1P6SA

Solution structure of the pleckstrin homology domain of human protein kinase b beta (pkb/akt)
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
111
structure length
111
Chain Sequence
MNEVSVIKEGWLHKRGEYIKTWRPRYFLLKSDGSFIGYKERPEAPDQTLPPLNNFSVAECQLMKTERPRPNTFVIRCLQWTTVIERTFHVDSPDEREEWMRAIQMVANSLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RAC-beta serine/threonine protein kinase
publication title Solution structure and backbone dynamics of the pleckstrin homology domain of the human protein kinase B (PKB/Akt). Interaction with inositol phosphates.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 17
structure length 111
sequence length 111
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2003-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1p6sA00
3MPXA 3SV1A 1RRPB 1V88A 1U5EA 2Q13A 3ULBA 1UEFA 3GYOA 2LULA 1KI1B 1W1DA 2DHJA 2K2UA 4DX90 1XCGA 2EMSA 5DIFB 2RGNB 1EF1A 1BTNA 2BCJA 5JHGA 1W1HA 1GC7A 1KZ7A 3F0WA 1DROA 4WVFB 4P7IA 2EC1A 1U29A 3A8QA 1V89A 4HAXB 4CYEA 2I1JA 3X23A 2KGXB 2EMTA 5D27A 1MIXA 4GN1A 5JHHA 2R09A 4HB2B 2N0YA 4A5KA 2J59M 2X18A 1U2BA 1H10A 2OQBA 3FEHA 2I5FA 1X11A 3KRXA 1DYNA 1B55A 2YS1A 1LW3A 3P7ZA 4GMXB 3TCAA 3D8DA 5HE1A 3QWMA 5CLQB 2Y8GA 4EKUA 2RUKB 4C0AA 1ZSQA 5DI9B 4A6HA 4YONA 4K2OA 1FHWA 1ZC3B 4DX8A 2AEHA 3FM8C 1OMWA 1EVHA 2VSZA 3ZVRA 2D9XA 2PZ1A 2KUPA 2CAYA 5DHAB 4HAVB 5JP4A 1WGUA 4PNKA 2LKOA 4TYZA 2MKRA 4XWXA 1BAKA 5D3VA 5DH9B 2MFQA 1X1GA 3TO1A 4F7UP 1MAIA 2UZRA 5HE0A 4GZUA 2J0MA 2QKLA 5C6RA 3HW2B 2D11A 1WJMA 2P8VA 4Z2MB 1ZC4B 5D3WA 5GOWB 2E2XA 2YF0A 5EFXA 4KVGB 1UNPA 2CY4A 1WG7A 1WJ1A 1OY2A 2ZPYA 3DXEA 1EAZA 2Z0PA 4A6FA 1M7EA 3TFMA 2RSGA 3AJ4A 3VOQA 2YRYA 1P3RA 3AU4A 4MT7A 3SUZA 2MDXA 5LONB 3PSCA 5KQ1A 2CRFA 4F7GA 2Z0OA 5C16A 2HE7A 4HAWB 3KRWA 1I7AA 1NTYA 1UPQA 2J0KA 2YT1A 5HE2A 1LB1A 3MDBC 2R0DA 4KHBB 1X05A 1DDWA 2LOXA 1J19A 2L1CA 3TW1A 1J0WA 2DHKA 4DXAB 1TQZA 2ROVA 1PMSA 4HAYB 2YVCA 4KHAA 5J3YA 1MPHA 2LG1A 5KQ4A 3ODXA 3ZDTA 4HDOA 1K5GB 4Y94A 1SHCA 3KSYA 3V5WA 2ELBA 2IFSA 5C5BB 1ISNA 4HDQA 2W2XC 3KZ1A 4D0NB 3GYPA 2Y8FA 1OQNA 4NSWA 3RCPA 1E5WA 2H7DA 4TKNA 1GC6A 4Z2NA 4HHVA 2YSZA 1U5FA 1MIZB 3A8PA 2YS3A 1WVHA 4HATB 3A98B 3QBVB 3BJIA 1QC6A 2GJYA 1U5GA 2D9YA 2ROZB 3QIJA 1ZVRA 1WGQA 5J3QA 2EJ8A 4MY6A 5DHFB 2COFA 1N3HA 1P5TA 1V5UA 2V76A 5D3XA 4HB4B 2N23A 1WI1A 3U7DA 1V5MA 2LOZA 2M14A 4IOYX 2LYDA 2RLOA 2P0DA 2Y7BA 4HAUB 2I5CA 2P0FA 1XD4A 2YT0A 3PG7A 2K2JA 1NTVA 4KAXB 4GPTB 5LOPB 1X1FA 5FI0A 2I1KA 3O96A 2G35A 2DYQA 2H7EA 4PQ0A 1PFJA 1KZGA 3CIKA 2AL6A 4WSFA 1XODA 2W2XD 1K5DB 4EMOA 2IYBA 2COCA 2ELAA 3M1IB 1PLSA 2ADZA 3SNHA 4A6KA 4DBBA 3CXBB 5L81A 4F7HA 2DHIA 1M7RA 4ZRIA 1XX0A 1Y5OA 2XQNM 3AU5A 4H8SA 4MK0A 1DDVA 2D9WA 2VKIA 4EJNA 4GXBA 4ZRJA 4WJ7A 1U27A 3PEGA 4K81A 3NSUA 1UNRA 2MWNB 2YS5A 3WA0A 2DTCA 1MK9B 1DDMA 3ML4A 3G9WA 4IAPA 3WYFB 1FGYA 1FB8A 3ODOA 2FJLA 2D2QA 1Z87A 1TJ6A 3VIAA 2DKPA 2GCLA 2RVBB 4HAZB 4YL8A 2CY5A 2DX5A 