1P6SA

Solution structure of the pleckstrin homology domain of human protein kinase b beta (pkb/akt)
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
111
structure length
111
Chain Sequence
MNEVSVIKEGWLHKRGEYIKTWRPRYFLLKSDGSFIGYKERPEAPDQTLPPLNNFSVAECQLMKTERPRPNTFVIRCLQWTTVIERTFHVDSPDEREEWMRAIQMVANSLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords RAC-beta serine/threonine protein kinase
publication title Solution structure and backbone dynamics of the pleckstrin homology domain of the human protein kinase B (PKB/Akt). Interaction with inositol phosphates.
pubmed doi rcsb
source organism Homo sapiens
total genus 17
structure length 111
sequence length 111
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2003-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1p6sA00
2FJLA 4HB2B 5KQ1A 4GMVA 4CYEA 3X23A 4HAYB 2J0MA 2YSZA 2ELAA 4MK0A 4WSFA 2EC1A 4MT7A 1M7EA 2DFKA 1I2HA 4GZUA 4B6HA 1RJ2A 2D9ZA 1W1GA 2G35A 2L1CA 5L81A 1ZC4B 5KCVA 2KGXB 4NSWA 1QQGA 1XD4A 2K2UA 2Y7BA 5C79A 5D27A 1K5DB 3HK0A 4GN1A 3PVLA 2W2XD 2RNRB 3ZDTA 2D9VA 2D4QA 1W1DA 1U5DA 2P0FA 5C5BA 1WJMA 4K17A 2YS3A 1WG7A 2Y8FA 3O96A 2GCJA 5DHFB 1W1HA 1N3HA 5DIFB 2OQBA 4HAUB 1RRPB 1KI1B 1U27A 1KZGA 1FGYA 3DXCA 1E5WA 4F7GA 2DX1A 1BTKA 2YF0A 4MY6A 2ELBA 2DTCA 4KHAA 1V89A 2LYDA 1Y19B 4BBKA 2NZ8B 2D10A 1AWEA 3FEHA 1PLSA 2LKOA 2LOZA 2RUKB 2K00A 2Y8GA 3KRXA 4L6EA 1Q67A 1J19A 2DX5A 1DROA 1UPRA 1GC7A 1LB1A 2P8VA 2CY4A 3F5RA 2RSGA 2BCJA 1QC6A 2I5FA 2D9YA 1X1FA 1ZSQA 4HAXB 1OY2A 3UZTA 3AJ4A 4EMOA 4TKNA 2D9XA 2VRWB 1SHCA 5FI1A 1FAOA 4Z2NA 3IVFA 3ML4A 2H7EA 1X1GA 4EJNA 1NTYA 2L2IA 2M14A 2MDXA 2RGNB 2GJYA 2DHKA 1X05A 5C6RA 1B55A 5LOPB 1TXDA 1P5TA 2UZRA 3PZDA 2IYBA 3ODWA 2W2WA 2ROZB 4IFSA 4XWXA 2EJ8A 2I5CA 1MIXA 3FM8C 1UNRA 2CAYA 3TW1A 4PNKA 3V5WA 2N23A 1ZC3B 1U2BA 3DXDA 4WVFB 4HHVA 4KHBB 2E2XA 1MPHA 1M7RA 4WJ7A 5JHGA 4HDOA 3N7CA 1FGZA 4A6FA 4KHOA 3G9WA 2W2XC 1FOEA 4HAVB 3PVWA 4CHJA 1AQCA 1MAIA 1I7AA 2DKPA 4K81A 1TJ6A 2MKRA 1FHXA 2N0YA 4HATB 5J3TA 1U5GA 4HB3B 2DYQA 2DN6A 1OMWA 1ISNA 2D9WA 3OANA 4GXBA 1V5MA 3BJIA 3AU5A 2K2JA 5HE1A 1UNQA 2COAA 2HTHB 5HE0A 1UPQA 1Y5OA 3D8FA 4Y94A 2NMBA 1MKEA 1J0WA 2H7DA 3GYOA 2CRFA 4HAZB 4TYZA 2Q13A 2DHIA 2YT1A 4DXAB 1WGQA 3P7ZA 3A98B 1EGXA 3KRWA 1PMSA 2P0DA 2DKQA 4YONA 5J3QA 4F7HA 3QBVB 2Z0QA 2EMTA 4A6KA 5CLQB 1BAKA 1SGHA 4H8SA 1DDMA 2OTXA 