1P6SA

Solution structure of the pleckstrin homology domain of human protein kinase b beta (pkb/akt)
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
111
structure length
111
Chain Sequence
MNEVSVIKEGWLHKRGEYIKTWRPRYFLLKSDGSFIGYKERPEAPDQTLPPLNNFSVAECQLMKTERPRPNTFVIRCLQWTTVIERTFHVDSPDEREEWMRAIQMVANSLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure and backbone dynamics of the pleckstrin homology domain of the human protein kinase B (PKB/Akt). Interaction with inositol phosphates.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords RAC-beta serine/threonine protein kinase
total genus 17
structure length 111
sequence length 111
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2003-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1p6sA00
1MIXA 4CYEA 2I5FA 2DYQA 5GOWB 2D9XA 4HAYB 4HDQA 2P8VA 1U5FA 1Z87A 4F7HA 3ULCA 4WVFB 2ROVA 1P3RA 3ODXA 4D0NB 3IVFA 5JLJB 2OQBA 1P6SA 2YS1A 1GC6A 1WJMA 2UZSA 1OQNA 2E2XA 2D2QA 2D11A 1NI2A 1TQZA 2CY4A 2Z0QA 1MK9B 2YSZA 3PZDA 2GCLA 1MAIA 2HTHB 5JHGA 4YL8A 5D3XA 2YVCA 3KRXA 2GJYA 3T06A 4Y94A 3DXDA 1EVHA 4A5KA 4F7GA 1DDMA 3PEGA 2HE7A 3G9WA 5LONB 2DA0A 2D10A 2DKQA 2YS3A 4YONA 1DBHA 5DIFB 3D8EA 4GMVA 4A6KA 4CHJA 2Q13A 1UNQA 1M7RA 1FOEA 2COFA 1I7AA 1LW3A 2ADZA 2ZPYA 5DHAB 4HAWB 1X05A 4KAXB 1H10A 4ZRIA 2Z0OA 2D9VA 3FSSA 4KHBB 1TJ6A 4HB2B 2CRFA 5EFXA 2Z0PA 2EMSA 2GS0A 4HHVA 1WGQA 4HB0B 1V89A 3D8FA 2I1JA 2P0DA 3HQCA 2N0YA 3BJIA 1X1GA 1WVHA 4A6FB 4L6EA 1XR0B 1FHWA 4Z2NA 1Y5OA 3A8QA 4DX90 4IFSA 1SHCA 3SUZA 4HB4B 5CLLB 2CODA 4DXAB 1DDWA 4KVGB 1K5DB 1DDVA 3TFMA 1ZC3B 3A8PA 1W1GA 2MWNB 1EAZA 2VSZA 2D9WA 5HE2A 3PSCA 5CLQB 4KHAA 1MKEA 3X23A 1V61A 4WSFA 5J3QA 4HATB 4MY6A 1XODA 5J3TA 2KCJA 2DHKA 4XWXA 2YS5A 2V76A 1XKEA 1V5PA 1X11A 2EC1A 5HE0A 3MDBC 3F5RA 3CXBB 2DX5A 4PNKA 3F0WA 2DKPA 1J0WA 2NZ8B 1EGXA 3VIAA 1TXDA 1J19A 3TO1A 5L81A 4MT7A 4C0AA 1P5TA 2LG1A 1KI1B 3ML4A 5C5BA 4GPTB 5JP4A 2D4QA 1PFJA 4HDOA 1RRPB 2LOZA 4K81A 2JP2A 4HAXB 1B55A 3WYFB 2MKRA 1KZGA 3FEHA 5D3VA 1QC6A 1NTVA 3KRWA 2MFQA 2I5CA 4F7UP 2M38A 1FGZA 4P7IA 4DBBA 2DX1A 3ZDTA 5C6RA 2KUPA 1MK7B 1FHOA 1BTNA 2Y7BA 2H7DA 2YT1A 3LJUX 5FI1A 1AWEA 3U7DA 3BINA 3N7CA 1X1FA 3QBVB 5HE3A 2W2WA 2LKOA 1U27A 1K5GB 5C79A 3PP2A 4BBKA 1FHXA 2FJLA 3VOQA 3ODOA 1BTKA 2RVBB 3TVVA 1U29A 5HE1A 4NY0A 5C16A 3SV1A 1FAOA 1NTYA 1FB8A 2VKIA 1FGYA 2J59M 3RCPA 5KQ4A 3SO6A 4TKNA 2P0FA 1WJ1A 4DX8A 1XD4A 1MIZB 4K17A 3P6AA 2DLWA 5D3YA 1RJ2A 2YRYA 3PVUA 2I1KA 2UZRA 4A6HA 1DROA 5KQ1A 1U5GA 2W2XC 1U5DA 2CAYA 2L2IA 1LB1A 2QKMA 4H8SA 2R0DA 3HK0A 2DYNA 4B6HA 5KCVA 1DYNA 1H4RA 5J3YA 1WI1A 3KSYA 1UPQA 2DN6A 2YF0A 2YT0A 2ROZB 4ZRJA 1BAKA 5D3WA 1OMWA 2K2JA 2NMBA 2MDXA 3CIKA 1SGHA 2R09A 3A98B 1U2BA 2Y8GA 4HAZB 4IOYX 2J0MA 2N23A 5JHHA 4TYZA 2RLOA 2XQNM 1M7EA 1U5EA 5DHFB 4EKUA 3U8ZA 2Y8FA 4GXBA 3V5WA 3M1IB 2RSGA 3PVWA 5FI0A 2K00A 2H7EA 3PG7A 2ELBA 1N3HA 2KGXB 4EJNA 1W1HA 1Y19B 2GCJA 1IRSA 3O96A 1AQCA 4MK0A 1WG7A 4A6FA 