5KCVA 3PVLA 2D10A 2UVMA 1GG3A 3D8EA 4K2PA 4ZRKA 1DBHA 3BINA 2QKMA 1X86A 4A6FB 5CLLB 3HK0A 5D3YA 2DLWA 2RNRB 1SGHA 1AQCA 3DXCA 3SYXA 3OANA 2COAA 4HB3B 1V61A 2D9VA 3FSSA 2NZ8B 2D4QA 1AWEA 3ULCA 1TXDA 1RJ2A 1FGZA 1Q67A 2GS0A 1U5DA 1FAOA 4L6EA 3IVFA 4NY0A 2GCJA 3F5RA 3HQCA 2W2WA 1MKEA 4GMVA 3LJUX 2KCJA 1NU2A 1BWNA 2DA0A 3PVWA 2CODA 4CHMA 2D9ZA 3N7CA 1IRSA 4KHOA 1BTKA 4HB0B 3SO6A 1H4RA 1V5PA 4CHJA 2Z0QA 5J3TA 2VRWB 2DKQA 3P6AA 4K17A 3U8ZA 1FHXA 2DN6A 2HTHB 5FI1A 2DFKA 3KY9A 2JP2A 2J0JA 1XR0B 1ZM0A 3PP2A 2UZSA 4B6HA 1NI2A 5C5BA 1UPRA 5HE3A 1I2HA 2NMBA 2M38A 3PZDA 3DXDA 2OTXA 2P0HA 2K00A 3T06A 1Y19B 1FHOA 5JLJB 1EGXA 1MK7B 4BBKA 2DX1A 1QQGA 2L2IA 3PVUA 3D8FA 1P6SA 4IFSA 5C79A 3TVVA 1XKEA 1W1GA 1FOEA 3UZTA 2DYNA 3ODWA 1UNQA
chains in the Genus database with same CATH superfamily
3MPXA 3SV1A 1RRPB 1V88A 1U5EA 2Q13A 3ULBA 1UEFA 3GYOA 2LULA 1KI1B 1W1DA 2DHJA 2K2UA 4DX90 1XCGA 2EMSA 5DIFB 2RGNB 1EF1A 1BTNA 2BCJA 5JHGA 1W1HA 1GC7A 3NWDA 3B77A 1KZ7A 3F0WA 2KIGA 1DROA 3A58A 3NWAA 4WVFB 4P7IA 2EC1A 1U29A 3A8QA 1V89A 4HAXB 4CYEA 2I1JA 3X23A 2KGXB 2EMTA 5D27A 1MIXA 4GN1A 4DIXA 5JHHA 2R09A 3HIEA 4HB2B 2N0YA 4A5KA 2J59M 2X18A 1U2BA 1H10A 1ZYIA 2OQBA 3FEHA 4CSQA 2I5FA 1X11A 3KRXA 1DYNA 1B55A 2YS1A 1LW3A 3P7ZA 4GMXB 3TCAA 3D8DA 5HE1A 3QWMA 5CLQB 2Y8GA 4EKUA 2RUKB 4C0AA 1ZSQA 5DI9B 4A6HA 4YONA 3NW8A 4K2OA 1FHWA 4OT1A 1ZC3B 4DX8A 2AEHA 3FM8C 1OMWA 1EVHA 2VSZA 3ZVRA 2D9XA 2K8EA 2PZ1A 2KUPA 2CAYA 5DHAB 4HAVB 5JP4A 2FJUB 1WGUA 4PNKA 2LKOA 4TYZA 2MKRA 4XWXA 1BAKA 3OHMB 5D3VA 5DH9B 2Z4DA 2MFQA 1X1GA 3TO1A 4F7UP 1MAIA 2UZRA 5HE0A 4GZUA 2J0MA 2QKLA 5C6RA 3HW2B 2D11A 1WJMA 2P8VA 4Z2MB 3DCXA 1ZC4B 5D3WA 5GOWB 2E2XA 2YF0A 5EFXA 4KVGB 1UNPA 2CY4A 1WG7A 1WJ1A 1OY2A 2ZPYA 3DXEA 1EAZA 2Z0PA 4A6FA 1M7EA 3TFMA 2RSGA 3AJ4A 2Z14A 3VOQA 2YRYA 1P3RA 3AU4A 4MT7A 3SUZA 2MDXA 5LONB 3PSCA 5KQ1A 2CRFA 4F7GA 3NWFA 2Z0OA 3U12A 5C16A 2HE7A 4HAWB 4GNKB 3KRWA 1I7AA 1NTYA 1UPQA 2J0KA 2YT1A 5HE2A 1LB1A 3MDBC 2R0DA 4KHBB 4D6WA 1X05A 1DDWA 2LOXA 1J19A 2L1CA 3TW1A 1J0WA 2DHKA 4DXAB 1TQZA 2ROVA 1PMSA 4HAYB 2YVCA 4KHAA 5J3YA 4QJ3B 1MPHA 2LG1A 5KQ4A 1T77A 3ODXA 3ZDTA 4HDOA 1K5GB 4Y94A 1SHCA 3KSYA 3V5WA 2ELBA 2IFSA 5C5BB 1ISNA 4HDQA 2W2XC 3KZ1A 4D0NB 3GYPA 4OSNA 2Y8FA 1OQNA 4NSWA 3RCPA 1E5WA 2H7DA 4TKNA 1GC6A 4Z2NA 4HHVA 2YSZA 5I2MA 1U5FA 1MIZB 3A8PA 2YS3A 1WVHA 4HATB 3A98B 3QBVB 3BJIA 1QC6A 2GJYA 1U5GA 2D9YA 2ROZB 3QIJA 1ZVRA 1WGQA 5J3QA 2EJ8A 4MY6A 5DHFB 2COFA 1N3HA 1P5TA 4QXAB 1V5UA 2V76A 5D3XA 4HB4B 2N23A 1WI1A 3U7DA 1V5MA 2LOZA 2M14A 4IOYX 2LYDA 2RLOA 2P0DA 2Y7BA 4HAUB 2I5CA 2P0FA 1XD4A 2YT0A 3PG7A 2K2JA 1NTVA 4KAXB 4GPTB 5LOPB 1X1FA 4GOUA 5FI0A 2I1KA 3O96A 2G35A 2DYQA 2H7EA 2YT2A 4PQ0A 1PFJA 1KZGA 3CIKA 2AL6A 4WSFA 1XODA 2W2XD 1K5DB 4EMOA 5LG4B 2IYBA 2COCA 2ELAA 3M1IB 1PLSA 2ADZA 3SNHA 4A6KA 4DBBA 3CXBB 2ZKMX 5L81A 4F7HA 4QJ4B 2DHIA 1M7RA 4ZRIA 1XX0A 1Y5OA 2XQNM 3AU5A 4H8SA 4MK0A 1DDVA 2KUQA 2D9WA 2VKIA 4EJNA 4GXBA 4ZRJA 