2ZPYA 3P6AA 2V76A 3MPXA 5C5BB 5C16A 5EFXA 2XQNM 3MDBC 1BTNA 1NTVA 1NI2A 1EF1A 3HW2B 3U7DA 4DX8A 4NY0A 4C0AA 3WYFB 1DBHA 1TQZA 2UZSA 5JLJB 3D8DA 3PEGA 2PZ1A 3TVVA 4DX90 1XKEA 1H10A 3LJUX 2YRYA 2QKMA 2DA0A 2AL6A 2Z0PA 5HE2A 2VKIA 4YL8A 2D11A 2D2QA 2VSZA 5JP4A 2DHJA 5J3YA 3VIAA 1LW3A 1X11A 5KQ4A 3QIJA 3ODXA 3T06A 2YVCA 1OQNA 1P3RA 4KAXB 1WVHA 3PVUA 5DH9B 1MIZB 1K5GB 4GMXB 4A6HA 1FHWA 3A8QA 2J0KA 3AU4A 3SUZA 4Z2MB 3KY9A 1XODA 5JHHA 5DHAB 3SV1A 5DI9B 3KZ1A 1V61A 3ODOA 5CLLB 1FHOA 2IFSA 3A8PA 4IAPA 3ZVRA 2YT0A 4KVGB 2KCJA 1MK7B 1WGUA 5D3YA 3TFMA 1X86A 2LOXA 1IRSA 1DDVA 2LG1A 1XX0A 4HB0B 2I1KA 4A5KA 1P6SA 3CIKA 2X18A 3M1IB 4K2OA 1ZVRA 3PP2A 1EAZA 1MK9B 4F7UP 3CXBB 2I1JA 2J59M 1ZM0A 4A6FB 1U5FA 3SNHA 5GOWB 1UEFA 3PSCA 2EMSA 1WI1A 4ZRKA 1V5PA 2YS1A 3SO6A 1BWNA 4ZRJA 2KUPA 4K2PA 1UNPA 2CODA 1U29A 1DYNA 2UVMA 1GC6A 4CHMA 4IOYX 3TO1A 3PG7A 2QKLA 1H4RA 2P0HA 4GPTB 2GCLA 2DLWA 5LONB 5D3XA 2M38A 2ROVA 3F0WA 4DBBA 3ULCA 3D8EA 5HE3A 1XCGA 2COFA 2Z0OA 3U8ZA 1U5EA 2MWNB 2LULA 1V88A 3FSSA 2JP2A 1KZ7A 2YS5A 5D3VA 3ULBA 4HAWB 3DXEA 3RCPA 1WJ1A 2MFQA 2COCA 3NSUA 5D3WA 1Z87A 3BINA 2ADZA 2RLOA 4D0NB 4ZRIA 2R0DA 2R09A 3HQCA 1FB8A 4HDQA 1DDWA 1V5UA 3GYPA 1NU2A 1PFJA 3TCAA 3WA0A 3VOQA 2J0JA 4HB4B 4P7IA 5FI0A 3QWMA 1GG3A 1EVHA 2GS0A 2DYNA 3SYXA 4EKUA 4PQ0A 1XR0B 2AEHA 3KSYA 2RVBB 2CY5A 2HE7A
chains in the Genus database with same CATH superfamily
5LG4B 2FJLA 4HB2B 5KQ1A 4GMVA 4GOUA 4CYEA 3X23A 4HAYB 2J0MA 2YSZA 3NWAA 2ELAA 1MI1A 4MK0A 4WSFA 2EC1A 4MT7A 1M7EA 2DFKA 1I2HA 4GZUA 4B6HA 1RJ2A 2D9ZA 1W1GA 2G35A 2L1CA 5L81A 1ZC4B 5KCVA 2KGXB 4NSWA 1QQGA 1XD4A 2K2UA 2Y7BA 5C79A 5D27A 1K5DB 3HK0A 4GN1A 3PVLA 2W2XD 2RNRB 3ZDTA 2D9VA 2D4QA 1W1DA 1U5DA 2P0FA 5C5BA 1WJMA 4K17A 2YS3A 1WG7A 2Y8FA 2GCJA 3O96A 5DHFB 1W1HA 1N3HA 5DIFB 2OQBA 4HAUB 1RRPB 1KI1B 1U27A 1KZGA 1FGYA 3DXCA 1E5WA 4OSNA 4F7GA 2DX1A 1BTKA 2YF0A 4MY6A 5IRSA 2ELBA 2DTCA 4KHAA 1V89A 2LYDA 1Y19B 4BBKA 3NWFA 2NZ8B 2D10A 1AWEA 3FEHA 1PLSA 4CSQA 2LKOA 2LOZA 2RUKB 2K00A 2Y8GA 3KRXA 4L6EA 1Q67A 1J19A 2DX5A 1DROA 1UPRA 1GC7A 1LB1A 2P8VA 2CY4A 3F5RA 2RSGA 2BCJA 1QC6A 2I5FA 2D9YA 1X1FA 1ZSQA 4HAXB 1OY2A 3UZTA 3AJ4A 5M4YB 4EMOA 4TKNA 2D9XA 2VRWB 1SHCA 5FI1A 1FAOA 4Z2NA 3IVFA 3ML4A 4OT1A 2H7EA 1X1GA 4EJNA 1NTYA 2L2IA 2M14A 2MDXA 4L1RA 2RGNB 2GJYA 2DHKA 1X05A 5C6RA 1B55A 5LOPB 1TXDA 1P5TA 2UZRA 3PZDA 2IYBA 