1P6SA

Solution structure of the pleckstrin homology domain of human protein kinase b beta (pkb/akt)
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
111
structure length
111
Chain Sequence
b'MNEVSVIKEGWLHKRGEYIKTWRPRYFLLKSDGSFIGYKERPEAPDQTLPPLNNFSVAECQLMKTERPRPNTFVIRCLQWTTVIERTFHVDSPDEREEWMRAIQMVANSLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RAC-beta serine/threonine protein kinase
publication title Solution structure and backbone dynamics of the pleckstrin homology domain of the human protein kinase B (PKB/Akt). Interaction with inositol phosphates.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 17
structure length 111
sequence length 111
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2003-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1p6sA00
1WJMA 4C0AA 3QBVB 3O96A 5DH9B 4YONA 5FI1A 2JP2A 3CXBB 2W2XC 4TKNA 1UEFA 1ZC3B 2QKMA 2LYDA 3IVFA 3WA0A 4HATB 1WGQA 5C16A 3ODOA 2UZRA 5KCVA 2J0JA 5HE1A 1AQCA 2DN6A 1BTNA 3A8PA 1FGZA 1UPRA 3U8ZA 3HQCA 2P0DA 3D8EA 3SUZA 2R09A 1ZC4B 3DXCA 4L6EA 3SO6A 1U5GA 1WVHA 2H7DA 2LG1A 4HB3B 5LONB 1ZM0A 1NU2A 2ELAA 2ROVA 5DIFB 2YT1A 1X1FA 3HW2B 3KZ1A 4GMVA 1GG3A 5KQ1A 2MKRA 3PZDA 3KRXA 4PNKA 2YS3A 1I2HA 1OMWA 5J3YA 2MWNB 1XODA 2G35A 5CLLB 3ZDTA 1K5GB 2RNRB 2FJLA 4F7UP 2P0HA 3AJ4A 3GYOA 2D4QA 2NZ8B 1RRPB 1W1GA 1DYNA 4WVFB 2Q13A 4HAUB 3VOQA 1XCGA 4DX90 3UZTA 2KCJA 4TYZA 2M14A 2D9YA 3FSSA 3MDBC 2DX5A 3OANA 2ROZB 2E2XA 2EMSA 4HAWB 2Y8FA 2EMTA 4CHJA 1MK7B 2YT0A 2COCA 3SYXA 4F7HA 2COFA 3F0WA 2VRWB 1MAIA 1W1DA 5C5BB 3TO1A 2J0MA 2K00A 4WJ7A 3DXEA 2GJYA 1DDMA 1P6SA 1U5EA 3PVUA 1XR0B 1U5FA 4HAVB 2LOXA 3TFMA 1QC6A 1X86A 1EAZA 1WGUA 4HB2B 5D3XA 1UPQA 3NSUA 3PG7A 3AU5A 1Z87A 2XQNM 1EVHA 1V88A 3ULBA 4YL8A 2OTXA 5JHHA 2YS1A 1OQNA 1H10A 2N23A 2NMBA 2DA0A 1U2BA 5J3TA 3PVLA 4EJNA 3DXDA 3V5WA 3ZVRA 2K2UA 1XX0A 4A6FB 5L81A 3ULCA 3G9WA 4IFSA 4A6FA 1H4RA 1DDVA 1WG7A 2QKLA 1LW3A 3HK0A 2RGNB 2N0YA 3ODWA 3SV1A 2X18A 2YS5A 1BAKA 2Z0QA 5C79A 1DDWA 3MPXA 2I1JA 2HE7A 4XWXA 3FM8C 1TXDA 1GC6A 4HDQA 1UNPA 1NTYA 1BTKA 1Q67A 5D3VA 3PEGA 2UVMA 3PSCA 2AEHA 2EJ8A 4NY0A 1J0WA 2OQBA 1PMSA 4KAXB 4D0NB 2IYBA 4ZRJA 4K2OA 4EMOA 4H8SA 2R0DA 5JHGA 2W2WA 1K5DB 2YVCA 3PVWA 5EFXA 1AWEA 1BWNA 4F7GA 2GCLA 2M38A 1KI1B 3VIAA 2P0FA 1U5DA 2DYQA 2DYNA 2IFSA 1TJ6A 5JLJB 1ZVRA 1J19A 1FB8A 1FHOA 1U27A 3A98B 1Y5OA 1SHCA 1UNQA 4HAXB 2D9ZA 4PQ0A 4EKUA 2DX1A 1KZGA 1NI2A 1FAOA 5LOPB 3T06A 5GOWB 2J0KA 3U7DA 3CIKA 1FOEA 4HAZB 1LB1A 2DKPA 2J59M 2CODA 5FI0A 2L2IA 4Y94A 4KHOA 4KHBB 3AU4A 1V5UA 2H7EA 4HDOA 4WSFA 4HHVA 1X1GA 3QIJA 2MFQA 2CY4A 4GMXB 2W2XD 1OY2A 2DHIA 2I5CA 3BJIA 1MPHA 2DHJA 1P5TA 2Y7BA 2VKIA 3KY9A 3A8QA 1UNRA 1MKEA 2DLWA 3TW1A 1U29A 4CYEA 1FHWA 4IAPA 2BCJA 1KZ7A 2ADZA 2YF0A 1PLSA 1ISNA 2D11A 1V5MA 4HAYB 4K17A 4CHMA 4HB4B 5CLQB 2V76A 1M7EA 4GXBA 4K2PA 2D10A 1V89A 2LKOA 3PP2A 1I7AA 1X05A 1W1HA 1ZSQA 4IOYX 2GS0A 4GZUA 5D3YA 4DX8A 1QQGA 4HB0B 5KQ4A 2RSGA 4A6HA 2AL6A 