4WJ7A 2NBVA 1U27A 3PEGA 4K81A 2RRFA 3NSUA 1UNRA 2MWNB 2YS5A 3WA0A 2DTCA 1MK9B 1MI1A 1DDMA 3ML4A 3G9WA 4IAPA 3WYFB 1FGYA 1FB8A 5IRSA 3ODOA 2FJLA 3FVCA 2D2QA 1Z87A 1TJ6A 3VIAA 2DKPA 2GCLA 2RVBB 2R2YA 4HAZB 2GUMA 4YL8A 2CY5A 2DX5A 5KCVA 3PVLA 2KR0A 2D10A 2UVMA 1GG3A 3D8EA 4K2PA 4ZRKA 1DBHA 3BINA 2QKMA 1X86A 4A6FB 5CLLB 3HK0A 5D3YA 2DLWA 2RNRB 1SGHA 1AQCA 3DXCA 3SYXA 3OANA 2COAA 4HB3B 1V61A 2D9VA 3FSSA 3HSAA 2NZ8B 2D4QA 1AWEA 3ULCA 1TXDA 1RJ2A 1FGZA 1Q67A 2GS0A 1U5DA 1FAOA 4L6EA 3IVFA 4NY0A 2GCJA 3F5RA 3HQCA 2W2WA 1MKEA 4GMVA 3LJUX 2KCJA 4KHBA 1NU2A 1BWNA 2DA0A 4L1RA 3PVWA 2CODA 4CHMA 2D9ZA 3N7CA 1IRSA 5M4YB 4KHOA 4HSIA 1BTKA 4HB0B 3SO6A 2K49A 1H4RA 1V5PA 4CHJA 2Z0QA 5J3TA 2VRWB 2DKQA 3P6AA 4K17A 3U8ZA 1FHXA 2DN6A 2HTHB 5FI1A 2DFKA 3KY9A 2JP2A 2J0JA 1XR0B 5I2SA 1ZM0A 3PP2A 2UZSA 2Z13A 1NI2A 4B6HA 5C5BA 1UPRA 5HE3A 1I2HA 2KIEA 2M38A 2NMBA 3PZDA 3DXDA 2OTXA 2P0HA 2Z59A 2K00A 3T06A 1Y19B 1FHOA 5JLJB 1EGXA 1MK7B 4BBKA 2DX1A 1QQGA 2L2IA 3PVUA 3D8FA 1P6SA 4IFSA 5C79A 3TVVA 1XKEA 1W1GA 4QJ5B 1FOEA 3UZTA 2DYNA 3ODWA 1UNQA
chains in the Genus database with same CATH topology
3MPXA 3SV1A 1RRPB 1V88A 1U5EA 2Q13A 3ULBA 1UEFA 3GYOA 2LULA 1KI1B 1W1DA 2DHJA 2K2UA 4DX90 1XCGA 2EMSA 5DIFB 2RGNB 1EF1A 1BTNA 2BCJA 5JHGA 1W1HA 1GC7A 1KZ7A 3F0WA 1DROA 4WVFB 4P7IA 2EC1A 1U29A 3A8QA 1V89A 4HAXB 4CYEA 2I1JA 3X23A 2KGXB 2EMTA 5D27A 1MIXA 4GN1A 5JHHA 2R09A 4HB2B 2N0YA 4A5KA 2J59M 2X18A 1U2BA 1H10A 2OQBA 3FEHA 2I5FA 1X11A 3KRXA 1DYNA 1B55A 2YS1A 1LW3A 3P7ZA 4GMXB 3TCAA 3D8DA 5HE1A 3QWMA 5CLQB 2Y8GA 4EKUA 2RUKB 4C0AA 1ZSQA 5DI9B 4A6HA 4YONA 4K2OA 1FHWA 1ZC3B 4DX8A 2AEHA 3FM8C 1OMWA 1EVHA 2VSZA 3ZVRA 2D9XA 2PZ1A 2KUPA 2CAYA 5DHAB 4HAVB 5JP4A 1WGUA 4PNKA 2LKOA 4TYZA 2MKRA 4XWXA 1BAKA 5D3VA 5DH9B 2MFQA 1X1GA 3TO1A 4F7UP 1MAIA 2UZRA 5HE0A 4GZUA 2J0MA 2QKLA 5C6RA 3HW2B 2D11A 1WJMA 2P8VA 4Z2MB 1ZC4B 5D3WA 5GOWB 2E2XA 2YF0A 5EFXA 4KVGB 1UNPA 2CY4A 1WG7A 1WJ1A 1OY2A 2ZPYA 3DXEA 1EAZA 2Z0PA 4A6FA 1M7EA 3TFMA 2RSGA 3AJ4A 3VOQA 2YRYA 1P3RA 3AU4A 4MT7A 3SUZA 2MDXA 5LONB 3PSCA 5KQ1A 2CRFA 4F7GA 2Z0OA 5C16A 2HE7A 4HAWB 3KRWA 1I7AA 1NTYA 1UPQA 2J0KA 2YT1A 5HE2A 1LB1A 3MDBC 2R0DA 4KHBB 1X05A 1DDWA 2LOXA 1J19A 2L1CA 3TW1A 1J0WA 2DHKA 4DXAB 1TQZA 2ROVA 1PMSA 4HAYB 2YVCA 4KHAA 5J3YA 1MPHA 2LG1A 5KQ4A 3ODXA 3ZDTA 4HDOA 1K5GB 4Y94A 1SHCA 3KSYA 3V5WA 2ELBA 2IFSA 5C5BB 1ISNA 4HDQA 2W2XC 3KZ1A 4D0NB 3GYPA 2Y8FA 1OQNA 4NSWA 3RCPA 1E5WA 2H7DA 4TKNA 1GC6A 4Z2NA 4HHVA 2YSZA 1U5FA 1MIZB 3A8PA 2YS3A 1WVHA 4HATB 3A98B 3QBVB 3BJIA 1QC6A 2GJYA 1U5GA 2D9YA 2ROZB 3QIJA 1ZVRA 1WGQA 5J3QA 2EJ8A 4MY6A 5DHFB 2COFA 1N3HA 1P5TA 1V5UA 2V76A 5D3XA 4HB4B 2N23A 1WI1A 3U7DA 1V5MA 2LOZA 2M14A 4IOYX 2LYDA 2RLOA 2P0DA 2Y7BA 4HAUB 2I5CA 2P0FA 1XD4A 2YT0A 3PG7A 2K2JA 1NTVA 4KAXB 4GPTB 5LOPB 1X1FA 5FI0A 2I1KA 3O96A 2G35A 2DYQA 2H7EA 4PQ0A 1PFJA 1KZGA 3CIKA 2AL6A 4WSFA 1XODA 2W2XD 1K5DB 4EMOA 2IYBA 2COCA 2ELAA 3M1IB 1PLSA 2ADZA 3SNHA 4A6KA 4DBBA 3CXBB 