3ODWA 2W2WA 2ROZB 4IFSA 4XWXA 2EJ8A 2ZKMX 2I5CA 1MIXA 3FM8C 1UNRA 2CAYA 3TW1A 4PNKA 3V5WA 2N23A 1ZC3B 1U2BA 3DXDA 4WVFB 4HHVA 3U12A 4KHBB 2E2XA 1MPHA 1M7RA 4WJ7A 2YT2A 5JHGA 4HDOA 3N7CA 1FGZA 4A6FA 4KHOA 3G9WA 2W2XC 1FOEA 4HAVB 3PVWA 2Z14A 4CHJA 1AQCA 1MAIA 1I7AA 2DKPA 4K81A 1TJ6A 2MKRA 1FHXA 2N0YA 4HATB 5J3TA 1U5GA 4HB3B 2DYQA 2DN6A 1OMWA 1ISNA 2D9WA 3OANA 4GXBA 1V5MA 3BJIA 3AU5A 2K2JA 5HE1A 1UNQA 2COAA 2HTHB 5HE0A 1UPQA 1Y5OA 3D8FA 4Y94A 2NMBA 1MKEA 1J0WA 2H7DA 3GYOA 2CRFA 4HAZB 4TYZA 2Q13A 2DHIA 2YT1A 2HE7A 4DXAB 1WGQA 3P7ZA 3A98B 1EGXA 3KRWA 5I2SA 1PMSA 2P0DA 2DKQA 4YONA 5J3QA 4F7HA 4QJ3B 4D6WA 3QBVB 2Z0QA 2EMTA 4A6KA 5CLQB 1BAKA 1SGHA 4H8SA 1DDMA 2OTXA 2ZPYA 3P6AA 2V76A 3MPXA 3NW8A 4QXAB 5C5BB 5C16A 5EFXA 2XQNM 3MDBC 1BTNA 2Z13A 2K8EA 1NTVA 1NI2A 1EF1A 3HW2B 3U7DA 4DX8A 4NY0A 4C0AA 3WYFB 1DBHA 1TQZA 2UZSA 5JLJB 3D8DA 3PEGA 2PZ1A 3TVVA 4DX90 1XKEA 1H10A 3LJUX 2YRYA 2Z4DA 2QKMA 2DA0A 4GNKB 2AL6A 2Z0PA 5HE2A 2VKIA 4YL8A 2D11A 2D2QA 2VSZA 5JP4A 2DHJA 5J3YA 3VIAA 1LW3A 1X11A 5KQ4A 3QIJA 3ODXA 3T06A 2YVCA 1OQNA 1P3RA 4KAXB 1WVHA 2GUMA 3PVUA 5DH9B 1MIZB 1K5GB 4GMXB 4A6HA 1FHWA 3A8QA 4QJ5B 2J0KA 3AU4A 3SUZA 4Z2MB 3KY9A 1XODA 5JHHA 5DHAB 3SV1A 5DI9B 3KZ1A 1V61A 3ODOA 5CLLB 1FHOA 2IFSA 3A8PA 4IAPA 2KR0A 2YT0A 4KVGB 3ZVRA 2KCJA 1MK7B 1WGUA 5D3YA 3TFMA 1X86A 2LOXA 1IRSA 1DDVA 2LG1A 1XX0A 4HB0B 2I1KA 4A5KA 2RRFA 1P6SA 3CIKA 2X18A 3M1IB 2NBVA 4K2OA 1ZVRA 3PP2A 1EAZA 1MK9B 4F7UP 3CXBB 2I1JA 2J59M 1ZM0A 3OHMB 4A6FB 3FVCA 1U5FA 3SNHA 1ZYIA 3HSAA 5GOWB 2K49A 3NWDA 1UEFA 3PSCA 2EMSA 1WI1A 3DCXA 5I2MA 4ZRKA 1V5PA 2YS1A 3SO6A 1BWNA 4ZRJA 4HSIA 2KUPA 4K2PA 1UNPA 2CODA 3B77A 2KIEA 1U29A 1DYNA 2UVMA 2FJUB 1GC6A 4CHMA 4IOYX 2Z59A 3TO1A 3PG7A 2QKLA 4DIXA 1H4RA 2P0HA 4GPTB 2GCLA 2DLWA 5LONB 5D3XA 2M38A 2ROVA 3F0WA 4DBBA 3ULCA 3D8EA 5HE3A 1XCGA 2COFA 2Z0OA 3U8ZA 1U5EA 2KIGA 2MWNB 2LULA 1V88A 3FSSA 2JP2A 1KZ7A 2YS5A 5D3VA 3ULBA 4HAWB 3DXEA 3RCPA 1WJ1A 2MFQA 2COCA 3NSUA 5D3WA 1Z87A 3HIEA 3BINA 2ADZA 2RLOA 4D0NB 4ZRIA 2R0DA 2R09A 3HQCA 4KHBA 1FB8A 3A58A 4HDQA 1DDWA 1V5UA 3GYPA 1NU2A 1PFJA 3TCAA 3WA0A 3VOQA 2J0JA 4HB4B 4P7IA 5FI0A 4QJ4B 3QWMA 1GG3A 1EVHA 1T77A 2GS0A 2DYNA 3SYXA 4EKUA 2KUQA 4PQ0A 1XR0B 2AEHA 3KSYA 2RVBB 2CY5A 2R2YA
chains in the Genus database with same CATH topology