2M14A 1QQGA 2DFKA 3ULBA 2EJ8A 1ZM0A 1V88A 2BCJA 3AU5A 1XX0A 2DHJA 3AU4A 1UNRA 2RNRB 5C5BB 4CHMA 3SYXA 1ZSQA 1PLSA 4GMXB 3QWMA 4IAPA 2IFSA 4K2PA 4Z2MB 2OTXA 1ZC4B 3KZ1A 4GN1A 3HW2B 2D9YA 5DH9B 3AJ4A 1Q67A 1UEFA 2J0JA 1I2HA 1ISNA 1V5MA 1GC7A 2ELAA 4WJ7A 3SNHA 3PVLA 5D27A 1PMSA 1V5UA 3DXEA 4HAVB 4PQ0A 2VRWB 1KZ7A 1WGUA 3OANA 4EMOA 2COCA 4HB3B 2DTCA 2AEHA 5DI9B 2W2XD 2K2UA 2RUKB 1XCGA 1MPHA 1UPRA 2PZ1A 4NSWA 3ZVRA 3GYOA 1BWNA 1GG3A 2X18A 2D9ZA 1E5WA 2RGNB 3DXCA 2QKLA 5LOPB 2DHIA 3D8DA 3TCAA 3WA0A 2G35A 2LULA 2J0KA 4K2OA 2IYBA 1ZVRA 2CY5A 1W1DA 2COAA 2UVMA 3GYPA 4GZUA 3NSUA 1X86A 2L1CA 1UNPA 3FM8C 1EF1A 2AL6A 2LOXA 3KY9A 3ODWA 3TW1A 2P0HA 2LYDA 4HAUB 1OY2A 3UZTA 3QIJA 2EMTA 4ZRKA 4KHOA 3P7ZA 3MPXA 1NU2A
chains in the Genus database with same CATH superfamily
1MIXA 4CYEA 2I5FA 4DIXA 3NWDA 4KHBA 2DYQA 5GOWB 2D9XA 4HAYB 4HDQA 2P8VA 1U5FA 1Z87A 4F7HA 3ULCA 4WVFB 2ROVA 1P3RA 2K8EA 3ODXA 4D0NB 3IVFA 5JLJB 2OQBA 1P6SA 2YS1A 1GC6A 1WJMA 2UZSA 1OQNA 2E2XA 2D2QA 2D11A 4QXAB 1NI2A 1TQZA 2CY4A 2Z0QA 3U12A 1MK9B 3NWFA 2YSZA 3PZDA 2GCLA 1MAIA 1T77A 2HTHB 5JHGA 4YL8A 5D3XA 4QJ4B 2YVCA 3KRXA 2GJYA 3T06A 4Y94A 3DXDA 2Z4DA 1EVHA 4A5KA 4F7GA 1DDMA 3PEGA 2HE7A 3G9WA 5LONB 2DA0A 2D10A 2DKQA 2YS3A 4YONA 1DBHA 2ZKMX 3OHMB 5DIFB 3D8EA 4GMVA 4A6KA 4CHJA 2Q13A 1UNQA 1M7RA 1FOEA 2COFA 1I7AA 4GNKB 1LW3A 2ADZA 2ZPYA 5DHAB 4HAWB 1X05A 3A58A 1H10A 4KAXB 4ZRIA 2Z0OA 2KUQA 2D9VA 3FSSA 4KHBB 1TJ6A 4HB2B 2CRFA 5EFXA 2Z0PA 2EMSA 2GS0A 4HHVA 1WGQA 4HB0B 1V89A 3D8FA 2I1JA 2P0DA 3HQCA 2N0YA 3BJIA 1X1GA 1WVHA 4A6FB 4L6EA 1XR0B 1FHWA 4Z2NA 1Y5OA 3A8QA 4DX90 4IFSA 1SHCA 3SUZA 4HB4B 3DCXA 5CLLB 2CODA 4DXAB 1DDWA 4KVGB 1K5DB 1DDVA 3TFMA 1ZC3B 3HIEA 3A8PA 1W1GA 2MWNB 1EAZA 2VSZA 2D9WA 5HE2A 3PSCA 5CLQB 4KHAA 1MKEA 3X23A 1V61A 4WSFA 5J3QA 4HATB 4MY6A 1XODA 5J3TA 2KCJA 2DHKA 4XWXA 2YS5A 2V76A 1XKEA 1V5PA 2Z14A 1X11A 2EC1A 5HE0A 3MDBC 3F5RA 3CXBB 2DX5A 4PNKA 3F0WA 2DKPA 1J0WA 2R2YA 2RRFA 2NZ8B 1EGXA 3VIAA 1TXDA 1J19A 3TO1A 5L81A 3B77A 4MT7A 4C0AA 1P5TA 2LG1A 2NBVA 1KI1B 3ML4A 5C5BA 4GPTB 5JP4A 2D4QA 1PFJA 4HDOA 1RRPB 2LOZA 4K81A 2JP2A 4HAXB 1B55A 3WYFB 2MKRA 1KZGA 3FEHA 5D3VA 1QC6A 1NTVA 3KRWA 2MFQA 2I5CA 4F7UP 2M38A 1FGZA 4P7IA 4DBBA 2DX1A 3ZDTA 5C6RA 4OSNA 2KUPA 1MK7B 1FHOA 1BTNA 3NW8A 2Y7BA 2H7DA 2YT1A 3LJUX 5FI1A 1AWEA 3U7DA 3BINA 3N7CA 1X1FA 3QBVB 5HE3A 2W2WA 2LKOA 1U27A 1K5GB 5C79A 3PP2A 4BBKA 1FHXA 2YT2A 2FJLA 3VOQA 3ODOA 1BTKA 2RVBB 3TVVA 1U29A 5HE1A 3FVCA 4NY0A 5C16A 3SV1A 1FAOA 1NTYA 1FB8A 2VKIA 1FGYA 2J59M 3RCPA 5KQ4A 3SO6A 2FJUB 4TKNA 2P0FA 1WJ1A 4DX8A 1XD4A 1MIZB 4K17A 3P6AA 2DLWA 5D3YA 1RJ2A 2YRYA 3PVUA 2I1KA 2UZRA 4A6HA 1DROA 5KQ1A 1U5GA 2W2XC 1U5DA 2CAYA 2L2IA 4QJ5B 1LB1A 2QKMA 4H8SA 2R0DA 3HK0A 2DYNA 4B6HA 5KCVA 1DYNA 1H4RA 5J3YA 1WI1A 3KSYA 1UPQA 2DN6A 2YF0A 2YT0A 2ROZB 4ZRJA 1BAKA 5D3WA 1MI1A 1OMWA 2K2JA 4GOUA 2NMBA 2MDXA 3CIKA 1SGHA 2R09A 3A98B 1U2BA 2Y8GA 4HAZB 4IOYX 2J0MA 2K49A 2N23A 5JHHA 