3M1IB 4MK0A 1Y19B 5JP4A 4DXAB 1DBHA 1P3RA 2DTCA 1V61A 2RVBB 2DKQA 4P7IA 1FHXA 1SGHA 5DHFB 2VSZA 2KUPA 3LJUX 1DROA 1EGXA 3P6AA 4KHAA 4Z2MB 1MK9B 2YRYA 1MIXA 2KGXB 5HE0A 1B55A 2D9WA 2D2QA 2ELBA 1WI1A 2CRFA 2L1CA 1XKEA 3D8DA 5D3WA 1N3HA 2K2JA 2PZ1A 2DFKA 4GPTB 4MY6A 4A5KA 5J3QA 2COAA 3QWMA 3FEHA 5HE2A 2DHKA 3RCPA 2HTHB 1FGYA 2Z0PA 1WJ1A 2UZSA 4NSWA 4B6HA 5HE3A 3X23A 2LOZA 3KRWA 3N7CA 4KVGB 1EF1A 1E5WA 1MIZB 2EC1A 5DI9B 1TQZA 3SNHA 3F5RA 4GN1A 2RUKB 2Y8GA 1XD4A 2D9XA 2P8VA 3WYFB 1GC7A 2LULA 1M7RA 3ODXA 2I5FA 2I1KA 2RLOA 3D8FA 4MT7A 3KSYA 1X11A 1IRSA 2ZPYA 4A6KA 1V5PA 3P7ZA 4ZRKA 5DHAB 2YSZA 3ML4A 4ZRIA 3GYPA 3BINA 1PFJA 3TVVA 5D27A 5C5BA 2CAYA 2CY5A 3TCAA 4DBBA 4Z2NA 4K81A 2D9VA 1NTVA 2Z0OA 2MDXA 1RJ2A 2GCJA 5C6RA 4BBKA
chains in the Genus database with same CATH superfamily
1WJMA 4C0AA 4D6WA 3QBVB 3O96A 5DH9B 4YONA 5FI1A 2JP2A 2RRFA 3CXBB 2W2XC 4TKNA 1UEFA 2KIGA 1ZC3B 3NW8A 2QKMA 2LYDA 3IVFA 3WA0A 4HATB 1WGQA 5C16A 3ODOA 2UZRA 5KCVA 2J0JA 5HE1A 1AQCA 2DN6A 1BTNA 3B77A 1T77A 3A8PA 1FGZA 1UPRA 3U8ZA 3HQCA 2P0DA 3D8EA 3SUZA 2R09A 2Z59A 1ZC4B 3DXCA 4L6EA 3SO6A 1U5GA 5M4YB 1WVHA 2H7DA 2K8EA 2LG1A 4HB3B 5LONB 1ZM0A 1NU2A 2ELAA 2ROVA 5DIFB 2YT1A 1X1FA 3HW2B 3KZ1A 4GMVA 1GG3A 5KQ1A 2MKRA 3PZDA 3KRXA 4PNKA 2YS3A 1I2HA 1OMWA 5J3YA 2MWNB 1XODA 2G35A 5CLLB 3ZDTA 1K5GB 2RNRB 2FJLA 4F7UP 2P0HA 4OT1A 3AJ4A 3GYOA 2D4QA 2NZ8B 1RRPB 1W1GA 1DYNA 3NWDA 4WVFB 2Q13A 4HAUB 3VOQA 1XCGA 4DX90 3UZTA 2KCJA 4TYZA 2M14A 2NBVA 2D9YA 3FSSA 3MDBC 2DX5A 3OANA 2ROZB 2E2XA 2GUMA 2EMSA 4HAWB 2Y8FA 2EMTA 4CHJA 1MK7B 5I2MA 2YT0A 2COCA 3SYXA 4F7HA 3HSAA 2COFA 3F0WA 2VRWB 3FVCA 1MAIA 1W1DA 5C5BB 3TO1A 2J0MA 2K00A 4WJ7A 3DXEA 2GJYA 1DDMA 1P6SA 1U5EA 3PVUA 1XR0B 1U5FA 4HAVB 2LOXA 3TFMA 1QC6A 1X86A 1EAZA 1WGUA 4HB2B 5D3XA 1UPQA 3NSUA 3PG7A 3AU5A 1Z87A 2XQNM 1EVHA 1V88A 3ULBA 4YL8A 2OTXA 5JHHA 2YS1A 1OQNA 1H10A 2N23A 2NMBA 2DA0A 1U2BA 1MI1A 5J3TA 3PVLA 4EJNA 3DXDA 3V5WA 3ZVRA 2K2UA 1XX0A 2YT2A 2R2YA 4A6FB 5L81A 3ULCA 2KUQA 3G9WA 4IFSA 4A6FA 1H4RA 1DDVA 1WG7A 2QKLA 1LW3A 3HK0A 2RGNB 2N0YA 3ODWA 3SV1A 2X18A 3OHMB 2YS5A 1BAKA 2Z0QA 5C79A 1DDWA 3MPXA 2I1JA 2HE7A 4QJ3B 2FJUB 4XWXA 3FM8C 1TXDA 1GC6A 1ZYIA 4HDQA 1UNPA 1NTYA 1BTKA 1Q67A 3NWFA 5D3VA 3PEGA 2UVMA 3PSCA 4DIXA 2AEHA 2EJ8A 4NY0A 1J0WA 2OQBA 1PMSA 4KAXB 4D0NB 2IYBA 4ZRJA 4K2OA 4EMOA 4H8SA 2R0DA 5JHGA 2W2WA 1K5DB 4QXAB 2YVCA 3PVWA 5EFXA 1AWEA 1BWNA 4F7GA 2GCLA 2M38A 1KI1B 3VIAA 2P0FA 4QJ4B 1U5DA 2DYQA 2DYNA 2IFSA 1TJ6A 5JLJB 1ZVRA 1J19A 1FB8A 4HSIA 1FHOA 1U27A 3A98B 1Y5OA 3U12A 2KR0A 1SHCA 1UNQA 4HAXB 2D9ZA 4PQ0A 4EKUA 2DX1A 1KZGA 1NI2A 1FAOA 5LOPB 3T06A 5GOWB 2J0KA 3U7DA 3CIKA 1FOEA 4HAZB 1LB1A 2DKPA 2J59M 2CODA 5FI0A 2L2IA 3NWAA 4Y94A 4KHOA 4KHBB 3AU4A 1V5UA 2H7EA 4HDOA 4WSFA 4HHVA 1X1GA 3QIJA 2MFQA 4KHBA 2CY4A 4GMXB 2W2XD 5I2SA 1OY2A 2DHIA 2I5CA 3BJIA 2Z4DA 1MPHA 2DHJA 1P5TA 2Y7BA 2VKIA 3KY9A 3A8QA 1UNRA 1MKEA 2DLWA 3TW1A 1U29A 4CYEA 1FHWA 4IAPA 2BCJA 1KZ7A 