2FJLA 4HB2B 5KQ1A 4GMVA 4CYEA 3X23A 4HAYB 2J0MA 2YSZA 2ELAA 4MK0A 4WSFA 2EC1A 4MT7A 1M7EA 2DFKA 1I2HA 4GZUA 4B6HA 1RJ2A 2D9ZA 1W1GA 2G35A 2L1CA 5L81A 1ZC4B 5KCVA 2KGXB 4NSWA 1QQGA 1XD4A 2K2UA 2Y7BA 5C79A 5D27A 1K5DB 3HK0A 4GN1A 3PVLA 2W2XD 2RNRB 3ZDTA 2D9VA 2D4QA 1W1DA 1U5DA 2P0FA 5C5BA 1WJMA 4K17A 2YS3A 1WG7A 2Y8FA 3O96A 2GCJA 5DHFB 1W1HA 1N3HA 5DIFB 2OQBA 4HAUB 1RRPB 1KI1B 1U27A 1KZGA 1FGYA 3DXCA 1E5WA 4F7GA 2DX1A 1BTKA 2YF0A 4MY6A 2ELBA 2DTCA 4KHAA 1V89A 2LYDA 1Y19B 4BBKA 2NZ8B 2D10A 1AWEA 3FEHA 1PLSA 2LKOA 2LOZA 2RUKB 2K00A 2Y8GA 3KRXA 4L6EA 1Q67A 1J19A 2DX5A 1DROA 1UPRA 1GC7A 1LB1A 2P8VA 2CY4A 3F5RA 2RSGA 2BCJA 1QC6A 2I5FA 2D9YA 1X1FA 1ZSQA 4HAXB 1OY2A 3UZTA 3AJ4A 4EMOA 4TKNA 2D9XA 2VRWB 1SHCA 5FI1A 1FAOA 4Z2NA 3IVFA 3ML4A 2H7EA 1X1GA 4EJNA 1NTYA 2L2IA 2M14A 2MDXA 2RGNB 2GJYA 2DHKA 1X05A 5C6RA 1B55A 5LOPB 1TXDA 1P5TA 2UZRA 3PZDA 2IYBA 3ODWA 2W2WA 2ROZB 4IFSA 4XWXA 2EJ8A 2I5CA 1MIXA 3FM8C 1UNRA 2CAYA 3TW1A 4PNKA 3V5WA 2N23A 1ZC3B 1U2BA 3DXDA 4WVFB 4HHVA 4KHBB 2E2XA 1MPHA 1M7RA 4WJ7A 5JHGA 4HDOA 3N7CA 1FGZA 4A6FA 4KHOA 3G9WA 2W2XC 1FOEA 4HAVB 3PVWA 4CHJA 1AQCA 1MAIA 1I7AA 2DKPA 4K81A 1TJ6A 2MKRA 1FHXA 2N0YA 4HATB 5J3TA 1U5GA 4HB3B 2DYQA 2DN6A 1OMWA 1ISNA 2D9WA 3OANA 4GXBA 1V5MA 3BJIA 3AU5A 2K2JA 5HE1A 1UNQA 2COAA 2HTHB 5HE0A 1UPQA 1Y5OA 3D8FA 4Y94A 2NMBA 1MKEA 1J0WA 2H7DA 3GYOA 2CRFA 4HAZB 4TYZA 2Q13A 2DHIA 2YT1A 4DXAB 1WGQA 3P7ZA 3A98B 1EGXA 3KRWA 1PMSA 2P0DA 2DKQA 4YONA 5J3QA 4F7HA 3QBVB 2Z0QA 2EMTA 4A6KA 5CLQB 1BAKA 1SGHA 4H8SA 1DDMA 2OTXA 2ZPYA 3P6AA 2V76A 3MPXA 5C5BB 5C16A 5EFXA 2XQNM 3MDBC 1BTNA 1NTVA 1NI2A 1EF1A 3HW2B 3U7DA 4DX8A 4NY0A 4C0AA 3WYFB 1DBHA 1TQZA 2UZSA 5JLJB 3D8DA 3PEGA 2PZ1A 3TVVA 4DX90 1XKEA 1H10A 3LJUX 2YRYA 2QKMA 2DA0A 2AL6A 2Z0PA 5HE2A 2VKIA 4YL8A 2D11A 2D2QA 2VSZA 5JP4A 2DHJA 5J3YA 3VIAA 1LW3A 1X11A 5KQ4A 3QIJA 3ODXA 3T06A 2YVCA 1OQNA 1P3RA 4KAXB 1WVHA 3PVUA 5DH9B 1MIZB 1K5GB 4GMXB 4A6HA 1FHWA 3A8QA 2J0KA 3AU4A 3SUZA 4Z2MB 3KY9A 1XODA 5JHHA 5DHAB 3SV1A 5DI9B 3KZ1A 1V61A 3ODOA 5CLLB 1FHOA 2IFSA 3A8PA 4IAPA 3ZVRA 2YT0A 4KVGB 2KCJA 1MK7B 1WGUA 5D3YA 3TFMA 1X86A 2LOXA 1IRSA 1DDVA 2LG1A 1XX0A 4HB0B 2I1KA 4A5KA 1P6SA 3CIKA 2X18A 3M1IB 4K2OA 1ZVRA 3PP2A 1EAZA 1MK9B 4F7UP 3CXBB 2I1JA 2J59M 1ZM0A 4A6FB 1U5FA 3SNHA 5GOWB 1UEFA 3PSCA 2EMSA 1WI1A 4ZRKA 1V5PA 2YS1A 3SO6A 1BWNA 4ZRJA 2KUPA 4K2PA 1UNPA 2CODA 1U29A 1DYNA 2UVMA 1GC6A 4CHMA 4IOYX 3TO1A 3PG7A 2QKLA 1H4RA 2P0HA 4GPTB 