4TYZA 2RLOA 2XQNM 1M7EA 1U5EA 5DHFB 4EKUA 4CSQA 3U8ZA 2Y8FA 1ZYIA 4GXBA 3V5WA 2Z59A 3M1IB 2RSGA 5M4YB 3PVWA 5FI0A 2K00A 2H7EA 3PG7A 2ELBA 1N3HA 2KGXB 4EJNA 1W1HA 1Y19B 2GCJA 1IRSA 3O96A 1AQCA 4MK0A 1WG7A 4A6FA 2M14A 1QQGA 2DFKA 3ULBA 2EJ8A 1ZM0A 3NWAA 2KR0A 1V88A 2BCJA 5I2MA 3AU5A 1XX0A 2DHJA 3AU4A 1UNRA 2RNRB 5C5BB 4CHMA 3SYXA 1ZSQA 1PLSA 4GMXB 3QWMA 4IAPA 2IFSA 4K2PA 4Z2MB 5IRSA 2OTXA 1ZC4B 3KZ1A 4GN1A 3HW2B 2D9YA 5DH9B 3AJ4A 3HSAA 1Q67A 2GUMA 1UEFA 4QJ3B 2J0JA 1I2HA 1ISNA 1V5MA 1GC7A 2ELAA 4WJ7A 3SNHA 3PVLA 5D27A 1PMSA 4HSIA 1V5UA 3DXEA 4HAVB 4PQ0A 2VRWB 1KZ7A 1WGUA 2KIEA 3OANA 4EMOA 2COCA 4HB3B 2DTCA 2AEHA 5DI9B 2W2XD 2K2UA 2RUKB 2Z13A 1XCGA 1MPHA 1UPRA 2PZ1A 4NSWA 3ZVRA 3GYOA 1BWNA 1GG3A 2X18A 2D9ZA 1E5WA 2RGNB 3DXCA 2QKLA 4L1RA 5LOPB 2DHIA 3D8DA 3TCAA 3WA0A 2G35A 2LULA 2J0KA 4K2OA 2IYBA 1ZVRA 2CY5A 1W1DA 2COAA 2UVMA 3GYPA 4GZUA 4OT1A 3NSUA 1X86A 2L1CA 1UNPA 3FM8C 1EF1A 2AL6A 2KIGA 2LOXA 3KY9A 3ODWA 5I2SA 3TW1A 5LG4B 2P0HA 2LYDA 4HAUB 1OY2A 3UZTA 3QIJA 4D6WA 2EMTA 4ZRKA 4KHOA 3P7ZA 3MPXA 1NU2A
chains in the Genus database with same CATH topology
1MIXA 4CYEA 2I5FA 2DYQA 5GOWB 2D9XA 4HAYB 4HDQA 2P8VA 1U5FA 1Z87A 4F7HA 3ULCA 4WVFB 2ROVA 1P3RA 3ODXA 4D0NB 3IVFA 5JLJB 2OQBA 1P6SA 2YS1A 1GC6A 1WJMA 2UZSA 1OQNA 2E2XA 2D2QA 2D11A 1NI2A 1TQZA 2CY4A 2Z0QA 1MK9B 2YSZA 3PZDA 2GCLA 1MAIA 2HTHB 5JHGA 4YL8A 5D3XA 2YVCA 3KRXA 2GJYA 3T06A 4Y94A 3DXDA 1EVHA 4A5KA 4F7GA 1DDMA 3PEGA 2HE7A 3G9WA 5LONB 2DA0A 2D10A 2DKQA 2YS3A 4YONA 1DBHA 5DIFB 3D8EA 4GMVA 4A6KA 4CHJA 2Q13A 1UNQA 1M7RA 1FOEA 2COFA 1I7AA 1LW3A 2ADZA 2ZPYA 5DHAB 4HAWB 1X05A 4KAXB 1H10A 4ZRIA 2Z0OA 2D9VA 3FSSA 4KHBB 1TJ6A 4HB2B 2CRFA 5EFXA 2Z0PA 2EMSA 2GS0A 4HHVA 1WGQA 4HB0B 1V89A 3D8FA 2I1JA 2P0DA 3HQCA 2N0YA 3BJIA 1X1GA 1WVHA 4A6FB 4L6EA 1XR0B 1FHWA 4Z2NA 1Y5OA 3A8QA 4DX90 4IFSA 1SHCA 3SUZA 4HB4B 5CLLB 2CODA 4DXAB 1DDWA 4KVGB 1K5DB 1DDVA 3TFMA 1ZC3B 3A8PA 1W1GA 2MWNB 1EAZA 2VSZA 2D9WA 5HE2A 3PSCA 5CLQB 4KHAA 1MKEA 3X23A 1V61A 4WSFA 5J3QA 4HATB 4MY6A 1XODA 5J3TA 2KCJA 2DHKA 4XWXA 2YS5A 2V76A 1XKEA 1V5PA 1X11A 2EC1A 5HE0A 3MDBC 3F5RA 3CXBB 2DX5A 4PNKA 3F0WA 2DKPA 1J0WA 2NZ8B 1EGXA 3VIAA 1TXDA 1J19A 3TO1A 5L81A 4MT7A 4C0AA 1P5TA 2LG1A 1KI1B 3ML4A 5C5BA 4GPTB 5JP4A 2D4QA 1PFJA 4HDOA 1RRPB 2LOZA 4K81A 2JP2A 4HAXB 1B55A 3WYFB 2MKRA 1KZGA 3FEHA 5D3VA 1QC6A 1NTVA 3KRWA 2MFQA 2I5CA 4F7UP 2M38A 1FGZA 4P7IA 4DBBA 2DX1A 3ZDTA 5C6RA 2KUPA 1MK7B 1FHOA 1BTNA 2Y7BA 2H7DA 2YT1A 3LJUX 5FI1A 1AWEA 3U7DA 3BINA 3N7CA 1X1FA 3QBVB 5HE3A 2W2WA 2LKOA 1U27A 1K5GB 5C79A 3PP2A 4BBKA 1FHXA 2FJLA 3VOQA 3ODOA 1BTKA 2RVBB 3TVVA 1U29A 5HE1A 4NY0A 5C16A 3SV1A 1FAOA 1NTYA 1FB8A 2VKIA 1FGYA 2J59M 3RCPA 5KQ4A 3SO6A 4TKNA 2P0FA 1WJ1A 4DX8A 1XD4A 1MIZB 4K17A 3P6AA 2DLWA 5D3YA 1RJ2A 2YRYA 3PVUA 2I1KA 2UZRA 4A6HA 1DROA 5KQ1A 1U5GA 2W2XC 1U5DA 2CAYA 2L2IA 1LB1A 2QKMA 4H8SA 2R0DA 3HK0A 2DYNA 4B6HA 5KCVA 1DYNA 1H4RA 5J3YA 1WI1A 3KSYA 1UPQA 2DN6A 2YF0A 2YT0A 