2ADZA 2YF0A 1PLSA 1ISNA 2D11A 1V5MA 4HAYB 4K17A 4CHMA 4HB4B 4QJ5B 5CLQB 4CSQA 2V76A 1M7EA 4GXBA 4K2PA 4OSNA 2D10A 1V89A 2LKOA 3PP2A 1I7AA 1X05A 1W1HA 1ZSQA 4IOYX 2GS0A 4GZUA 5D3YA 4DX8A 1QQGA 4HB0B 5KQ4A 2RSGA 4A6HA 2AL6A 3M1IB 4MK0A 1Y19B 5JP4A 4DXAB 1DBHA 1P3RA 2DTCA 1V61A 2RVBB 2DKQA 3A58A 4P7IA 2K49A 1FHXA 1SGHA 5DHFB 2VSZA 2KUPA 3LJUX 1DROA 1EGXA 2ZKMX 3P6AA 4KHAA 4Z2MB 1MK9B 2YRYA 1MIXA 2Z13A 2KGXB 5HE0A 1B55A 2D9WA 2D2QA 2ELBA 1WI1A 2CRFA 2L1CA 1XKEA 3D8DA 5D3WA 1N3HA 2K2JA 2PZ1A 2DFKA 4GPTB 4MY6A 4A5KA 5J3QA 2COAA 2Z14A 4GOUA 3QWMA 3FEHA 5HE2A 2DHKA 3RCPA 2HTHB 1FGYA 2Z0PA 4L1RA 1WJ1A 2UZSA 4NSWA 4B6HA 2KIEA 5HE3A 3X23A 2LOZA 3KRWA 3N7CA 5IRSA 4KVGB 1EF1A 1E5WA 1MIZB 2EC1A 5DI9B 1TQZA 3SNHA 3F5RA 4GN1A 2RUKB 2Y8GA 1XD4A 2D9XA 2P8VA 3WYFB 1GC7A 2LULA 3DCXA 1M7RA 3ODXA 2I5FA 2I1KA 3HIEA 2RLOA 3D8FA 4MT7A 3KSYA 1X11A 1IRSA 2ZPYA 4A6KA 1V5PA 3P7ZA 4ZRKA 5DHAB 2YSZA 3ML4A 4ZRIA 3GYPA 3BINA 1PFJA 3TVVA 5D27A 5LG4B 5C5BA 2CAYA 2CY5A 4GNKB 3TCAA 4DBBA 4Z2NA 4K81A 2D9VA 1NTVA 2Z0OA 2MDXA 1RJ2A 2GCJA 5C6RA 4BBKA
chains in the Genus database with same CATH topology
1WJMA 4C0AA 3QBVB 3O96A 5DH9B 4YONA 5FI1A 2JP2A 3CXBB 2W2XC 4TKNA 1UEFA 1ZC3B 2QKMA 2LYDA 3IVFA 3WA0A 4HATB 1WGQA 5C16A 3ODOA 2UZRA 5KCVA 2J0JA 5HE1A 1AQCA 2DN6A 1BTNA 3A8PA 1FGZA 1UPRA 3U8ZA 3HQCA 2P0DA 3D8EA 3SUZA 2R09A 1ZC4B 3DXCA 4L6EA 3SO6A 1U5GA 1WVHA 2H7DA 2LG1A 4HB3B 5LONB 1ZM0A 1NU2A 2ELAA 2ROVA 5DIFB 2YT1A 1X1FA 3HW2B 3KZ1A 4GMVA 1GG3A 5KQ1A 2MKRA 3PZDA 3KRXA 4PNKA 2YS3A 1I2HA 1OMWA 5J3YA 2MWNB 1XODA 2G35A 5CLLB 3ZDTA 1K5GB 2RNRB 2FJLA 4F7UP 2P0HA 3AJ4A 3GYOA 2D4QA 2NZ8B 1RRPB 1W1GA 1DYNA 4WVFB 2Q13A 4HAUB 3VOQA 1XCGA 4DX90 3UZTA 2KCJA 4TYZA 2M14A 2D9YA 3FSSA 3MDBC 2DX5A 3OANA 2ROZB 2E2XA 2EMSA 4HAWB 2Y8FA 2EMTA 4CHJA 1MK7B 2YT0A 2COCA 3SYXA 4F7HA 2COFA 3F0WA 2VRWB 1MAIA 1W1DA 5C5BB 3TO1A 2J0MA 2K00A 4WJ7A 3DXEA 2GJYA 1DDMA 1P6SA 1U5EA 3PVUA 1XR0B 1U5FA 4HAVB 2LOXA 3TFMA 1QC6A 1X86A 1EAZA 1WGUA 4HB2B 5D3XA 1UPQA 3NSUA 3PG7A 3AU5A 1Z87A 2XQNM 1EVHA 1V88A 3ULBA 4YL8A 2OTXA 5JHHA 2YS1A 1OQNA 1H10A 2N23A 2NMBA 2DA0A 1U2BA 5J3TA 3PVLA 4EJNA 3DXDA 3V5WA 3ZVRA 2K2UA 1XX0A 4A6FB 5L81A 3ULCA 3G9WA 4IFSA 4A6FA 1H4RA 1DDVA 1WG7A 2QKLA 1LW3A 3HK0A 2RGNB 2N0YA 3ODWA 3SV1A 2X18A 2YS5A 1BAKA 2Z0QA 5C79A 1DDWA 3MPXA 2I1JA 2HE7A 4XWXA 3FM8C 1TXDA 1GC6A 4HDQA 1UNPA 1NTYA 1BTKA 1Q67A 5D3VA 3PEGA 2UVMA 3PSCA 2AEHA 2EJ8A 4NY0A 1J0WA 2OQBA 1PMSA 4KAXB 4D0NB 2IYBA 4ZRJA 4K2OA 4EMOA 4H8SA 2R0DA 5JHGA 2W2WA 1K5DB 2YVCA 3PVWA 5EFXA 1AWEA 1BWNA 4F7GA 2GCLA 2M38A 1KI1B 3VIAA 2P0FA 1U5DA 2DYQA 2DYNA 2IFSA 1TJ6A 5JLJB 1ZVRA 1J19A 1FB8A 1FHOA 1U27A 3A98B 1Y5OA 1SHCA 1UNQA 4HAXB 2D9ZA 4PQ0A 4EKUA 2DX1A 1KZGA 1NI2A 1FAOA 5LOPB 3T06A 5GOWB 2J0KA 3U7DA 3CIKA 1FOEA 4HAZB 1LB1A 2DKPA 2J59M 2CODA 5FI0A 2L2IA 4Y94A 4KHOA 4KHBB 3AU4A 1V5UA 2H7EA 4HDOA 4WSFA 4HHVA 1X1GA 3QIJA 2MFQA 2CY4A 4GMXB 2W2XD 1OY2A 2DHIA 2I5CA 3BJIA 1MPHA 2DHJA 