2GCLA 2DLWA 5LONB 5D3XA 2M38A 2ROVA 3F0WA 4DBBA 3ULCA 3D8EA 5HE3A 1XCGA 2COFA 2Z0OA 3U8ZA 1U5EA 2MWNB 2LULA 1V88A 3FSSA 2JP2A 1KZ7A 2YS5A 5D3VA 3ULBA 4HAWB 3DXEA 3RCPA 1WJ1A 2MFQA 2COCA 3NSUA 5D3WA 1Z87A 3BINA 2ADZA 2RLOA 4D0NB 4ZRIA 2R0DA 2R09A 3HQCA 1FB8A 4HDQA 1DDWA 1V5UA 3GYPA 1NU2A 1PFJA 3TCAA 3WA0A 3VOQA 2J0JA 4HB4B 4P7IA 5FI0A 3QWMA 1GG3A 1EVHA 2GS0A 2DYNA 3SYXA 4EKUA 4PQ0A 1XR0B 2AEHA 3KSYA 2RVBB 2CY5A 2HE7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FJL A;  4HB2 B;  5KQ1 A;  4GMV A;  4CYE A;  3X23 A;  4HAY B;  2J0M A;  2YSZ A;  2ELA A;  4MK0 A;  4WSF A;  2EC1 A;  4MT7 A;  1M7E A;  2DFK A;  1I2H A;  4GZU A;  4B6H A;  1RJ2 A;  2D9Z A;  1W1G A;  2G35 A;  2L1C A;  5L81 A;  1ZC4 B;  5KCV A;  2KGX B;  4NSW A;  1QQG A;  1XD4 A;  2K2U A;  2Y7B A;  5C79 A;  5D27 A;  1K5D B;  3HK0 A;  4GN1 A;  3PVL A;  2W2X D;  2RNR B;  3ZDT A;  2D9V A;  2D4Q A;  1W1D A;  1U5D A;  2P0F A;  5C5B A;  1WJM A;  4K17 A;  2YS3 A;  1WG7 A;  2Y8F A;  3O96 A;  2GCJ A;  5DHF B;  1W1H A;  1N3H A;  5DIF B;  2OQB A;  4HAU B;  1RRP B;  1KI1 B;  1U27 A;  1KZG A;  1FGY A;  3DXC A;  1E5W A;  4F7G A;  2DX1 A;  1BTK A;  2YF0 A;  4MY6 A;  2ELB A;  2DTC A;  4KHA A;  1V89 A;  2LYD A;  1Y19 B;  4BBK A;  2NZ8 B;  2D10 A;  1AWE A;  3FEH A;  1PLS A;  2LKO A;  2LOZ A;  2RUK B;  2K00 A;  2Y8G A;  3KRX A;  4L6E A;  1Q67 A;  1J19 A;  2DX5 A;  1DRO A;  1UPR A;  1GC7 A;  1LB1 A;  2P8V A;  2CY4 A;  3F5R A;  2RSG A;  2BCJ A;  1QC6 A;  2I5F A;  2D9Y A;  1X1F A;  1ZSQ A;  4HAX B;  1OY2 A;  3UZT A;  3AJ4 A;  4EMO A;  4TKN A;  2D9X A;  2VRW B;  1SHC A;  5FI1 A;  1FAO A;  4Z2N A;  3IVF A;  3ML4 A;  2H7E A;  1X1G A;  4EJN A;  1NTY A;  2L2I A;  2M14 A;  2MDX A;  2RGN B;  2GJY A;  2DHK A;  1X05 A;  5C6R A;  1B55 A;  5LOP B;  1TXD A;  1P5T A;  2UZR A;  3PZD A;  2IYB A;  3ODW A;  2W2W A;  2ROZ B;  4IFS A;  4XWX A;  2EJ8 A;  2I5C A;  1MIX A;  3FM8 C;  1UNR A;  2CAY A;  3TW1 A;  4PNK A;  3V5W A;  2N23 A;  1ZC3 B;  1U2B A;  3DXD A;  4WVF B;  4HHV A;  4KHB B;  2E2X A;  1MPH A;  1M7R A;  4WJ7 A;  5JHG A;  4HDO A;  3N7C A;  1FGZ A;  4A6F A;  4KHO A;  3G9W A;  2W2X C;  1FOE A;  4HAV B;  3PVW A;  4CHJ A;  1AQC A;  1MAI A;  1I7A A;  2DKP A;  4K81 A;  1TJ6 A;  2MKR A;  1FHX A;  2N0Y A;  4HAT B;  5J3T A;  1U5G A;  4HB3 B;  2DYQ A;  2DN6 A;  1OMW A;  1ISN A;  2D9W A;  3OAN A;  4GXB A;  1V5M