2ROZB 4ZRJA 1BAKA 5D3WA 1OMWA 2K2JA 2NMBA 2MDXA 3CIKA 1SGHA 2R09A 3A98B 1U2BA 2Y8GA 4HAZB 4IOYX 2J0MA 2N23A 5JHHA 4TYZA 2RLOA 2XQNM 1M7EA 1U5EA 5DHFB 4EKUA 3U8ZA 2Y8FA 4GXBA 3V5WA 3M1IB 2RSGA 3PVWA 5FI0A 2K00A 2H7EA 3PG7A 2ELBA 1N3HA 2KGXB 4EJNA 1W1HA 1Y19B 2GCJA 1IRSA 3O96A 1AQCA 4MK0A 1WG7A 4A6FA 2M14A 1QQGA 2DFKA 3ULBA 2EJ8A 1ZM0A 1V88A 2BCJA 3AU5A 1XX0A 2DHJA 3AU4A 1UNRA 2RNRB 5C5BB 4CHMA 3SYXA 1ZSQA 1PLSA 4GMXB 3QWMA 4IAPA 2IFSA 4K2PA 4Z2MB 2OTXA 1ZC4B 3KZ1A 4GN1A 3HW2B 2D9YA 5DH9B 3AJ4A 1Q67A 1UEFA 2J0JA 1I2HA 1ISNA 1V5MA 1GC7A 2ELAA 4WJ7A 3SNHA 3PVLA 5D27A 1PMSA 1V5UA 3DXEA 4HAVB 4PQ0A 2VRWB 1KZ7A 1WGUA 3OANA 4EMOA 2COCA 4HB3B 2DTCA 2AEHA 5DI9B 2W2XD 2K2UA 2RUKB 1XCGA 1MPHA 1UPRA 2PZ1A 4NSWA 3ZVRA 3GYOA 1BWNA 1GG3A 2X18A 2D9ZA 1E5WA 2RGNB 3DXCA 2QKLA 5LOPB 2DHIA 3D8DA 3TCAA 3WA0A 2G35A 2LULA 2J0KA 4K2OA 2IYBA 1ZVRA 2CY5A 1W1DA 2COAA 2UVMA 3GYPA 4GZUA 3NSUA 1X86A 2L1CA 1UNPA 3FM8C 1EF1A 2AL6A 2LOXA 3KY9A 3ODWA 3TW1A 2P0HA 2LYDA 4HAUB 1OY2A 3UZTA 3QIJA 2EMTA 4ZRKA 4KHOA 3P7ZA 3MPXA 1NU2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MIX A;  4CYE A;  2I5F A;  2DYQ A;  5GOW B;  2D9X A;  4HAY B;  4HDQ A;  2P8V A;  1U5F A;  1Z87 A;  4F7H A;  3ULC A;  4WVF B;  2ROV A;  1P3R A;  3ODX A;  4D0N B;  3IVF A;  5JLJ B;  2OQB A;  1P6S A;  2YS1 A;  1GC6 A;  1WJM A;  2UZS A;  1OQN A;  2E2X A;  2D2Q A;  2D11 A;  1NI2 A;  1TQZ A;  2CY4 A;  2Z0Q A;  1MK9 B;  2YSZ A;  3PZD A;  2GCL A;  1MAI A;  2HTH B;  5JHG A;  4YL8 A;  5D3X A;  2YVC A;  3KRX A;  2GJY A;  3T06 A;  4Y94 A;  3DXD A;  1EVH A;  4A5K A;  4F7G A;  1DDM A;  3PEG A;  2HE7 A;  3G9W A;  5LON B;  2DA0 A;  2D10 A;  2DKQ A;  2YS3 A;  4YON A;  1DBH A;  5DIF B;  3D8E A;  4GMV A;  4A6K A;  4CHJ A;  2Q13 A;  1UNQ A;  1M7R A;  1FOE A;  2COF A;  1I7A A;  1LW3 A;  2ADZ A;  2ZPY A;  5DHA B;  4HAW B;  1X05 A;  4KAX B;  1H10 A;  4ZRI A;  2Z0O A;  2D9V A;  3FSS A;  4KHB B;  1TJ6 A;  4HB2 B;  2CRF A;  5EFX A;  2Z0P A;  2EMS A;  2GS0 A;  4HHV A;  1WGQ A;  4HB0 B;  1V89 A;  3D8F A;  2I1J A;  2P0D A;  3HQC A;  2N0Y A;  3BJI A;  1X1G A;  1WVH A;  4A6F B;  4L6E A;  1XR0 B;  1FHW A;  4Z2N A;  1Y5O A;  3A8Q A;  4DX9 0;  4IFS A;  1SHC A;  3SUZ A;  4HB4 B;  5CLL B;  2COD A;  4DXA B;  1DDW A;  4KVG B;  1K5D B;  1DDV A;  3TFM A;  1ZC3 B;  3A8P A;  1W1G A;  2MWN B;  1EAZ A;  2VSZ A;  2D9W A;  5HE2 A;  3PSC A;  5CLQ B;  4KHA A;  1MKE A;  3X23 A;  1V61 A;  4WSF A;  5J3Q A;  4HAT B;  4MY6 A;  1XOD A;  5J3T A;  2KCJ A;  2DHK A;  4XWX A;  2YS5 A;  2V76 A;  1XKE A;  1V5P A;  1X11 A;  2EC1 A;  5HE0 A;  3MDB C;  3F5R A;  3CXB B;  2DX5 A;  4PNK A;  3F0W A;  2DKP A;  1J0W A;  2NZ8 B;  1EGX A;  3VIA A;  1TXD A;  1J19 A;  3TO1 A;  5L81 A;  4MT7 A;  4C0A A;  1P5T A;  2LG1 A;  1KI1 B;  3ML4 A;  5C5B A;  4GPT B;  5JP4 A;  2D4Q A;  1PFJ A;  4HDO A;  1RRP B;  2LOZ A;  4K81 A;  2JP2 A;  4HAX B;  1B55 A;  3WYF B;  2MKR A;  1KZG A;  3FEH A;  5D3V A;  1QC6 A;  1NTV