  4CHM A;  1WI1 A;  3D8D A;  4ZRJ A;  1ZC4 B;  2I1J A;  4B6H A;  4WVF B;  2Z13 A;  3BJI A;  3WYF B;  2MDX A;  2ZPY A;  2YRY A;  2YS3 A;  2YS1 A;  3FM8 C;  5DH9 B;  1OQN A;  2ZKM X;  3VOQ A;  3ULC A;  5D3Y A;  4F7G A;  3CIK A;  4YON A;  1V61 A;  3WA0 A;  3IVF A;  5JHG A;  1UNR A;  2LKO A;  3BIN A;  4QXA B;  4NY0 A;  2GJY A;  2ELB A;  1FHW A;  4QJ5 B;  5L81 A;  4GZU A;  2YT1 A;  5M4Y B;  2COF A;  5J3Q A;  5FI1 A;  1BTN A;  3A8P A;  1W1H A;  5HE3 A;  1X86 A;  2Z14 A;  1DDW A;  2CAY A;  2NZ8 B;  5I2M A;  1ZSQ A;  1DDM A;  2RRF A;  3PVU A;  2COD A;  3T06 A;  5D3W A;  1PMS A;  4DIX A;  3ODW A;  5GOW B;  4H8S A;  2MFQ A;  3ZDT A;  2X18 A;  1XOD A;  4HAV B;  4PQ0 A;  1P6S A;  2K2U A;  4HHV A;  4L6E A;  1P3R A;  1TQZ A;  5HE2 A;  1EVH A;  4OSN A;  3DXD A;  3QBV B;  1XCG A;  2H7E A;  3PG7 A;  1N3H A;  2L2I A;  2QKL A;  4KHO A;  2Z0O A;  2DX1 A;  3D8F A;  2GCL A;  2DHI A;  3UZT A;  1WJM A;  1NU2 A;  2P0H A;  1EF1 A;  3PVW A;  1UEF A;  2KUP A;  3KRX A;  4GXB A;  4D6W A;  2KIE A;  2E2X A;  1UPQ A;  5LON B;  3PZD A;  2CY4 A;  3FEH A;  2P0F A;  3NW8 A;  1I7A A;  2HTH B;  4F7H A;  2D9W A;  2J0K A;  2YSZ A;  2I5C A;  2EMT A;  4QJ3 B;  3MDB C;  2VRW B;  1H4R A;  2YF0 A;  2ELA A;  2G35 A;  1U5D A;  3A98 B;  2M14 A;  3N7C A;  2COC A;  3U8Z A;  4HB2 B;  4D0N B;  1BAK A;  2UVM A;  1GG3 A;  4HAX B;  2D9Z A;  3GYP A;  3TO1 A;  4NSW A;  2EJ8 A;  4TYZ A;  4PNK A;  2KIG A;  3KY9 A;  2DHJ A;  4K17 A;  4MK0 A;  3ULB A;  5C5B B;  1W1G A;  5C6R A;  1TXD A;  3SNH A;  4HB4 B;  5KQ1 A;  2DLW A;  5LG4 B;  2CY5 A;  5HE1 A;  2PZ1 A;  4BBK A;  1V5M A;  4MT7 A;  1KI1 B;  2D9X A;  3PP2 A;  3MPX A;  2DKQ A;  3AJ4 A;  4HDO A;  3AU5 A;  2V76 A;  4ZRI A;  1FHO A;  5FI0 A;  3DCX A;  1Z87 A;  3F5R A;  5KCV A;  1XKE A;  1NTY A;  1WGQ A;  5DHA B;  5KQ4 A;  2DKP A;  2KGX B;  1V5U A;  2R0D A;  1BWN A;  2RGN B;  3HSA A;  3QWM A;  2N0Y A;  1WJ1 A;  1MPH A;  4KHB A;  2Y8G A;  4QJ4 B;  1MIX A;  5IRS A;  1X05 A;  1T77 A;  1DBH