A;  3BJI A;  3AU5 A;  2K2J A;  5HE1 A;  1UNQ A;  2COA A;  2HTH B;  5HE0 A;  1UPQ A;  1Y5O A;  3D8F A;  4Y94 A;  2NMB A;  1MKE A;  1J0W A;  2H7D A;  3GYO A;  2CRF A;  4HAZ B;  4TYZ A;  2Q13 A;  2DHI A;  2YT1 A;  4DXA B;  1WGQ A;  3P7Z A;  3A98 B;  1EGX A;  3KRW A;  1PMS A;  2P0D A;  2DKQ A;  4YON A;  5J3Q A;  4F7H A;  3QBV B;  2Z0Q A;  2EMT A;  4A6K A;  5CLQ B;  1BAK A;  1SGH A;  4H8S A;  1DDM A;  2OTX A;  2ZPY A;  3P6A A;  2V76 A;  3MPX A;  5C5B B;  5C16 A;  5EFX A;  2XQN M;  3MDB C;  1BTN A;  1NTV A;  1NI2 A;  1EF1 A;  3HW2 B;  3U7D A;  4DX8 A;  4NY0 A;  4C0A A;  3WYF B;  1DBH A;  1TQZ A;  2UZS A;  5JLJ B;  3D8D A;  3PEG A;  2PZ1 A;  3TVV A;  4DX9 0;  1XKE A;  1H10 A;  3LJU X;  2YRY A;  2QKM A;  2DA0 A;  2AL6 A;  2Z0P A;  5HE2 A;  2VKI A;  4YL8 A;  2D11 A;  2D2Q A;  2VSZ A;  5JP4 A;  2DHJ A;  5J3Y A;  3VIA A;  1LW3 A;  1X11 A;  5KQ4 A;  3QIJ A;  3ODX A;  3T06 A;  2YVC A;  1OQN A;  1P3R A;  4KAX B;  1WVH A;  3PVU A;  5DH9 B;  1MIZ B;  1K5G B;  4GMX B;  4A6H A;  1FHW A;  3A8Q A;  2J0K A;  3AU4 A;  3SUZ A;  4Z2M B;  3KY9 A;  1XOD A;  5JHH A;  5DHA B;  3SV1 A;  5DI9 B;  3KZ1 A;  1V61 A;  3ODO A;  5CLL B;  1FHO A;  2IFS A;  3A8P A;  4IAP A;  3ZVR A;  2YT0 A;  4KVG B;  2KCJ A;  1MK7 B;  1WGU A;  5D3Y A;  3TFM A;  1X86 A;  2LOX A;  1IRS A;  1DDV A;  2LG1 A;  1XX0 A;  4HB0 B;  2I1K A;  4A5K A;  1P6S A;  3CIK A;  2X18 A;  3M1I B;  4K2O A;  1ZVR A;  3PP2 A;  1EAZ A;  1MK9 B;  4F7U P;  3CXB B;  2I1J A;  2J59 M;  1ZM0 A;  4A6F B;  1U5F A;  3SNH A;  5GOW B;  1UEF A;  3PSC A;  2EMS A;  1WI1 A;  4ZRK A;  1V5P A;  2YS1 A;  3SO6 A;  1BWN A;  4ZRJ A;  2KUP A;  4K2P A;  1UNP A;  2COD A;  1U29 A;  1DYN A;  2UVM A;  1GC6 A;  4CHM A;  4IOY X;  3TO1 A;  3PG7 A;  2QKL A;  1H4R A;  2P0H A;  4GPT B;  2GCL A;  2DLW A;  5LON B;  5D3X A;  2M38 A;  2ROV A;  3F0W A;  4DBB A;  3ULC A;  3D8E A;  5HE3 A;  1XCG A;  2COF A;  2Z0O A;  3U8Z A;  1U5E A;  2MWN B;  2LUL A;  1V88 A;  3FSS A;  2JP2 A;  1KZ7 A;  2YS5 A;  5D3V A;  3ULB A;  4HAW B;  3DXE A;  3RCP A;  1WJ1 A;  2MFQ A;  2COC A;  3NSU A;  5D3W A;  1Z87 A;  3BIN A;  2ADZ A;  2RLO A;  4D0N B;  4ZRI A;  2R0D A;  2R09 A;  3HQC A;  1FB8 A;  4HDQ A;  1DDW A;  1V5U A;  3GYP A;  1NU2 A;  1PFJ A;  3TCA A;  3WA0 A;  3VOQ A;  2J0J A;  4HB4 B;  4P7I A;  5FI0 A;  3QWM A;  1GG3 A;  1EVH A;  2GS0 A;  2DYN A;  3SYX A;  4EKU A;  4PQ0 A;  1XR0 B;  2AEH A;  3KSY A;  2RVB B;  2CY5 A;  2HE7 A; 