A;  3KRW A;  2MFQ A;  2I5C A;  4F7U P;  2M38 A;  1FGZ A;  4P7I A;  4DBB A;  2DX1 A;  3ZDT A;  5C6R A;  2KUP A;  1MK7 B;  1FHO A;  1BTN A;  2Y7B A;  2H7D A;  2YT1 A;  3LJU X;  5FI1 A;  1AWE A;  3U7D A;  3BIN A;  3N7C A;  1X1F A;  3QBV B;  5HE3 A;  2W2W A;  2LKO A;  1U27 A;  1K5G B;  5C79 A;  3PP2 A;  4BBK A;  1FHX A;  2FJL A;  3VOQ A;  3ODO A;  1BTK A;  2RVB B;  3TVV A;  1U29 A;  5HE1 A;  4NY0 A;  5C16 A;  3SV1 A;  1FAO A;  1NTY A;  1FB8 A;  2VKI A;  1FGY A;  2J59 M;  3RCP A;  5KQ4 A;  3SO6 A;  4TKN A;  2P0F A;  1WJ1 A;  4DX8 A;  1XD4 A;  1MIZ B;  4K17 A;  3P6A A;  2DLW A;  5D3Y A;  1RJ2 A;  2YRY A;  3PVU A;  2I1K A;  2UZR A;  4A6H A;  1DRO A;  5KQ1 A;  1U5G A;  2W2X C;  1U5D A;  2CAY A;  2L2I A;  1LB1 A;  2QKM A;  4H8S A;  2R0D A;  3HK0 A;  2DYN A;  4B6H A;  5KCV A;  1DYN A;  1H4R A;  5J3Y A;  1WI1 A;  3KSY A;  1UPQ A;  2DN6 A;  2YF0 A;  2YT0 A;  2ROZ B;  4ZRJ A;  1BAK A;  5D3W A;  1OMW A;  2K2J A;  2NMB A;  2MDX A;  3CIK A;  1SGH A;  2R09 A;  3A98 B;  1U2B A;  2Y8G A;  4HAZ B;  4IOY X;  2J0M A;  2N23 A;  5JHH A;  4TYZ A;  2RLO A;  2XQN M;  1M7E A;  1U5E A;  5DHF B;  4EKU A;  3U8Z A;  2Y8F A;  4GXB A;  3V5W A;  3M1I B;  2RSG A;  3PVW A;  5FI0 A;  2K00 A;  2H7E A;  3PG7 A;  2ELB A;  1N3H A;  2KGX B;  4EJN A;  1W1H A;  1Y19 B;  2GCJ A;  1IRS A;  3O96 A;  1AQC A;  4MK0 A;  1WG7 A;  4A6F A;  2M14 A;  1QQG A;  2DFK A;  3ULB A;  2EJ8 A;  1ZM0 A;  1V88 A;  2BCJ A;  3AU5 A;  1XX0 A;  2DHJ A;  3AU4 A;  1UNR A;  2RNR B;  5C5B B;  4CHM A;  3SYX A;  1ZSQ A;  1PLS A;  4GMX B;  3QWM A;  4IAP A;  2IFS A;  4K2P A;  4Z2M B;  2OTX A;  1ZC4 B;  3KZ1 A;  4GN1 A;  3HW2 B;  2D9Y A;  5DH9 B;  3AJ4 A;  1Q67 A;  1UEF A;  2J0J A;  1I2H A;  1ISN A;  1V5M A;  1GC7 A;  2ELA A;  4WJ7 A;  3SNH A;  3PVL A;  5D27 A;  1PMS A;  1V5U A;  3DXE A;  4HAV B;  4PQ0 A;  2VRW B;  1KZ7 A;  1WGU A;  3OAN A;  4EMO A;  2COC A;  4HB3 B;  2DTC A;  2AEH A;  5DI9 B;  2W2X D;  2K2U A;  2RUK B;  1XCG A;  1MPH A;  1UPR A;  2PZ1 A;  4NSW A;  3ZVR A;  3GYO A;  1BWN A;  1GG3 A;  2X18 A;  2D9Z A;  1E5W A;  2RGN B;  3DXC A;  2QKL A;  5LOP B;  2DHI A;  3D8D A;  3TCA A;  3WA0 A;  2G35 A;  2LUL A;  2J0K A;  4K2O A;  2IYB A;  1ZVR A;  2CY5 A;  1W1D A;  2COA A;  2UVM A;  3GYP A;  4GZU A;  3NSU A;  1X86 A;  2L1C A;  1UNP A;  3FM8 C;  1EF1 A;  2AL6 A;  2LOX A;  3KY9 A;  3ODW A;  3TW1 A;  2P0H A;  2LYD A;  4HAU B;  1OY2 A;  3UZT A;  3QIJ A;  2EMT A;  4ZRK A;  4KHO A;  3P7Z A;  3MPX A;  1NU2 A; 
#chains in the Genus database with same CATH topology