5L81A 4F7HA 2DHIA 1M7RA 4ZRIA 1XX0A 1Y5OA 2XQNM 3AU5A 4H8SA 4MK0A 1DDVA 2D9WA 2VKIA 4EJNA 4GXBA 4ZRJA 4WJ7A 1U27A 3PEGA 4K81A 3NSUA 1UNRA 2MWNB 2YS5A 3WA0A 2DTCA 1MK9B 1DDMA 3ML4A 3G9WA 4IAPA 3WYFB 1FGYA 1FB8A 3ODOA 2FJLA 2D2QA 1Z87A 1TJ6A 3VIAA 2DKPA 2GCLA 2RVBB 4HAZB 4YL8A 2CY5A 2DX5A 5KCVA 3PVLA 2D10A 2UVMA 1GG3A 3D8EA 4K2PA 4ZRKA 1DBHA 3BINA 2QKMA 1X86A 4A6FB 5CLLB 3HK0A 5D3YA 2DLWA 2RNRB 1SGHA 1AQCA 3DXCA 3SYXA 3OANA 2COAA 4HB3B 1V61A 2D9VA 3FSSA 2NZ8B 2D4QA 1AWEA 3ULCA 1TXDA 1RJ2A 1FGZA 1Q67A 2GS0A 1U5DA 1FAOA 4L6EA 3IVFA 4NY0A 2GCJA 3F5RA 3HQCA 2W2WA 1MKEA 4GMVA 3LJUX 2KCJA 1NU2A 1BWNA 2DA0A 3PVWA 2CODA 4CHMA 2D9ZA 3N7CA 1IRSA 4KHOA 1BTKA 4HB0B 3SO6A 1H4RA 1V5PA 4CHJA 2Z0QA 5J3TA 2VRWB 2DKQA 3P6AA 4K17A 3U8ZA 1FHXA 2DN6A 2HTHB 5FI1A 2DFKA 3KY9A 2JP2A 2J0JA 1XR0B 1ZM0A 3PP2A 2UZSA 4B6HA 1NI2A 5C5BA 1UPRA 5HE3A 1I2HA 2NMBA 2M38A 3PZDA 3DXDA 2OTXA 2P0HA 2K00A 3T06A 1Y19B 1FHOA 5JLJB 1EGXA 1MK7B 4BBKA 2DX1A 1QQGA 2L2IA 3PVUA 3D8FA 1P6SA 4IFSA 5C79A 3TVVA 1XKEA 1W1GA 1FOEA 3UZTA 2DYNA 3ODWA 1UNQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MPX A;  3SV1 A;  1RRP B;  1V88 A;  1U5E A;  2Q13 A;  3ULB A;  1UEF A;  3GYO A;  2LUL A;  1KI1 B;  1W1D A;  2DHJ A;  2K2U A;  4DX9 0;  1XCG A;  2EMS A;  5DIF B;  2RGN B;  1EF1 A;  1BTN A;  2BCJ A;  5JHG A;  1W1H A;  1GC7 A;  1KZ7 A;  3F0W A;  1DRO A;  4WVF B;  4P7I A;  2EC1 A;  1U29 A;  3A8Q A;  1V89 A;  4HAX B;  4CYE A;  2I1J A;  3X23 A;  2KGX B;  2EMT A;  5D27 A;  1MIX A;  4GN1 A;  5JHH A;  2R09 A;  4HB2 B;  2N0Y A;  4A5K A;  2J59 M;  2X18 A;  1U2B A;  1H10 A;  2OQB A;  3FEH A;  2I5F A;  1X11 A;  3KRX A;  1DYN A;  1B55 A;  2YS1 A;  1LW3 A;  3P7Z A;  4GMX B;  3TCA A;  3D8D A;  5HE1 A;  3QWM A;  5CLQ B;  2Y8G A;  4EKU A;  2RUK B;  4C0A A;  1ZSQ A;  5DI9 B;  4A6H A;  4YON A;  4K2O A;  1FHW A;  1ZC3 B;  4DX8 A;  2AEH A;  3FM8 C;  1OMW A;  1EVH A;  2VSZ A;  3ZVR A;  2D9X A;  2PZ1 A;  2KUP A;  2CAY A;  5DHA B;  4HAV B;  5JP4 A;  1WGU A;  4PNK A;  2LKO A;  4TYZ A;  2MKR A;  4XWX A;  1BAK A;  5D3V A;  5DH9 B;  2MFQ A;  1X1G A;  3TO1 A;  4F7U P;  1MAI A;  2UZR A;  5HE0 A;  4GZU A;  2J0M A;  2QKL A;  5C6R A;  3HW2 B;  2D11 A;  1WJM A;  2P8V A;  4Z2M B;  1ZC4 B;  5D3W A;  5GOW B;  2E2X A;  2YF0 A;  5EFX A;  4KVG B;  1UNP A;  2CY4 A;  1WG7 A;  1WJ1 A;  1OY2 A;  2ZPY A;  3DXE A;  1EAZ A;  2Z0P A;  4A6F A;  1M7E A;  3TFM A;  2RSG A;  3AJ4 A;  3VOQ A;  2YRY A;  1P3R A;  3AU4 A;  4MT7 A;  3SUZ A;  2MDX A;  5LON B;  3PSC A;  5KQ1 A;  2CRF A;  4F7G A;  2Z0O A;  5C16 A;  2HE7 A;  4HAW B;  3KRW A;  1I7A A;  1NTY A;  1UPQ A;  2J0K A;  2YT1 A;  5HE2 A;  1LB1 A;  3MDB C;  2R0D A;  4KHB B;  1X05 A;  1DDW A;  2LOX A;  1J19 A;  2L1C A;  3TW1 A;  1J0W A;  2DHK A;  4DXA B;  1TQZ A;  2ROV A;  1PMS A;  4HAY B;  2YVC A;  4KHA A;  5J3Y A;  1MPH A;  2LG1 A;  5KQ4 A;  3ODX A;  3ZDT A;  4HDO A;  1K5G B;  4Y94 A;  1SHC A;  3KSY A;  3V5W A;  2ELB A;  2IFS