A;  4C0A A;  5DIF B;  3NSU A;  1K5G B;  2YT0 A;  4F7U P;  4L1R A;  1U27 A;  2QKM A;  4MY6 A;  1DYN A;  1DDV A;  4K81 A;  1PFJ A;  1OY2 A;  2GUM A;  4EKU A;  1X1G A;  2Q13 A;  2W2W A;  4GPT B;  4GMX B;  3OAN A;  4A5K A;  1KZ7 A;  2D4Q A;  1FOE A;  2Z0P A;  5D27 A;  1QQG A;  2DA0 A;  2VKI A;  1K5D B;  2EMS A;  2DX5 A;  2NBV A;  1OMW A;  1ZYI A;  2D2Q A;  4K2O A;  2I1K A;  1U2B A;  4HDQ A;  4IFS A;  3A58 A;  2DHK A;  2KR0 A;  1U29 A;  4DBB A;  1U5F A;  3TFM A;  5C79 A;  2W2X D;  3LJU X;  2NMB A;  3TW1 A;  5J3T A;  5HE0 A;  5C16 A;  5D3V A;  1UNQ A;  2Y8F A;  2DTC A;  1Y19 B;  2ROZ B;  3DXE A;  4Z2M B;  1MK7 B;  3GYO A;  4HAW B;  2I5F A;  2COA A;  1P5T A;  5I2S A;  1X11 A;  4IAP A;  1X1F A;  2MKR A;  3M1I B;  4DXA B;  2GCJ A;  2R09 A;  4P7I A;  1UNP A;  3ML4 A;  1J19 A;  1U5G A;  3KRW A;  2ROV A;  5C5B A;  4EMO A;  3QIJ A;  4CHJ A;  2P8V A;  1MIZ B;  2P0D A;  3ODX A;  1MAI A;  1DRO A;  1IRS A;  2DYQ A;  4HB3 B;  2AEH A;  2CRF A;  2K49 A;  3KZ1 A;  4K2P A;  3NWF A;  3SO6 A;  4ZRK A;  4IOY X;  2ADZ A;  3B77 A;  4GMV A;  3HIE A;  3CXB B;  3ODO A;  1PLS A;  5JHH A;  4TKN A;  3SV1 A;  1Q67 A;  4HSI A;  3X23 A;  1FHX A;  3NWA A;  1I2H A;  2UZS A;  2YT2 A;  5CLQ B;  2K8E A;  3SUZ A;  3DXC A;  1ZVR A;  2LOZ A;  1SHC A;  2JP2 A;  4HAZ B;  4OT1 A;  4KHB B;  1XD4 A;  3OHM B;  5LOP B;  2RLO A;  1AWE A;  2J0J A;  2DYN A;  2D9Y A;  1W1D A;  4KAX B;  1M7R A;  1V89 A;  3TVV A;  4A6F A;  1RJ2 A;  2VSZ A;  1M7E A;  2RSG A;  2K00 A;  3P7Z A;  2LOX A;  3P6A A;  1LW3 A;  3ZVR A;  2LYD A; 
#chains in the Genus database with same CATH homology
 2N23 A;  3F0W A;  2D10 A;  2H7D A;  2L1C A;  4DX9 0;  5D3X A;  1MKE A;  2IFS A;  1WGU A;  3V5W A;  2GS0 A;  1J0W A;  1ZC3 B;  4YL8 A;  2FJL A;  2EC1 A;  4Y94 A;  2M38 A;  3KSY A;  1GC6 A;  1EGX A;  3G9W A;  5DI9 B;  4WSF A;  4KHA A;  3D8E A;  2OTX A;  1KZG A;  2DFK A;  1RRP B;  1FB8 A;  3FSS A;  3HK0 A;  1NI2 A;  1TJ6 A;  1U5E A;  2AL6 A;  1EAZ A;  1GC7 A;  3AU4 