 1MIX A;  4CYE A;  2I5F A;  4DIX A;  3NWD A;  4KHB A;  2DYQ A;  5GOW B;  2D9X A;  4HAY B;  4HDQ A;  2P8V A;  1U5F A;  1Z87 A;  4F7H A;  3ULC A;  4WVF B;  2ROV A;  1P3R A;  2K8E A;  3ODX A;  4D0N B;  3IVF A;  5JLJ B;  2OQB A;  1P6S A;  2YS1 A;  1GC6 A;  1WJM A;  2UZS A;  1OQN A;  2E2X A;  2D2Q A;  2D11 A;  4QXA B;  1NI2 A;  1TQZ A;  2CY4 A;  2Z0Q A;  3U12 A;  1MK9 B;  3NWF A;  2YSZ A;  3PZD A;  2GCL A;  1MAI A;  1T77 A;  2HTH B;  5JHG A;  4YL8 A;  5D3X A;  4QJ4 B;  2YVC A;  3KRX A;  2GJY A;  3T06 A;  4Y94 A;  3DXD A;  2Z4D A;  1EVH A;  4A5K A;  4F7G A;  1DDM A;  3PEG A;  2HE7 A;  3G9W A;  5LON B;  2DA0 A;  2D10 A;  2DKQ A;  2YS3 A;  4YON A;  1DBH A;  2ZKM X;  3OHM B;  5DIF B;  3D8E A;  4GMV A;  4A6K A;  4CHJ A;  2Q13 A;  1UNQ A;  1M7R A;  1FOE A;  2COF A;  1I7A A;  4GNK B;  1LW3 A;  2ADZ A;  2ZPY A;  5DHA B;  4HAW B;  1X05 A;  3A58 A;  1H10 A;  4KAX B;  4ZRI A;  2Z0O A;  2KUQ A;  2D9V A;  3FSS A;  4KHB B;  1TJ6 A;  4HB2 B;  2CRF A;  5EFX A;  2Z0P A;  2EMS A;  2GS0 A;  4HHV A;  1WGQ A;  4HB0 B;  1V89 A;  3D8F A;  2I1J A;  2P0D A;  3HQC A;  2N0Y A;  3BJI A;  1X1G A;  1WVH A;  4A6F B;  4L6E A;  1XR0 B;  1FHW A;  4Z2N A;  1Y5O A;  3A8Q A;  4DX9 0;  4IFS A;  1SHC A;  3SUZ A;  4HB4 B;  3DCX A;  5CLL B;  2COD A;  4DXA B;  1DDW A;  4KVG B;  1K5D B;  1DDV A;  3TFM A;  1ZC3 B;  3HIE A;  3A8P A;  1W1G A;  2MWN B;  1EAZ A;  2VSZ A;  2D9W A;  5HE2 A;  3PSC A;  5CLQ B;  4KHA A;  1MKE A;  3X23 A;  1V61 A;  4WSF A;  5J3Q A;  4HAT B;  4MY6 A;  1XOD A;  5J3T A;  2KCJ A;  2DHK A;  4XWX A;  2YS5 A;  2V76 A;  1XKE A;  1V5P A;  2Z14 A;  1X11 A;  2EC1 A;  5HE0 A;  3MDB C;  3F5R A;  3CXB B;  2DX5 A;  4PNK A;  3F0W A;  2DKP A;  1J0W A;  2R2Y A;  2RRF A;  2NZ8 B;  1EGX A;  3VIA A;  1TXD A;  1J19 A;  3TO1 A;  5L81 A;  3B77 A;  4MT7 A;  4C0A A;  1P5T A;  2LG1 A;  2NBV A;  1KI1 B;  3ML4 A;  5C5B A;  4GPT B;  5JP4 A;  2D4Q A;  1PFJ A;  4HDO A;  1RRP B;  2LOZ A;  4K81 A;  2JP2 A;  4HAX B;  1B55 A;  3WYF B;  2MKR A;  1KZG A;  3FEH A;  5D3V A;  1QC6 A;  1NTV A;  3KRW A;  2MFQ A;  2I5C A;  4F7U P;  2M38 A;  1FGZ A;  4P7I A;  4DBB A;  2DX1 A;  3ZDT A;  5C6R A;  4OSN A;  2KUP A;  1MK7 B;  1FHO A;  1BTN A;  3NW8 A;  2Y7B A;  2H7D A;  2YT1 A;  3LJU X;  5FI1 A;  1AWE A;  3U7D A;  3BIN A;  3N7C A;  1X1F A;  3QBV B;  5HE3 A;  2W2W A;  2LKO A;  1U27 A;  1K5G B;  5C79 A;  3PP2 A;  4BBK A;  1FHX A;  2YT2 A;  2FJL A;  3VOQ A;  3ODO A;  1BTK A;  2RVB B;  3TVV A;  1U29 A;  5HE1 A;  3FVC A;  4NY0 A;  5C16 A;  3SV1 A;  1FAO A;  1NTY A;  1FB8 A;  2VKI A;  1FGY A;  2J59 M;  3RCP A;  5KQ4 A;  3SO6 A;  2FJU B;  4TKN A;  2P0F A;  1WJ1 A;  4DX8 A;  1XD4 A;  1MIZ B;  4K17 A;  3P6A A;  2DLW A;  5D3Y A;  1RJ2 A;  2YRY A;  3PVU A;  2I1K A;  2UZR A;  4A6H A;  1DRO A;  5KQ1 A;  1U5G A;  2W2X C;  1U5D A;  2CAY A;  2L2I A;  4QJ5 B;  1LB1 A;  2QKM A;  4H8S A;  2R0D A;  3HK0 A;  2DYN A;  4B6H A;  5KCV A;  1DYN A;  1H4R A;  5J3Y A;  1WI1 A;  3KSY A;  1UPQ A;  2DN6 A;  2YF0 A;  2YT0 A;  2ROZ B;  4ZRJ A;  1BAK A;  5D3W A;  1MI1 A;  1OMW A;  2K2J A;  4GOU A;  2NMB A;  2MDX A;  3CIK A;  1SGH A;  2R09 A;  3A98 B;  1U2B A;  2Y8G A;  4HAZ B;  4IOY X;  2J0M A;  2K49 A;  2N23 A;  5JHH A;  4TYZ A;  2RLO A;  2XQN M;  1M7E A;  1U5E A;  5DHF B;  4EKU A;  4CSQ A;  3U8Z A;  2Y8F A;  1ZYI A;  4GXB A;  3V5W A;  2Z59 A;  3M1I