A;  5C5B B;  1ISN A;  4HDQ A;  2W2X C;  3KZ1 A;  4D0N B;  3GYP A;  2Y8F A;  1OQN A;  4NSW A;  3RCP A;  1E5W A;  2H7D A;  4TKN A;  1GC6 A;  4Z2N A;  4HHV A;  2YSZ A;  1U5F A;  1MIZ B;  3A8P A;  2YS3 A;  1WVH A;  4HAT B;  3A98 B;  3QBV B;  3BJI A;  1QC6 A;  2GJY A;  1U5G A;  2D9Y A;  2ROZ B;  3QIJ A;  1ZVR A;  1WGQ A;  5J3Q A;  2EJ8 A;  4MY6 A;  5DHF B;  2COF A;  1N3H A;  1P5T A;  1V5U A;  2V76 A;  5D3X A;  4HB4 B;  2N23 A;  1WI1 A;  3U7D A;  1V5M A;  2LOZ A;  2M14 A;  4IOY X;  2LYD A;  2RLO A;  2P0D A;  2Y7B A;  4HAU B;  2I5C A;  2P0F A;  1XD4 A;  2YT0 A;  3PG7 A;  2K2J A;  1NTV A;  4KAX B;  4GPT B;  5LOP B;  1X1F A;  5FI0 A;  2I1K A;  3O96 A;  2G35 A;  2DYQ A;  2H7E A;  4PQ0 A;  1PFJ A;  1KZG A;  3CIK A;  2AL6 A;  4WSF A;  1XOD A;  2W2X D;  1K5D B;  4EMO A;  2IYB A;  2COC A;  2ELA A;  3M1I B;  1PLS A;  2ADZ A;  3SNH A;  4A6K A;  4DBB A;  3CXB B;  5L81 A;  4F7H A;  2DHI A;  1M7R A;  4ZRI A;  1XX0 A;  1Y5O A;  2XQN M;  3AU5 A;  4H8S A;  4MK0 A;  1DDV A;  2D9W A;  2VKI A;  4EJN A;  4GXB A;  4ZRJ A;  4WJ7 A;  1U27 A;  3PEG A;  4K81 A;  3NSU A;  1UNR A;  2MWN B;  2YS5 A;  3WA0 A;  2DTC A;  1MK9 B;  1DDM A;  3ML4 A;  3G9W A;  4IAP A;  3WYF B;  1FGY A;  1FB8 A;  3ODO A;  2FJL A;  2D2Q A;  1Z87 A;  1TJ6 A;  3VIA A;  2DKP A;  2GCL A;  2RVB B;  4HAZ B;  4YL8 A;  2CY5 A;  2DX5 A;  5KCV A;  3PVL A;  2D10 A;  2UVM A;  1GG3 A;  3D8E A;  4K2P A;  4ZRK A;  1DBH A;  3BIN A;  2QKM A;  1X86 A;  4A6F B;  5CLL B;  3HK0 A;  5D3Y A;  2DLW A;  2RNR B;  1SGH A;  1AQC A;  3DXC A;  3SYX A;  3OAN A;  2COA A;  4HB3 B;  1V61 A;  2D9V A;  3FSS A;  2NZ8 B;  2D4Q A;  1AWE A;  3ULC A;  1TXD A;  1RJ2 A;  1FGZ A;  1Q67 A;  2GS0 A;  1U5D A;  1FAO A;  4L6E A;  3IVF A;  4NY0 A;  2GCJ A;  3F5R A;  3HQC A;  2W2W A;  1MKE A;  4GMV A;  3LJU X;  2KCJ A;  1NU2 A;  1BWN A;  2DA0 A;  3PVW A;  2COD A;  4CHM A;  2D9Z A;  3N7C A;  1IRS A;  4KHO A;  1BTK A;  4HB0 B;  3SO6 A;  1H4R A;  1V5P A;  4CHJ A;  2Z0Q A;  5J3T A;  2VRW B;  2DKQ A;  3P6A A;  4K17 A;  3U8Z A;  1FHX A;  2DN6 A;  2HTH B;  5FI1 A;  2DFK A;  3KY9 A;  2JP2 A;  2J0J A;  1XR0 B;  1ZM0 A;  3PP2 A;  2UZS A;  4B6H A;  1NI2 A;  5C5B A;  1UPR A;  5HE3 A;  1I2H A;  2NMB A;  2M38 A;  3PZD A;  3DXD A;  2OTX A;  2P0H A;  2K00 A;  3T06 A;  1Y19 B;  1FHO A;  5JLJ B;  1EGX A;  1MK7 B;  4BBK A;  2DX1 A;  1QQG A;  2L2I A;  3PVU A;  3D8F A;  1P6S A;  4IFS A;  5C79 A;  3TVV A;  1XKE A;  1W1G A;  1FOE A;  3UZT A;  2DYN A;  3ODW A;  1UNQ A; 
#chains in the Genus database with same CATH topology