1P5TA 2Y7BA 2VKIA 3KY9A 3A8QA 1UNRA 1MKEA 2DLWA 3TW1A 1U29A 4CYEA 1FHWA 4IAPA 2BCJA 1KZ7A 2ADZA 2YF0A 1PLSA 1ISNA 2D11A 1V5MA 4HAYB 4K17A 4CHMA 4HB4B 5CLQB 2V76A 1M7EA 4GXBA 4K2PA 2D10A 1V89A 2LKOA 3PP2A 1I7AA 1X05A 1W1HA 1ZSQA 4IOYX 2GS0A 4GZUA 5D3YA 4DX8A 1QQGA 4HB0B 5KQ4A 2RSGA 4A6HA 2AL6A 3M1IB 4MK0A 1Y19B 5JP4A 4DXAB 1DBHA 1P3RA 2DTCA 1V61A 2RVBB 2DKQA 4P7IA 1FHXA 1SGHA 5DHFB 2VSZA 2KUPA 3LJUX 1DROA 1EGXA 3P6AA 4KHAA 4Z2MB 1MK9B 2YRYA 1MIXA 2KGXB 5HE0A 1B55A 2D9WA 2D2QA 2ELBA 1WI1A 2CRFA 2L1CA 1XKEA 3D8DA 5D3WA 1N3HA 2K2JA 2PZ1A 2DFKA 4GPTB 4MY6A 4A5KA 5J3QA 2COAA 3QWMA 3FEHA 5HE2A 2DHKA 3RCPA 2HTHB 1FGYA 2Z0PA 1WJ1A 2UZSA 4NSWA 4B6HA 5HE3A 3X23A 2LOZA 3KRWA 3N7CA 4KVGB 1EF1A 1E5WA 1MIZB 2EC1A 5DI9B 1TQZA 3SNHA 3F5RA 4GN1A 2RUKB 2Y8GA 1XD4A 2D9XA 2P8VA 3WYFB 1GC7A 2LULA 1M7RA 3ODXA 2I5FA 2I1KA 2RLOA 3D8FA 4MT7A 3KSYA 1X11A 1IRSA 2ZPYA 4A6KA 1V5PA 3P7ZA 4ZRKA 5DHAB 2YSZA 3ML4A 4ZRIA 3GYPA 3BINA 1PFJA 3TVVA 5D27A 5C5BA 2CAYA 2CY5A 3TCAA 4DBBA 4Z2NA 4K81A 2D9VA 1NTVA 2Z0OA 2MDXA 1RJ2A 2GCJA 5C6RA 4BBKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WJM A;  4C0A A;  3QBV B;  3O96 A;  5DH9 B;  4YON A;  5FI1 A;  2JP2 A;  3CXB B;  2W2X C;  4TKN A;  1UEF A;  1ZC3 B;  2QKM A;  2LYD A;  3IVF A;  3WA0 A;  4HAT B;  1WGQ A;  5C16 A;  3ODO A;  2UZR A;  5KCV A;  2J0J A;  5HE1 A;  1AQC A;  2DN6 A;  1BTN A;  3A8P A;  1FGZ A;  1UPR A;  3U8Z A;  3HQC A;  2P0D A;  3D8E A;  3SUZ A;  2R09 A;  1ZC4 B;  3DXC A;  4L6E A;  3SO6 A;  1U5G A;  1WVH A;  2H7D A;  2LG1 A;  4HB3 B;  5LON B;  1ZM0 A;  1NU2 A;  2ELA A;  2ROV A;  5DIF B;  2YT1 A;  1X1F A;  3HW2 B;  3KZ1 A;  4GMV A;  1GG3 A;  5KQ1 A;  2MKR A;  3PZD A;  3KRX A;  4PNK A;  2YS3 A;  1I2H A;  1OMW A;  5J3Y A;  2MWN B;  1XOD A;  2G35 A;  5CLL B;  3ZDT A;  1K5G B;  2RNR B;  2FJL A;  4F7U P;  2P0H A;  3AJ4 A;  3GYO A;  2D4Q A;  2NZ8 B;  1RRP B;  1W1G A;  1DYN A;  4WVF B;  2Q13 A;  4HAU B;  3VOQ A;  1XCG A;  4DX9 0;  3UZT A;  2KCJ A;  4TYZ A;  2M14 A;  2D9Y A;  3FSS A;  3MDB C;  2DX5 A;  3OAN A;  2ROZ B;  2E2X A;  2EMS A;  4HAW B;  2Y8F A;  2EMT A;  4CHJ A;  1MK7 B;  2YT0 A;  2COC A;  3SYX A;  4F7H A;  2COF A;  3F0W A;  2VRW B;  1MAI A;  1W1D A;  5C5B B;  3TO1 A;  2J0M A;  2K00 A;  4WJ7 A;  3DXE A;  2GJY A;  1DDM A;  1P6S A;  1U5E A;  3PVU A;  1XR0 B;  1U5F A;  4HAV B;  2LOX A;  3TFM A;  1QC6 A;  1X86 A;  1EAZ A;  1WGU A;  4HB2 B;  5D3X A;  1UPQ A;  3NSU A;  3PG7 A;  3AU5 A;  1Z87 A;  2XQN M;  1EVH A;  1V88 A;  3ULB A;  4YL8 A;  2OTX A;  5JHH A;  2YS1 A;  1OQN A;  1H10 A;  2N23 A;  2NMB A;  2DA0 A;  1U2B A;  5J3T A;  3PVL A;  4EJN A;  3DXD A;  3V5W A;  3ZVR A;  2K2U A;  1XX0 A;  4A6F B;  5L81 A;  3ULC A;  3G9W A;  4IFS A;  4A6F A;  1H4R A;  1DDV A;  1WG7 A;  2QKL A;  1LW3 A;  3HK0 A;  2RGN B;  2N0Y A;  3ODW A;  3SV1 A;  2X18 A;  2YS5 A;  1BAK A;  2Z0Q A;  5C79 A;  1DDW A;  3MPX A;  2I1J A;  2HE7 A;  4XWX A;  3FM8 C;  1TXD A;  1GC6 A;  