A;  1XR0 B;  3HQC A;  1FAO A;  3PSC A;  1LB1 A;  4A6K A;  2IYB A;  1Y5O A;  4WJ7 A;  3VIA A;  2J59 M;  4EJN A;  2RVB B;  5DHF B;  5JLJ B;  2KCJ A;  2Y7B A;  3U7D A;  3RCP A;  3A8Q A;  1B55 A;  4A6F B;  1V5P A;  2OQB A;  2RNR B;  2MWN B;  2HE7 A;  4CYE A;  2UZR A;  1BTK A;  2J0M A;  4A6H A;  5CLL B;  2XQN M;  4HAT B;  1MK9 B;  3SYX A;  1H10 A;  1ZM0 A;  3PVL A;  2K2J A;  5EFX A;  1WVH A;  2D11 A;  2DN6 A;  4GN1 A;  5J3Y A;  4HAY B;  4Z2N A;  2BCJ A;  2LG1 A;  1XX0 A;  2LUL A;  4HB0 B;  1ISN A;  5JP4 A;  3O96 A;  1AQC A;  2RUK B;  3HW2 B;  1V88 A;  4DX8 A;  1NTV A;  1E5W A;  1SGH A;  1UPR A;  1FGY A;  2D9V A;  2Z0Q A;  3PEG A;  1FGZ A;  4XWX A;  1WG7 A;  2W2X C;  2YVC A;  4KVG B;  2YS5 A;  1QC6 A;  3TCA A;  4HAU B;  4CHM A;  1WI1 A;  3D8D A;  4ZRJ A;  1ZC4 B;  2I1J A;  4B6H A;  4WVF B;  3BJI A;  3WYF B;  2MDX A;  2ZPY A;  2YRY A;  2YS3 A;  2YS1 A;  3FM8 C;  5DH9 B;  1OQN A;  3VOQ A;  3ULC A;  5D3Y A;  4F7G A;  3CIK A;  4YON A;  1V61 A;  3WA0 A;  3IVF A;  5JHG A;  1UNR A;  2LKO A;  3BIN A;  4NY0 A;  2GJY A;  2ELB A;  1FHW A;  5L81 A;  4GZU A;  2YT1 A;  2COF A;  5J3Q A;  5FI1 A;  1BTN A;  3A8P A;  1W1H A;  5HE3 A;  1X86 A;  1DDW A;  2CAY A;  2NZ8 B;  1ZSQ A;  1DDM A;  3PVU A;  2COD A;  3T06 A;  5D3W A;  1PMS A;  3ODW A;  5GOW B;  4H8S A;  2MFQ A;  3ZDT A;  2X18 A;  1XOD A;  4HAV B;  4PQ0 A;  1P6S A;  2K2U A;  4HHV A;  4L6E A;  1P3R A;  1TQZ A;  5HE2 A;  1EVH A;  3DXD A;  3QBV B;  1XCG A;  2H7E A;  3PG7 A;  1N3H A;  2L2I A;  2QKL A;  4KHO A;  2Z0O A;  2DX1 A;  3D8F A;  2GCL A;  2DHI A;  3UZT A;  1WJM A;  1NU2 A;  2P0H A;  1EF1 A;  3PVW A;  1UEF A;  2KUP A;  3KRX A;  4GXB A;  2E2X A;  1UPQ A;  5LON B;  3PZD A;  2CY4 A;  3FEH A;  2P0F A;  1I7A A;  2HTH B;  4F7H A;  2D9W A;  2J0K A;  2YSZ A;  2I5C A;  2EMT A;  3MDB C;  2VRW B;  1H4R A;  2YF0 A;  2ELA A;  2G35 A;  1U5D A;  3A98 B;  2M14 A;  3N7C A;  2COC A;  3U8Z A;  4HB2 B;  4D0N B;  1BAK A;  2UVM A;  1GG3 A;  4HAX B;  2D9Z A;  3GYP