B;  2RSG A;  5M4Y B;  3PVW A;  5FI0 A;  2K00 A;  2H7E A;  3PG7 A;  2ELB A;  1N3H A;  2KGX B;  4EJN A;  1W1H A;  1Y19 B;  2GCJ A;  1IRS A;  3O96 A;  1AQC A;  4MK0 A;  1WG7 A;  4A6F A;  2M14 A;  1QQG A;  2DFK A;  3ULB A;  2EJ8 A;  1ZM0 A;  3NWA A;  2KR0 A;  1V88 A;  2BCJ A;  5I2M A;  3AU5 A;  1XX0 A;  2DHJ A;  3AU4 A;  1UNR A;  2RNR B;  5C5B B;  4CHM A;  3SYX A;  1ZSQ A;  1PLS A;  4GMX B;  3QWM A;  4IAP A;  2IFS A;  4K2P A;  4Z2M B;  5IRS A;  2OTX A;  1ZC4 B;  3KZ1 A;  4GN1 A;  3HW2 B;  2D9Y A;  5DH9 B;  3AJ4 A;  3HSA A;  1Q67 A;  2GUM A;  1UEF A;  4QJ3 B;  2J0J A;  1I2H A;  1ISN A;  1V5M A;  1GC7 A;  2ELA A;  4WJ7 A;  3SNH A;  3PVL A;  5D27 A;  1PMS A;  4HSI A;  1V5U A;  3DXE A;  4HAV B;  4PQ0 A;  2VRW B;  1KZ7 A;  1WGU A;  2KIE A;  3OAN A;  4EMO A;  2COC A;  4HB3 B;  2DTC A;  2AEH A;  5DI9 B;  2W2X D;  2K2U A;  2RUK B;  2Z13 A;  1XCG A;  1MPH A;  1UPR A;  2PZ1 A;  4NSW A;  3ZVR A;  3GYO A;  1BWN A;  1GG3 A;  2X18 A;  2D9Z A;  1E5W A;  2RGN B;  3DXC A;  2QKL A;  4L1R A;  5LOP B;  2DHI A;  3D8D A;  3TCA A;  3WA0 A;  2G35 A;  2LUL A;  2J0K A;  4K2O A;  2IYB A;  1ZVR A;  2CY5 A;  1W1D A;  2COA A;  2UVM A;  3GYP A;  4GZU A;  4OT1 A;  3NSU A;  1X86 A;  2L1C A;  1UNP A;  3FM8 C;  1EF1 A;  2AL6 A;  2KIG A;  2LOX A;  3KY9 A;  3ODW A;  5I2S A;  3TW1 A;  5LG4 B;  2P0H A;  2LYD A;  4HAU B;  1OY2 A;  3UZT A;  3QIJ A;  4D6W A;  2EMT A;  4ZRK A;  4KHO A;  3P7Z A;  3MPX A;  1NU2 A; 
#chains in the Genus database with same CATH homology
 1MIX A;  4CYE A;  2I5F A;  2DYQ A;  5GOW B;  2D9X A;  4HAY B;  4HDQ A;  2P8V A;  1U5F A;  1Z87 A;  4F7H A;  3ULC A;  4WVF B;  2ROV A;  1P3R A;  3ODX A;  4D0N B;  3IVF A;  5JLJ B;  2OQB A;  1P6S A;  2YS1 A;  1GC6 A;  1WJM A;  2UZS A;  1OQN A;  2E2X A;  2D2Q A;  2D11 A;  1NI2 A;  1TQZ A;  2CY4 A;  2Z0Q A;  1MK9 B;  2YSZ A;  3PZD A;  2GCL A;  1MAI A;  2HTH B;  5JHG A;  4YL8 A;  5D3X A;  2YVC A;  3KRX A;  2GJY A;  3T06 A;  4Y94 A;  3DXD A;  1EVH A;  4A5K A;  4F7G A;  1DDM A;  3PEG A;  2HE7 A;  3G9W A;  5LON B;  2DA0 A;  2D10 A;  2DKQ A;  2YS3 A;  4YON A;  1DBH A;  5DIF B;  3D8E A;  4GMV A;  4A6K A;  4CHJ A;  2Q13 A;  1UNQ A;  1M7R A;  1FOE A;  2COF A;  1I7A A;  1LW3 A;  2ADZ A;  2ZPY A;  5DHA B;  4HAW B;  1X05 A;  4KAX B;  1H10 A;  4ZRI A;  2Z0O A;  2D9V A;  3FSS A;  4KHB B;  1TJ6 A;  4HB2 B;  2CRF A;  5EFX A;  2Z0P A;  2EMS A;  2GS0 A;  4HHV A;  1WGQ A;  4HB0 B;  1V89 A;  3D8F A;  2I1J A;  2P0D A;  3HQC A;  2N0Y A;  3BJI A;  1X1G A;  1WVH A;  4A6F B;  4L6E A;  1XR0 B;  1FHW A;  4Z2N A;  1Y5O A;  3A8Q A;  4DX9 0;  4IFS A;  1SHC A;  3SUZ A;  4HB4 B;  5CLL B;  2COD A;  4DXA B;  1DDW A;  4KVG B;  1K5D B;  1DDV A;  3TFM A;  1ZC3 B;  3A8P A;  1W1G A;  2MWN B;  1EAZ A;  2VSZ A;  2D9W A;  5HE2 A;  3PSC A;  5CLQ B;  4KHA A;  1MKE A;  3X23 A;  1V61 A;  4WSF A;  5J3Q A;  4HAT B;  4MY6 A;  1XOD A;  5J3T A;  2KCJ A;  2DHK A;  4XWX A;  2YS5 A;  2V76 A;  1XKE A;  