 3MPX A;  3SV1 A;  1RRP B;  1V88 A;  1U5E A;  2Q13 A;  3ULB A;  1UEF A;  3GYO A;  2LUL A;  1KI1 B;  1W1D A;  2DHJ A;  2K2U A;  4DX9 0;  1XCG A;  2EMS A;  5DIF B;  2RGN B;  1EF1 A;  1BTN A;  2BCJ A;  5JHG A;  1W1H A;  1GC7 A;  3NWD A;  3B77 A;  1KZ7 A;  3F0W A;  2KIG A;  1DRO A;  3A58 A;  3NWA A;  4WVF B;  4P7I A;  2EC1 A;  1U29 A;  3A8Q A;  1V89 A;  4HAX B;  4CYE A;  2I1J A;  3X23 A;  2KGX B;  2EMT A;  5D27 A;  1MIX A;  4GN1 A;  4DIX A;  5JHH A;  2R09 A;  3HIE A;  4HB2 B;  2N0Y A;  4A5K A;  2J59 M;  2X18 A;  1U2B A;  1H10 A;  1ZYI A;  2OQB A;  3FEH A;  4CSQ A;  2I5F A;  1X11 A;  3KRX A;  1DYN A;  1B55 A;  2YS1 A;  1LW3 A;  3P7Z A;  4GMX B;  3TCA A;  3D8D A;  5HE1 A;  3QWM A;  5CLQ B;  2Y8G A;  4EKU A;  2RUK B;  4C0A A;  1ZSQ A;  5DI9 B;  4A6H A;  4YON A;  3NW8 A;  4K2O A;  1FHW A;  4OT1 A;  1ZC3 B;  4DX8 A;  2AEH A;  3FM8 C;  1OMW A;  1EVH A;  2VSZ A;  3ZVR A;  2D9X A;  2K8E A;  2PZ1 A;  2KUP A;  2CAY A;  5DHA B;  4HAV B;  5JP4 A;  2FJU B;  1WGU A;  4PNK A;  2LKO A;  4TYZ A;  2MKR A;  4XWX A;  1BAK A;  3OHM B;  5D3V A;  5DH9 B;  2Z4D A;  2MFQ A;  1X1G A;  3TO1 A;  4F7U P;  1MAI A;  2UZR A;  5HE0 A;  4GZU A;  2J0M A;  2QKL A;  5C6R A;  3HW2 B;  2D11 A;  1WJM A;  2P8V A;  4Z2M B;  3DCX A;  1ZC4 B;  5D3W A;  5GOW B;  2E2X A;  2YF0 A;  5EFX A;  4KVG B;  1UNP A;  2CY4 A;  1WG7 A;  1WJ1 A;  1OY2 A;  2ZPY A;  3DXE A;  1EAZ A;  2Z0P A;  4A6F A;  1M7E A;  3TFM A;  2RSG A;  3AJ4 A;  2Z14 A;  3VOQ A;  2YRY A;  1P3R A;  3AU4 A;  4MT7 A;  3SUZ A;  2MDX A;  5LON B;  3PSC A;  5KQ1 A;  2CRF A;  4F7G A;  3NWF A;  2Z0O A;  3U12 A;  5C16 A;  2HE7 A;  4HAW B;  4GNK B;  3KRW A;  1I7A A;  1NTY A;  1UPQ A;  2J0K A;  2YT1 A;  5HE2 A;  1LB1 A;  3MDB C;  2R0D A;  4KHB B;  4D6W A;  1X05 A;  1DDW A;  2LOX A;  1J19 A;  2L1C A;  3TW1 A;  1J0W A;  2DHK A;  4DXA B;  1TQZ A;  2ROV A;  1PMS A;  4HAY B;  2YVC A;  4KHA A;  5J3Y A;  4QJ3 B;  1MPH A;  2LG1 A;  5KQ4 A;  1T77 A;  3ODX A;  3ZDT A;  4HDO A;  1K5G B;  4Y94 A;  1SHC A;  3KSY A;  3V5W A;  2ELB A;  2IFS A;  5C5B B;  1ISN A;  4HDQ A;  2W2X C;  3KZ1 A;  4D0N B;  3GYP A;  4OSN A;  2Y8F A;  1OQN A;  4NSW A;  3RCP A;  1E5W A;  2H7D A;  4TKN A;  1GC6 A;  4Z2N A;  4HHV A;  2YSZ A;  5I2M A;  1U5F A;  1MIZ B;  3A8P A;  2YS3 A;  1WVH A;  4HAT B;  3A98 B;  3QBV B;  3BJI A;  1QC6 A;  2GJY A;  1U5G A;  2D9Y A;  2ROZ B;  3QIJ A;  1ZVR A;  1WGQ A;  5J3Q A;  2EJ8 A;  4MY6 A;  5DHF B;  2COF A;  1N3H A;  1P5T A;  4QXA B;  1V5U A;  2V76 A;  5D3X A;  4HB4 B;  2N23 A;  1WI1 A;  3U7D A;  1V5M A;  2LOZ A;  2M14 A;  4IOY X;  2LYD A;  2RLO A;  2P0D A;  2Y7B A;  4HAU B;  2I5C A;  2P0F A;  1XD4 A;  2YT0 A;  3PG7 A;  2K2J A;  1NTV A;  4KAX B;  4GPT B;  5LOP B;  1X1F A;  4GOU A;  5FI0 A;  2I1K A;  3O96 A;  2G35 A;  2DYQ A;  2H7E A;  2YT2 A;  4PQ0 A;  1PFJ A;  1KZG A;  3CIK A;  2AL6 A;  4WSF A;  1XOD A;  2W2X D;  1K5D B;  4EMO A;  5LG4 B;  2IYB A;  2COC A;  2ELA A;  3M1I B;  1PLS A;  2ADZ A;  3SNH A;  4A6K A;  4DBB A;  3CXB B;  2ZKM X;  5L81 A;  4F7H A;  4QJ4 B;  2DHI A;  1M7R A;  4ZRI A;  1XX0 A;  1Y5O A;  2XQN M;  3AU5 A;  4H8S A;  4MK0 A;  1DDV A;  2KUQ A;  2D9W A;  2VKI A;  4EJN A;  4GXB A;  4ZRJ A;  4WJ7 A;  2NBV A;  1U27 A;  3PEG A;  4K81 A;  2RRF A;  3NSU A;  1UNR A;  2MWN B;  2YS5 A;  3WA0 A;  2DTC A;  1MK9 B;  1MI1 A;  1DDM A;  3ML4 A;  