A;  3TO1 A;  4NSW A;  2EJ8 A;  4TYZ A;  4PNK A;  3KY9 A;  2DHJ A;  4K17 A;  4MK0 A;  3ULB A;  5C5B B;  1W1G A;  5C6R A;  1TXD A;  3SNH A;  4HB4 B;  5KQ1 A;  2DLW A;  2CY5 A;  5HE1 A;  2PZ1 A;  4BBK A;  1V5M A;  4MT7 A;  1KI1 B;  2D9X A;  3PP2 A;  3MPX A;  2DKQ A;  3AJ4 A;  4HDO A;  3AU5 A;  2V76 A;  4ZRI A;  1FHO A;  5FI0 A;  1Z87 A;  3F5R A;  5KCV A;  1XKE A;  1NTY A;  1WGQ A;  5DHA B;  5KQ4 A;  2DKP A;  2KGX B;  1V5U A;  2R0D A;  1BWN A;  2RGN B;  3QWM A;  2N0Y A;  1WJ1 A;  1MPH A;  2Y8G A;  1MIX A;  1X05 A;  1DBH A;  4C0A A;  5DIF B;  3NSU A;  1K5G B;  2YT0 A;  4F7U P;  1U27 A;  2QKM A;  4MY6 A;  1DYN A;  1DDV A;  4K81 A;  1PFJ A;  1OY2 A;  4EKU A;  1X1G A;  2Q13 A;  2W2W A;  4GPT B;  4GMX B;  3OAN A;  4A5K A;  1KZ7 A;  2D4Q A;  1FOE A;  2Z0P A;  5D27 A;  1QQG A;  2DA0 A;  2VKI A;  1K5D B;  2EMS A;  2DX5 A;  1OMW A;  2D2Q A;  4K2O A;  2I1K A;  1U2B A;  4HDQ A;  4IFS A;  2DHK A;  1U29 A;  4DBB A;  1U5F A;  3TFM A;  5C79 A;  2W2X D;  3LJU X;  2NMB A;  3TW1 A;  5J3T A;  5HE0 A;  5C16 A;  5D3V A;  1UNQ A;  2Y8F A;  2DTC A;  1Y19 B;  2ROZ B;  3DXE A;  4Z2M B;  1MK7 B;  3GYO A;  4HAW B;  2I5F A;  2COA A;  1P5T A;  1X11 A;  4IAP A;  1X1F A;  2MKR A;  3M1I B;  4DXA B;  2GCJ A;  2R09 A;  4P7I A;  1UNP A;  3ML4 A;  1J19 A;  1U5G A;  3KRW A;  2ROV A;  5C5B A;  4EMO A;  3QIJ A;  4CHJ A;  2P8V A;  1MIZ B;  2P0D A;  3ODX A;  1MAI A;  1DRO A;  1IRS A;  2DYQ A;  4HB3 B;  2AEH A;  2CRF A;  3KZ1 A;  4K2P A;  3SO6 A;  4ZRK A;  4IOY X;  2ADZ A;  4GMV A;  3CXB B;  3ODO A;  1PLS A;  5JHH A;  4TKN A;  3SV1 A;  1Q67 A;  3X23 A;  1FHX A;  1I2H A;  2UZS A;  5CLQ B;  3SUZ A;  3DXC A;  1ZVR A;  2LOZ A;  1SHC A;  2JP2 A;  4HAZ B;  4KHB B;  1XD4 A;  5LOP B;  2RLO A;  1AWE A;  2J0J A;  2DYN A;  2D9Y A;  1W1D A;  4KAX B;  1M7R A;  1V89 A;  3TVV A;  4A6F A;  1RJ2 A;  2VSZ A;  1M7E A;  2RSG A;  2K00 A;  3P7Z A;  2LOX A;  3P6A A;  1LW3 A;  3ZVR A;  2LYD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...