4HDQ A;  1UNP A;  1NTY A;  1BTK A;  1Q67 A;  5D3V A;  3PEG A;  2UVM A;  3PSC A;  2AEH A;  2EJ8 A;  4NY0 A;  1J0W A;  2OQB A;  1PMS A;  4KAX B;  4D0N B;  2IYB A;  4ZRJ A;  4K2O A;  4EMO A;  4H8S A;  2R0D A;  5JHG A;  2W2W A;  1K5D B;  2YVC A;  3PVW A;  5EFX A;  1AWE A;  1BWN A;  4F7G A;  2GCL A;  2M38 A;  1KI1 B;  3VIA A;  2P0F A;  1U5D A;  2DYQ A;  2DYN A;  2IFS A;  1TJ6 A;  5JLJ B;  1ZVR A;  1J19 A;  1FB8 A;  1FHO A;  1U27 A;  3A98 B;  1Y5O A;  1SHC A;  1UNQ A;  4HAX B;  2D9Z A;  4PQ0 A;  4EKU A;  2DX1 A;  1KZG A;  1NI2 A;  1FAO A;  5LOP B;  3T06 A;  5GOW B;  2J0K A;  3U7D A;  3CIK A;  1FOE A;  4HAZ B;  1LB1 A;  2DKP A;  2J59 M;  2COD A;  5FI0 A;  2L2I A;  4Y94 A;  4KHO A;  4KHB B;  3AU4 A;  1V5U A;  2H7E A;  4HDO A;  4WSF A;  4HHV A;  1X1G A;  3QIJ A;  2MFQ A;  2CY4 A;  4GMX B;  2W2X D;  1OY2 A;  2DHI A;  2I5C A;  3BJI A;  1MPH A;  2DHJ A;  1P5T A;  2Y7B A;  2VKI A;  3KY9 A;  3A8Q A;  1UNR A;  1MKE A;  2DLW A;  3TW1 A;  1U29 A;  4CYE A;  1FHW A;  4IAP A;  2BCJ A;  1KZ7 A;  2ADZ A;  2YF0 A;  1PLS A;  1ISN A;  2D11 A;  1V5M A;  4HAY B;  4K17 A;  4CHM A;  4HB4 B;  5CLQ B;  2V76 A;  1M7E A;  4GXB A;  4K2P A;  2D10 A;  1V89 A;  2LKO A;  3PP2 A;  1I7A A;  1X05 A;  1W1H A;  1ZSQ A;  4IOY X;  2GS0 A;  4GZU A;  5D3Y A;  4DX8 A;  1QQG A;  4HB0 B;  5KQ4 A;  2RSG A;  4A6H A;  2AL6 A;  3M1I B;  4MK0 A;  1Y19 B;  5JP4 A;  4DXA B;  1DBH A;  1P3R A;  2DTC A;  1V61 A;  2RVB B;  2DKQ A;  4P7I A;  1FHX A;  1SGH A;  5DHF B;  2VSZ A;  2KUP A;  3LJU X;  1DRO A;  1EGX A;  3P6A A;  4KHA A;  4Z2M B;  1MK9 B;  2YRY A;  1MIX A;  2KGX B;  5HE0 A;  1B55 A;  2D9W A;  2D2Q A;  2ELB A;  1WI1 A;  2CRF A;  2L1C A;  1XKE A;  3D8D A;  5D3W A;  1N3H A;  2K2J A;  2PZ1 A;  2DFK A;  4GPT B;  4MY6 A;  4A5K A;  5J3Q A;  2COA A;  3QWM A;  3FEH A;  5HE2 A;  2DHK A;  3RCP A;  2HTH B;  1FGY A;  2Z0P A;  1WJ1 A;  2UZS A;  4NSW A;  4B6H A;  5HE3 A;  3X23 A;  2LOZ A;  3KRW A;  3N7C A;  4KVG B;  1EF1 A;  1E5W A;  1MIZ B;  2EC1 A;  5DI9 B;  1TQZ A;  3SNH A;  3F5R A;  4GN1 A;  2RUK B;  2Y8G A;  1XD4 A;  2D9X A;  2P8V A;  3WYF B;  1GC7 A;  2LUL A;  1M7R A;  3ODX A;  2I5F A;  2I1K A;  2RLO A;  3D8F A;  4MT7 A;  3KSY A;  1X11 A;  1IRS A;  2ZPY A;  4A6K A;  1V5P A;  3P7Z A;  4ZRK A;  5DHA B;  2YSZ A;  3ML4 A;  4ZRI A;  3GYP A;  3BIN A;  1PFJ A;  3TVV A;  5D27 A;  5C5B A;  2CAY A;  2CY5 A;  3TCA A;  4DBB A;  4Z2N A;  4K81 A;  2D9V A;  1NTV A;  2Z0O A;  2MDX A;  1RJ2 A;  2GCJ A;  5C6R A;  4BBK A; 
#chains in the Genus database with same CATH topology