3G9W A;  4IAP A;  3WYF B;  1FGY A;  1FB8 A;  5IRS A;  3ODO A;  2FJL A;  3FVC A;  2D2Q A;  1Z87 A;  1TJ6 A;  3VIA A;  2DKP A;  2GCL A;  2RVB B;  2R2Y A;  4HAZ B;  2GUM A;  4YL8 A;  2CY5 A;  2DX5 A;  5KCV A;  3PVL A;  2KR0 A;  2D10 A;  2UVM A;  1GG3 A;  3D8E A;  4K2P A;  4ZRK A;  1DBH A;  3BIN A;  2QKM A;  1X86 A;  4A6F B;  5CLL B;  3HK0 A;  5D3Y A;  2DLW A;  2RNR B;  1SGH A;  1AQC A;  3DXC A;  3SYX A;  3OAN A;  2COA A;  4HB3 B;  1V61 A;  2D9V A;  3FSS A;  3HSA A;  2NZ8 B;  2D4Q A;  1AWE A;  3ULC A;  1TXD A;  1RJ2 A;  1FGZ A;  1Q67 A;  2GS0 A;  1U5D A;  1FAO A;  4L6E A;  3IVF A;  4NY0 A;  2GCJ A;  3F5R A;  3HQC A;  2W2W A;  1MKE A;  4GMV A;  3LJU X;  2KCJ A;  4KHB A;  1NU2 A;  1BWN A;  2DA0 A;  4L1R A;  3PVW A;  2COD A;  4CHM A;  2D9Z A;  3N7C A;  1IRS A;  5M4Y B;  4KHO A;  4HSI A;  1BTK A;  4HB0 B;  3SO6 A;  2K49 A;  1H4R A;  1V5P A;  4CHJ A;  2Z0Q A;  5J3T A;  2VRW B;  2DKQ A;  3P6A A;  4K17 A;  3U8Z A;  1FHX A;  2DN6 A;  2HTH B;  5FI1 A;  2DFK A;  3KY9 A;  2JP2 A;  2J0J A;  1XR0 B;  5I2S A;  1ZM0 A;  3PP2 A;  2UZS A;  2Z13 A;  1NI2 A;  4B6H A;  5C5B A;  1UPR A;  5HE3 A;  1I2H A;  2KIE A;  2M38 A;  2NMB A;  3PZD A;  3DXD A;  2OTX A;  2P0H A;  2Z59 A;  2K00 A;  3T06 A;  1Y19 B;  1FHO A;  5JLJ B;  1EGX A;  1MK7 B;  4BBK A;  2DX1 A;  1QQG A;  2L2I A;  3PVU A;  3D8F A;  1P6S A;  4IFS A;  5C79 A;  3TVV A;  1XKE A;  1W1G A;  4QJ5 B;  1FOE A;  3UZT A;  2DYN A;  3ODW A;  1UNQ A; 
#chains in the Genus database with same CATH homology
 3MPX A;  3SV1 A;  1RRP B;  1V88 A;  1U5E A;  2Q13 A;  3ULB A;  1UEF A;  3GYO A;  2LUL A;  1KI1 B;  1W1D A;  2DHJ A;  2K2U A;  4DX9 0;  1XCG A;  2EMS A;  5DIF B;  2RGN B;  1EF1 A;  1BTN A;  2BCJ A;  5JHG A;  1W1H A;  1GC7 A;  1KZ7 A;  3F0W A;  1DRO A;  4WVF B;  4P7I A;  2EC1 A;  1U29 A;  3A8Q A;  1V89 A;  4HAX B;  4CYE A;  2I1J A;  3X23 A;  2KGX B;  2EMT A;  5D27 A;  1MIX A;  4GN1 A;  5JHH A;  2R09 A;  4HB2 B;  2N0Y A;  4A5K A;  2J59 M;  2X18 A;  1U2B A;  1H10 A;  2OQB A;  3FEH A;  2I5F A;  1X11 A;  3KRX A;  1DYN A;  1B55 A;  2YS1 A;  1LW3 A;  3P7Z A;  4GMX B;  3TCA A;  3D8D A;  5HE1 A;  3QWM A;  5CLQ B;  2Y8G A;  4EKU A;  2RUK B;  4C0A A;  1ZSQ A;  5DI9 B;  4A6H A;  4YON A;  4K2O A;  1FHW A;  1ZC3 B;  4DX8 A;  2AEH A;  3FM8 C;  1OMW A;  1EVH A;  2VSZ A;  3ZVR A;  2D9X A;  2PZ1 A;  2KUP A;  2CAY A;  5DHA B;  4HAV B;  5JP4 A;  1WGU A;  4PNK A;  2LKO A;  4TYZ A;  2MKR A;  4XWX A;  1BAK A;  5D3V A;  5DH9 B;  2MFQ A;  1X1G A;  3TO1 A;  4F7U P;  1MAI A;  2UZR A;  5HE0 A;  4GZU A;  2J0M A;  2QKL A;  5C6R A;  3HW2 B;  2D11 A;  1WJM A;  2P8V A;  4Z2M B;  1ZC4 B;  5D3W A;  5GOW B;  2E2X A;  2YF0 A;  5EFX A;  4KVG B;  1UNP A;  2CY4 A;  1WG7 A;  1WJ1 A;  1OY2 A;  2ZPY A;  3DXE A;  1EAZ A;  2Z0P A;  4A6F A;  1M7E A;  3TFM A;  2RSG A;  3AJ4 A;  3VOQ A;  2YRY A;  1P3R A;  3AU4 A;  4MT7 A;  3SUZ A;  2MDX A;  5LON B;  3PSC A;  5KQ1 A;  2CRF A;  4F7G A;  2Z0O A;  