1V5P A;  1X11 A;  2EC1 A;  5HE0 A;  3MDB C;  3F5R A;  3CXB B;  2DX5 A;  4PNK A;  3F0W A;  2DKP A;  1J0W A;  2NZ8 B;  1EGX A;  3VIA A;  1TXD A;  1J19 A;  3TO1 A;  5L81 A;  4MT7 A;  4C0A A;  1P5T A;  2LG1 A;  1KI1 B;  3ML4 A;  5C5B A;  4GPT B;  5JP4 A;  2D4Q A;  1PFJ A;  4HDO A;  1RRP B;  2LOZ A;  4K81 A;  2JP2 A;  4HAX B;  1B55 A;  3WYF B;  2MKR A;  1KZG A;  3FEH A;  5D3V A;  1QC6 A;  1NTV A;  3KRW A;  2MFQ A;  2I5C A;  4F7U P;  2M38 A;  1FGZ A;  4P7I A;  4DBB A;  2DX1 A;  3ZDT A;  5C6R A;  2KUP A;  1MK7 B;  1FHO A;  1BTN A;  2Y7B A;  2H7D A;  2YT1 A;  3LJU X;  5FI1 A;  1AWE A;  3U7D A;  3BIN A;  3N7C A;  1X1F A;  3QBV B;  5HE3 A;  2W2W A;  2LKO A;  1U27 A;  1K5G B;  5C79 A;  3PP2 A;  4BBK A;  1FHX A;  2FJL A;  3VOQ A;  3ODO A;  1BTK A;  2RVB B;  3TVV A;  1U29 A;  5HE1 A;  4NY0 A;  5C16 A;  3SV1 A;  1FAO A;  1NTY A;  1FB8 A;  2VKI A;  1FGY A;  2J59 M;  3RCP A;  5KQ4 A;  3SO6 A;  4TKN A;  2P0F A;  1WJ1 A;  4DX8 A;  1XD4 A;  1MIZ B;  4K17 A;  3P6A A;  2DLW A;  5D3Y A;  1RJ2 A;  2YRY A;  3PVU A;  2I1K A;  2UZR A;  4A6H A;  1DRO A;  5KQ1 A;  1U5G A;  2W2X C;  1U5D A;  2CAY A;  2L2I A;  1LB1 A;  2QKM A;  4H8S A;  2R0D A;  3HK0 A;  2DYN A;  4B6H A;  5KCV A;  1DYN A;  1H4R A;  5J3Y A;  1WI1 A;  3KSY A;  1UPQ A;  2DN6 A;  2YF0 A;  2YT0 A;  2ROZ B;  4ZRJ A;  1BAK A;  5D3W A;  1OMW A;  2K2J A;  2NMB A;  2MDX A;  3CIK A;  1SGH A;  2R09 A;  3A98 B;  1U2B A;  2Y8G A;  4HAZ B;  4IOY X;  2J0M A;  2N23 A;  5JHH A;  4TYZ A;  2RLO A;  2XQN M;  1M7E A;  1U5E A;  5DHF B;  4EKU A;  3U8Z A;  2Y8F A;  4GXB A;  3V5W A;  3M1I B;  2RSG A;  3PVW A;  5FI0 A;  2K00 A;  2H7E A;  3PG7 A;  2ELB A;  1N3H A;  2KGX B;  4EJN A;  1W1H A;  1Y19 B;  2GCJ A;  1IRS A;  3O96 A;  1AQC A;  4MK0 A;  1WG7 A;  4A6F A;  2M14 A;  1QQG A;  2DFK A;  3ULB A;  2EJ8 A;  1ZM0 A;  1V88 A;  2BCJ A;  3AU5 A;  1XX0 A;  2DHJ A;  3AU4 A;  1UNR A;  2RNR B;  5C5B B;  4CHM A;  3SYX A;  1ZSQ A;  1PLS A;  4GMX B;  3QWM A;  4IAP A;  2IFS A;  4K2P A;  4Z2M B;  2OTX A;  1ZC4 B;  3KZ1 A;  4GN1 A;  3HW2 B;  2D9Y A;  5DH9 B;  3AJ4 A;  1Q67 A;  1UEF A;  2J0J A;  1I2H A;  1ISN A;  1V5M A;  1GC7 A;  2ELA A;  4WJ7 A;  3SNH A;  3PVL A;  5D27 A;  1PMS A;  1V5U A;  3DXE A;  4HAV B;  4PQ0 A;  2VRW B;  1KZ7 A;  1WGU A;  3OAN A;  4EMO A;  2COC A;  4HB3 B;  2DTC A;  2AEH A;  5DI9 B;  2W2X D;  2K2U A;  2RUK B;  1XCG A;  1MPH A;  1UPR A;  2PZ1 A;  4NSW A;  3ZVR A;  3GYO A;  1BWN A;  1GG3 A;  2X18 A;  2D9Z A;  1E5W A;  2RGN B;  3DXC A;  2QKL A;  5LOP B;  2DHI A;  3D8D A;  3TCA A;  3WA0 A;  2G35 A;  2LUL A;  2J0K A;  4K2O A;  2IYB A;  1ZVR A;  2CY5 A;  1W1D A;  2COA A;  2UVM A;  3GYP A;  4GZU A;  3NSU A;  1X86 A;  2L1C A;  1UNP A;  3FM8 C;  1EF1 A;  2AL6 A;  2LOX A;  3KY9 A;  3ODW A;  3TW1 A;  2P0H A;  2LYD A;  4HAU B;  1OY2 A;  3UZT A;  3QIJ A;  2EMT A;  4ZRK A;  4KHO A;  3P7Z A;  3MPX A;  1NU2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...