 1WJM A;  4C0A A;  4D6W A;  3QBV B;  3O96 A;  5DH9 B;  4YON A;  5FI1 A;  2JP2 A;  2RRF A;  3CXB B;  2W2X C;  4TKN A;  1UEF A;  2KIG A;  1ZC3 B;  3NW8 A;  2QKM A;  2LYD A;  3IVF A;  3WA0 A;  4HAT B;  1WGQ A;  5C16 A;  3ODO A;  2UZR A;  5KCV A;  2J0J A;  5HE1 A;  1AQC A;  2DN6 A;  1BTN A;  3B77 A;  1T77 A;  3A8P A;  1FGZ A;  1UPR A;  3U8Z A;  3HQC A;  2P0D A;  3D8E A;  3SUZ A;  2R09 A;  2Z59 A;  1ZC4 B;  3DXC A;  4L6E A;  3SO6 A;  1U5G A;  5M4Y B;  1WVH A;  2H7D A;  2K8E A;  2LG1 A;  4HB3 B;  5LON B;  1ZM0 A;  1NU2 A;  2ELA A;  2ROV A;  5DIF B;  2YT1 A;  1X1F A;  3HW2 B;  3KZ1 A;  4GMV A;  1GG3 A;  5KQ1 A;  2MKR A;  3PZD A;  3KRX A;  4PNK A;  2YS3 A;  1I2H A;  1OMW A;  5J3Y A;  2MWN B;  1XOD A;  2G35 A;  5CLL B;  3ZDT A;  1K5G B;  2RNR B;  2FJL A;  4F7U P;  2P0H A;  4OT1 A;  3AJ4 A;  3GYO A;  2D4Q A;  2NZ8 B;  1RRP B;  1W1G A;  1DYN A;  3NWD A;  4WVF B;  2Q13 A;  4HAU B;  3VOQ A;  1XCG A;  4DX9 0;  3UZT A;  2KCJ A;  4TYZ A;  2M14 A;  2NBV A;  2D9Y A;  3FSS A;  3MDB C;  2DX5 A;  3OAN A;  2ROZ B;  2E2X A;  2GUM A;  2EMS A;  4HAW B;  2Y8F A;  2EMT A;  4CHJ A;  1MK7 B;  5I2M A;  2YT0 A;  2COC A;  3SYX A;  4F7H A;  3HSA A;  2COF A;  3F0W A;  2VRW B;  3FVC A;  1MAI A;  1W1D A;  5C5B B;  3TO1 A;  2J0M A;  2K00 A;  4WJ7 A;  3DXE A;  2GJY A;  1DDM A;  1P6S A;  1U5E A;  3PVU A;  1XR0 B;  1U5F A;  4HAV B;  2LOX A;  3TFM A;  1QC6 A;  1X86 A;  1EAZ A;  1WGU A;  4HB2 B;  5D3X A;  1UPQ A;  3NSU A;  3PG7 A;  3AU5 A;  1Z87 A;  2XQN M;  1EVH A;  1V88 A;  3ULB A;  4YL8 A;  2OTX A;  5JHH A;  2YS1 A;  1OQN A;  1H10 A;  2N23 A;  2NMB A;  2DA0 A;  1U2B A;  1MI1 A;  5J3T A;  3PVL A;  4EJN A;  3DXD A;  3V5W A;  3ZVR A;  2K2U A;  1XX0 A;  2YT2 A;  2R2Y A;  4A6F B;  5L81 A;  3ULC A;  2KUQ A;  3G9W A;  4IFS A;  4A6F A;  1H4R A;  1DDV A;  1WG7 A;  2QKL A;  1LW3 A;  3HK0 A;  2RGN B;  2N0Y A;  3ODW A;  3SV1 A;  2X18 A;  3OHM B;  2YS5 A;  1BAK A;  2Z0Q A;  5C79 A;  1DDW A;  3MPX A;  2I1J A;  2HE7 A;  4QJ3 B;  2FJU B;  4XWX A;  3FM8 C;  1TXD A;  1GC6 A;  1ZYI A;  4HDQ A;  1UNP A;  1NTY A;  1BTK A;  1Q67 A;  3NWF A;  5D3V A;  3PEG A;  2UVM A;  3PSC A;  4DIX A;  2AEH A;  2EJ8 A;  4NY0 A;  1J0W A;  2OQB A;  1PMS A;  4KAX B;  4D0N B;  2IYB A;  4ZRJ A;  4K2O A;  4EMO A;  4H8S A;  2R0D A;  5JHG A;  2W2W A;  1K5D B;  4QXA B;  2YVC A;  3PVW A;  5EFX A;  1AWE A;  1BWN A;  4F7G A;  2GCL A;  2M38 A;  1KI1 B;  3VIA A;  2P0F A;  4QJ4 B;  1U5D A;  2DYQ A;  2DYN A;  2IFS A;  1TJ6 A;  5JLJ B;  1ZVR A;  1J19 A;  1FB8 A;  4HSI A;  1FHO A;  1U27 A;  3A98 B;  1Y5O A;  3U12 A;  2KR0 A;  1SHC A;  1UNQ A;  4HAX B;  2D9Z A;  4PQ0 A;  4EKU A;  2DX1 A;  1KZG A;  1NI2 A;  1FAO A;  5LOP B;  3T06 A;  5GOW B;  2J0K A;  3U7D A;  3CIK A;  1FOE A;  4HAZ B;  1LB1 A;  2DKP A;  2J59 M;  2COD A;  5FI0 A;  2L2I A;  3NWA A;  4Y94 A;  4KHO A;  4KHB B;  3AU4 A;  1V5U A;  2H7E A;  4HDO A;  4WSF A;  4HHV A;  1X1G A;  3QIJ A;  2MFQ A;  4KHB A;  2CY4 A;  4GMX B;  2W2X D;  5I2S A;  1OY2 A;  2DHI A;  2I5C A;  3BJI A;  2Z4D A;  1MPH A;  2DHJ A;  1P5T A;  2Y7B A;  2VKI A;  3KY9 A;  3A8Q A;  1UNR A;  1MKE A;  2DLW A;  3TW1 A;  1U29 A;  4CYE A;  1FHW A;  4IAP A;  2BCJ A;  1KZ7 A;  2ADZ A;  2YF0 A;  1PLS A;  1ISN A;  2D11 A;  1V5M A;  4HAY B;  4K17 A;  4CHM A;  4HB4 B;  4QJ5 B;  5CLQ B;  4CSQ A;  2V76 A;  1M7E A;  4GXB A;  