#chains in the Genus database with same CATH topology
 5LG4 B;  2FJL A;  4HB2 B;  5KQ1 A;  4GMV A;  4GOU A;  4CYE A;  3X23 A;  4HAY B;  2J0M A;  2YSZ A;  3NWA A;  2ELA A;  1MI1 A;  4MK0 A;  4WSF A;  2EC1 A;  4MT7 A;  1M7E A;  2DFK A;  1I2H A;  4GZU A;  4B6H A;  1RJ2 A;  2D9Z A;  1W1G A;  2G35 A;  2L1C A;  5L81 A;  1ZC4 B;  5KCV A;  2KGX B;  4NSW A;  1QQG A;  1XD4 A;  2K2U A;  2Y7B A;  5C79 A;  5D27 A;  1K5D B;  3HK0 A;  4GN1 A;  3PVL A;  2W2X D;  2RNR B;  3ZDT A;  2D9V A;  2D4Q A;  1W1D A;  1U5D A;  2P0F A;  5C5B A;  1WJM A;  4K17 A;  2YS3 A;  1WG7 A;  2Y8F A;  2GCJ A;  3O96 A;  5DHF B;  1W1H A;  1N3H A;  5DIF B;  2OQB A;  4HAU B;  1RRP B;  1KI1 B;  1U27 A;  1KZG A;  1FGY A;  3DXC A;  1E5W A;  4OSN A;  4F7G A;  2DX1 A;  1BTK A;  2YF0 A;  4MY6 A;  5IRS A;  2ELB A;  2DTC A;  4KHA A;  1V89 A;  2LYD A;  1Y19 B;  4BBK A;  3NWF A;  2NZ8 B;  2D10 A;  1AWE A;  3FEH A;  1PLS A;  4CSQ A;  2LKO A;  2LOZ A;  2RUK B;  2K00 A;  2Y8G A;  3KRX A;  4L6E A;  1Q67 A;  1J19 A;  2DX5 A;  1DRO A;  1UPR A;  1GC7 A;  1LB1 A;  2P8V A;  2CY4 A;  3F5R A;  2RSG A;  2BCJ A;  1QC6 A;  2I5F A;  2D9Y A;  1X1F A;  1ZSQ A;  4HAX B;  1OY2 A;  3UZT A;  3AJ4 A;  5M4Y B;  4EMO A;  4TKN A;  2D9X A;  2VRW B;  1SHC A;  5FI1 A;  1FAO A;  4Z2N A;  3IVF A;  3ML4 A;  4OT1 A;  2H7E A;  1X1G A;  4EJN A;  1NTY A;  2L2I A;  2M14 A;  2MDX A;  4L1R A;  2RGN B;  2GJY A;  2DHK A;  1X05 A;  5C6R A;  1B55 A;  5LOP B;  1TXD A;  1P5T A;  2UZR A;  3PZD A;  2IYB A;  3ODW A;  2W2W A;  2ROZ B;  4IFS A;  4XWX A;  2EJ8 A;  2ZKM X;  2I5C A;  1MIX A;  3FM8 C;  1UNR A;  2CAY A;  3TW1 A;  4PNK A;  3V5W A;  2N23 A;  1ZC3 B;  1U2B A;  3DXD A;  4WVF B;  4HHV A;  3U12 A;  4KHB B;  2E2X A;  1MPH A;  1M7R A;  4WJ7 A;  2YT2 A;  5JHG A;  4HDO A;  3N7C A;  1FGZ A;  4A6F A;  4KHO A;  3G9W A;  2W2X C;  1FOE A;  4HAV B;  3PVW A;  2Z14 A;  4CHJ A;  1AQC A;  1MAI A;  1I7A A;  2DKP A;  4K81 A;  1TJ6 A;  2MKR A;  1FHX A;  2N0Y A;  4HAT B;  5J3T A;  1U5G A;  4HB3 B;  2DYQ A;  2DN6 A;  1OMW A;  1ISN A;  2D9W A;  3OAN A;  4GXB A;  1V5M A;  3BJI A;  3AU5 A;  2K2J A;  5HE1 A;  1UNQ A;  2COA A;  2HTH B;  5HE0 A;  1UPQ A;  1Y5O A;  3D8F A;  4Y94 A;  2NMB A;  1MKE A;  1J0W A;  2H7D A;  3GYO A;  2CRF A;  4HAZ B;  4TYZ A;  2Q13 A;  2DHI A;  