5C16 A;  2HE7 A;  4HAW B;  3KRW A;  1I7A A;  1NTY A;  1UPQ A;  2J0K A;  2YT1 A;  5HE2 A;  1LB1 A;  3MDB C;  2R0D A;  4KHB B;  1X05 A;  1DDW A;  2LOX A;  1J19 A;  2L1C A;  3TW1 A;  1J0W A;  2DHK A;  4DXA B;  1TQZ A;  2ROV A;  1PMS A;  4HAY B;  2YVC A;  4KHA A;  5J3Y A;  1MPH A;  2LG1 A;  5KQ4 A;  3ODX A;  3ZDT A;  4HDO A;  1K5G B;  4Y94 A;  1SHC A;  3KSY A;  3V5W A;  2ELB A;  2IFS A;  5C5B B;  1ISN A;  4HDQ A;  2W2X C;  3KZ1 A;  4D0N B;  3GYP A;  2Y8F A;  1OQN A;  4NSW A;  3RCP A;  1E5W A;  2H7D A;  4TKN A;  1GC6 A;  4Z2N A;  4HHV A;  2YSZ A;  1U5F A;  1MIZ B;  3A8P A;  2YS3 A;  1WVH A;  4HAT B;  3A98 B;  3QBV B;  3BJI A;  1QC6 A;  2GJY A;  1U5G A;  2D9Y A;  2ROZ B;  3QIJ A;  1ZVR A;  1WGQ A;  5J3Q A;  2EJ8 A;  4MY6 A;  5DHF B;  2COF A;  1N3H A;  1P5T A;  1V5U A;  2V76 A;  5D3X A;  4HB4 B;  2N23 A;  1WI1 A;  3U7D A;  1V5M A;  2LOZ A;  2M14 A;  4IOY X;  2LYD A;  2RLO A;  2P0D A;  2Y7B A;  4HAU B;  2I5C A;  2P0F A;  1XD4 A;  2YT0 A;  3PG7 A;  2K2J A;  1NTV A;  4KAX B;  4GPT B;  5LOP B;  1X1F A;  5FI0 A;  2I1K A;  3O96 A;  2G35 A;  2DYQ A;  2H7E A;  4PQ0 A;  1PFJ A;  1KZG A;  3CIK A;  2AL6 A;  4WSF A;  1XOD A;  2W2X D;  1K5D B;  4EMO A;  2IYB A;  2COC A;  2ELA A;  3M1I B;  1PLS A;  2ADZ A;  3SNH A;  4A6K A;  4DBB A;  3CXB B;  5L81 A;  4F7H A;  2DHI A;  1M7R A;  4ZRI A;  1XX0 A;  1Y5O A;  2XQN M;  3AU5 A;  4H8S A;  4MK0 A;  1DDV A;  2D9W A;  2VKI A;  4EJN A;  4GXB A;  4ZRJ A;  4WJ7 A;  1U27 A;  3PEG A;  4K81 A;  3NSU A;  1UNR A;  2MWN B;  2YS5 A;  3WA0 A;  2DTC A;  1MK9 B;  1DDM A;  3ML4 A;  3G9W A;  4IAP A;  3WYF B;  1FGY A;  1FB8 A;  3ODO A;  2FJL A;  2D2Q A;  1Z87 A;  1TJ6 A;  3VIA A;  2DKP A;  2GCL A;  2RVB B;  4HAZ B;  4YL8 A;  2CY5 A;  2DX5 A;  5KCV A;  3PVL A;  2D10 A;  2UVM A;  1GG3 A;  3D8E A;  4K2P A;  4ZRK A;  1DBH A;  3BIN A;  2QKM A;  1X86 A;  4A6F B;  5CLL B;  3HK0 A;  5D3Y A;  2DLW A;  2RNR B;  1SGH A;  1AQC A;  3DXC A;  3SYX A;  3OAN A;  2COA A;  4HB3 B;  1V61 A;  2D9V A;  3FSS A;  2NZ8 B;  2D4Q A;  1AWE A;  3ULC A;  1TXD A;  1RJ2 A;  1FGZ A;  1Q67 A;  2GS0 A;  1U5D A;  1FAO A;  4L6E A;  3IVF A;  4NY0 A;  2GCJ A;  3F5R A;  3HQC A;  2W2W A;  1MKE A;  4GMV A;  3LJU X;  2KCJ A;  1NU2 A;  1BWN A;  2DA0 A;  3PVW A;  2COD A;  4CHM A;  2D9Z A;  3N7C A;  1IRS A;  4KHO A;  1BTK A;  4HB0 B;  3SO6 A;  1H4R A;  1V5P A;  4CHJ A;  2Z0Q A;  5J3T A;  2VRW B;  2DKQ A;  3P6A A;  4K17 A;  3U8Z A;  1FHX A;  2DN6 A;  2HTH B;  5FI1 A;  2DFK A;  3KY9 A;  2JP2 A;  2J0J A;  1XR0 B;  1ZM0 A;  3PP2 A;  2UZS A;  4B6H A;  1NI2 A;  5C5B A;  1UPR A;  5HE3 A;  1I2H A;  2NMB A;  2M38 A;  3PZD A;  3DXD A;  2OTX A;  2P0H A;  2K00 A;  3T06 A;  1Y19 B;  1FHO A;  5JLJ B;  1EGX A;  1MK7 B;  4BBK A;  2DX1 A;  1QQG A;  2L2I A;  3PVU A;  3D8F A;  1P6S A;  4IFS A;  5C79 A;  3TVV A;  1XKE A;  1W1G A;  1FOE A;  3UZT A;  2DYN A;  3ODW A;  1UNQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...