4K2P A;  4OSN A;  2D10 A;  1V89 A;  2LKO A;  3PP2 A;  1I7A A;  1X05 A;  1W1H A;  1ZSQ A;  4IOY X;  2GS0 A;  4GZU A;  5D3Y A;  4DX8 A;  1QQG A;  4HB0 B;  5KQ4 A;  2RSG A;  4A6H A;  2AL6 A;  3M1I B;  4MK0 A;  1Y19 B;  5JP4 A;  4DXA B;  1DBH A;  1P3R A;  2DTC A;  1V61 A;  2RVB B;  2DKQ A;  3A58 A;  4P7I A;  2K49 A;  1FHX A;  1SGH A;  5DHF B;  2VSZ A;  2KUP A;  3LJU X;  1DRO A;  1EGX A;  2ZKM X;  3P6A A;  4KHA A;  4Z2M B;  1MK9 B;  2YRY A;  1MIX A;  2Z13 A;  2KGX B;  5HE0 A;  1B55 A;  2D9W A;  2D2Q A;  2ELB A;  1WI1 A;  2CRF A;  2L1C A;  1XKE A;  3D8D A;  5D3W A;  1N3H A;  2K2J A;  2PZ1 A;  2DFK A;  4GPT B;  4MY6 A;  4A5K A;  5J3Q A;  2COA A;  2Z14 A;  4GOU A;  3QWM A;  3FEH A;  5HE2 A;  2DHK A;  3RCP A;  2HTH B;  1FGY A;  2Z0P A;  4L1R A;  1WJ1 A;  2UZS A;  4NSW A;  4B6H A;  2KIE A;  5HE3 A;  3X23 A;  2LOZ A;  3KRW A;  3N7C A;  5IRS A;  4KVG B;  1EF1 A;  1E5W A;  1MIZ B;  2EC1 A;  5DI9 B;  1TQZ A;  3SNH A;  3F5R A;  4GN1 A;  2RUK B;  2Y8G A;  1XD4 A;  2D9X A;  2P8V A;  3WYF B;  1GC7 A;  2LUL A;  3DCX A;  1M7R A;  3ODX A;  2I5F A;  2I1K A;  3HIE A;  2RLO A;  3D8F A;  4MT7 A;  3KSY A;  1X11 A;  1IRS A;  2ZPY A;  4A6K A;  1V5P A;  3P7Z A;  4ZRK A;  5DHA B;  2YSZ A;  3ML4 A;  4ZRI A;  3GYP A;  3BIN A;  1PFJ A;  3TVV A;  5D27 A;  5LG4 B;  5C5B A;  2CAY A;  2CY5 A;  4GNK B;  3TCA A;  4DBB A;  4Z2N A;  4K81 A;  2D9V A;  1NTV A;  2Z0O A;  2MDX A;  1RJ2 A;  2GCJ A;  5C6R A;  4BBK A; 
#chains in the Genus database with same CATH homology
 1WJM A;  4C0A A;  3QBV B;  3O96 A;  5DH9 B;  4YON A;  5FI1 A;  2JP2 A;  3CXB B;  2W2X C;  4TKN A;  1UEF A;  1ZC3 B;  2QKM A;  2LYD A;  3IVF A;  3WA0 A;  4HAT B;  1WGQ A;  5C16 A;  3ODO A;  2UZR A;  5KCV A;  2J0J A;  5HE1 A;  1AQC A;  2DN6 A;  1BTN A;  3A8P A;  1FGZ A;  1UPR A;  3U8Z A;  3HQC A;  2P0D A;  3D8E A;  3SUZ A;  2R09 A;  1ZC4 B;  3DXC A;  4L6E A;  3SO6 A;  1U5G A;  1WVH A;  2H7D A;  2LG1 A;  4HB3 B;  5LON B;  1ZM0 A;  1NU2 A;  2ELA A;  2ROV A;  5DIF B;  2YT1 A;  1X1F A;  3HW2 B;  3KZ1 A;  4GMV A;  1GG3 A;  5KQ1 A;  2MKR A;  3PZD A;  3KRX A;  4PNK A;  2YS3 A;  1I2H A;  1OMW A;  5J3Y A;  2MWN B;  1XOD A;  2G35 A;  5CLL B;  3ZDT A;  1K5G B;  2RNR B;  2FJL A;  4F7U P;  2P0H A;  3AJ4 A;  3GYO A;  2D4Q A;  2NZ8 B;  1RRP B;  1W1G A;  1DYN A;  4WVF B;  2Q13 A;  4HAU B;  3VOQ A;  1XCG A;  4DX9 0;  3UZT A;  2KCJ A;  4TYZ A;  2M14 A;  2D9Y A;  3FSS A;  3MDB C;  2DX5 A;  3OAN A;  2ROZ B;  2E2X A;  2EMS A;  4HAW B;  2Y8F A;  2EMT A;  4CHJ A;  1MK7 B;  2YT0 A;  2COC A;  3SYX A;  4F7H A;  2COF A;  3F0W A;  2VRW B;  1MAI A;  1W1D A;  5C5B B;  3TO1 A;  2J0M A;  2K00 A;  4WJ7 A;  3DXE A;  2GJY A;  1DDM A;  1P6S A;  1U5E A;  3PVU A;  1XR0 B;  1U5F A;  4HAV B;  2LOX A;  3TFM A;  1QC6 A;  1X86 A;  1EAZ A;  1WGU A;  4HB2 B;  5D3X A;  1UPQ A;  3NSU A;  3PG7 A;  3AU5 A;  1Z87 A;  2XQN M;  1EVH A;  1V88 A;  3ULB A;  4YL8 A;  2OTX A;  5JHH A;  2YS1 A;  1OQN A;  1H10 A;  2N23 A;  2NMB A;  2DA0 A;  1U2B A;  5J3T A;  3PVL A;  4EJN A;  3DXD A;  3V5W A;  3ZVR A;  2K2U A;  1XX0 A;  4A6F B;  5L81 A;  3ULC A;  3G9W A;  4IFS A;  4A6F A;  1H4R A;  1DDV A;  1WG7 A;  2QKL A;  1LW3 A;  3HK0 A;  2RGN B;  2N0Y A;  3ODW A;  3SV1 A;  2X18 A;  2YS5 A;  1BAK A;  2Z0Q A;  5C79 A;  1DDW A;  3MPX A;  2I1J A;  2HE7 A;  4XWX A;  3FM8 C;  1TXD A;  1GC6 A;  4HDQ A;  1UNP A;  1NTY A;  1BTK A;  1Q67 A;  5D3V A;  3PEG A;  2UVM A;  3PSC A;  2AEH A;  2EJ8 A;  4NY0 A;  1J0W A;  2OQB A;  1PMS A;  4KAX B;  4D0N B;  2IYB A;  4ZRJ A;  4K2O A;  4EMO A;  4H8S A;  2R0D A;  5JHG A;  2W2W A;  1K5D B;  2YVC A;  3PVW A;  5EFX A;  1AWE A;  1BWN A;  4F7G A;  2GCL A;  2M38 A;  1KI1 B;  3VIA A;  2P0F A;  1U5D A;  2DYQ A;  2DYN A;  2IFS A;  1TJ6 A;  5JLJ B;  1ZVR A;  1J19 A;  1FB8 A;  1FHO A;  1U27 A;  3A98 B;  1Y5O A;  1SHC A;  1UNQ A;  4HAX B;  2D9Z A;  4PQ0 A;  4EKU A;  2DX1 A;  1KZG A;  1NI2 A;  1FAO A;  5LOP B;  3T06 A;  5GOW B;  2J0K A;  3U7D A;  3CIK A;  1FOE A;  4HAZ B;  1LB1 A;  2DKP A;  2J59 M;  2COD A;  5FI0 A;  2L2I A;  4Y94 A;  4KHO A;  4KHB B;  3AU4 A;  1V5U A;  2H7E A;  4HDO A;  4WSF A;  4HHV A;  1X1G A;  3QIJ A;  2MFQ A;  2CY4 A;  4GMX B;  2W2X D;  1OY2 A;  2DHI A;  2I5C A;  3BJI A;  1MPH A;  2DHJ A;  1P5T A;  2Y7B A;  2VKI A;  3KY9 A;  3A8Q A;  1UNR A;  1MKE A;  2DLW A;  3TW1 A;  1U29 A;  4CYE A;  1FHW A;  4IAP A;  2BCJ A;  1KZ7 A;  2ADZ A;  2YF0 A;  1PLS A;  1ISN A;  2D11 A;  1V5M A;  4HAY B;  4K17 A;  4CHM A;  4HB4 B;  5CLQ B;  2V76 A;  1M7E A;  4GXB A;  4K2P A;  2D10 A;  1V89 A;  2LKO A;  3PP2 A;  1I7A A;  1X05 A;  1W1H A;  1ZSQ A;  4IOY X;  2GS0 A;  4GZU A;  5D3Y A;  4DX8 A;  1QQG A;  4HB0 B;  5KQ4 A;  2RSG A;  4A6H A;  2AL6 A;  3M1I B;  4MK0 A;  1Y19 B;  5JP4 A;  4DXA B;  1DBH A;  1P3R A;  2DTC A;  1V61 A;  2RVB B;  2DKQ A;  4P7I A;  1FHX A;  1SGH A;  5DHF B;  2VSZ A;  2KUP A;  3LJU X;  1DRO A;  1EGX A;  3P6A A;  4KHA A;  4Z2M B;  1MK9 B;  2YRY A;  1MIX A;  2KGX B;  5HE0 A;  1B55 A;  2D9W A;  2D2Q A;  2ELB A;  1WI1 A;  2CRF A;  2L1C A;  1XKE A;  3D8D A;  5D3W A;  1N3H A;  2K2J A;  2PZ1 A;  2DFK A;  4GPT B;  4MY6 A;  4A5K A;  5J3Q A;  2COA A;  3QWM A;  3FEH A;  5HE2 A;  2DHK A;  3RCP A;  2HTH B;  1FGY A;  2Z0P A;  1WJ1 A;  2UZS A;  4NSW A;  4B6H A;  5HE3 A;  3X23 A;  2LOZ A;  3KRW A;  3N7C A;  4KVG B;  1EF1 A;  1E5W A;  1MIZ B;  2EC1 A;  5DI9 B;  1TQZ A;  3SNH A;  3F5R A;  4GN1 A;  2RUK B;  2Y8G A;  1XD4 A;  2D9X A;  2P8V A;  3WYF B;  1GC7 A;  2LUL A;  1M7R A;  3ODX A;  2I5F A;  2I1K A;  2RLO A;  3D8F A;  4MT7 A;  3KSY A;  1X11 A;  1IRS A;  2ZPY A;  4A6K A;  1V5P A;  3P7Z A;  4ZRK A;  5DHA B;  2YSZ A;  3ML4 A;  4ZRI A;  3GYP A;  3BIN A;  1PFJ A;  3TVV A;  5D27 A;  5C5B A;  2CAY A;  2CY5 A;  3TCA A;  4DBB A;  4Z2N A;  4K81 A;  2D9V A;  1NTV A;  2Z0O A;  2MDX A;  1RJ2 A;  2GCJ A;  5C6R A;  4BBK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...