2YT1 A;  2HE7 A;  4DXA B;  1WGQ A;  3P7Z A;  3A98 B;  1EGX A;  3KRW A;  5I2S A;  1PMS A;  2P0D A;  2DKQ A;  4YON A;  5J3Q A;  4F7H A;  4QJ3 B;  4D6W A;  3QBV B;  2Z0Q A;  2EMT A;  4A6K A;  5CLQ B;  1BAK A;  1SGH A;  4H8S A;  1DDM A;  2OTX A;  2ZPY A;  3P6A A;  2V76 A;  3MPX A;  3NW8 A;  4QXA B;  5C5B B;  5C16 A;  5EFX A;  2XQN M;  3MDB C;  1BTN A;  2Z13 A;  2K8E A;  1NTV A;  1NI2 A;  1EF1 A;  3HW2 B;  3U7D A;  4DX8 A;  4NY0 A;  4C0A A;  3WYF B;  1DBH A;  1TQZ A;  2UZS A;  5JLJ B;  3D8D A;  3PEG A;  2PZ1 A;  3TVV A;  4DX9 0;  1XKE A;  1H10 A;  3LJU X;  2YRY A;  2Z4D A;  2QKM A;  2DA0 A;  4GNK B;  2AL6 A;  2Z0P A;  5HE2 A;  2VKI A;  4YL8 A;  2D11 A;  2D2Q A;  2VSZ A;  5JP4 A;  2DHJ A;  5J3Y A;  3VIA A;  1LW3 A;  1X11 A;  5KQ4 A;  3QIJ A;  3ODX A;  3T06 A;  2YVC A;  1OQN A;  1P3R A;  4KAX B;  1WVH A;  2GUM A;  3PVU A;  5DH9 B;  1MIZ B;  1K5G B;  4GMX B;  4A6H A;  1FHW A;  3A8Q A;  4QJ5 B;  2J0K A;  3AU4 A;  3SUZ A;  4Z2M B;  3KY9 A;  1XOD A;  5JHH A;  5DHA B;  3SV1 A;  5DI9 B;  3KZ1 A;  1V61 A;  3ODO A;  5CLL B;  1FHO A;  2IFS A;  3A8P A;  4IAP A;  2KR0 A;  2YT0 A;  4KVG B;  3ZVR A;  2KCJ A;  1MK7 B;  1WGU A;  5D3Y A;  3TFM A;  1X86 A;  2LOX A;  1IRS A;  1DDV A;  2LG1 A;  1XX0 A;  4HB0 B;  2I1K A;  4A5K A;  2RRF A;  1P6S A;  3CIK A;  2X18 A;  3M1I B;  2NBV A;  4K2O A;  1ZVR A;  3PP2 A;  1EAZ A;  1MK9 B;  4F7U P;  3CXB B;  2I1J A;  2J59 M;  1ZM0 A;  3OHM B;  4A6F B;  3FVC A;  1U5F A;  3SNH A;  1ZYI A;  3HSA A;  5GOW B;  2K49 A;  3NWD A;  1UEF A;  3PSC A;  2EMS A;  1WI1 A;  3DCX A;  5I2M A;  4ZRK A;  1V5P A;  2YS1 A;  3SO6 A;  1BWN A;  4ZRJ A;  4HSI A;  2KUP A;  4K2P A;  1UNP A;  2COD A;  3B77 A;  2KIE A;  1U29 A;  1DYN A;  2UVM A;  2FJU B;  1GC6 A;  4CHM A;  4IOY X;  2Z59 A;  3TO1 A;  3PG7 A;  2QKL A;  4DIX A;  1H4R A;  2P0H A;  4GPT B;  2GCL A;  2DLW A;  5LON B;  5D3X A;  2M38 A;  2ROV A;  3F0W A;  4DBB A;  3ULC A;  3D8E A;  5HE3 A;  1XCG A;  2COF A;  2Z0O A;  3U8Z A;  1U5E A;  2KIG A;  2MWN B;  2LUL A;  1V88 A;  3FSS A;  2JP2 A;  1KZ7 A;  2YS5 A;  5D3V A;  3ULB A;  4HAW B;  3DXE A;  3RCP A;  1WJ1 A;  2MFQ A;  2COC A;  3NSU A;  5D3W A;  1Z87 A;  3HIE A;  3BIN A;  2ADZ A;  2RLO A;  4D0N B;  4ZRI A;  2R0D A;  2R09 A;  3HQC A;  4KHB A;  1FB8 A;  3A58 A;  4HDQ A;  1DDW A;  1V5U A;  3GYP A;  1NU2 A;  1PFJ A;  3TCA A;  3WA0 A;  3VOQ A;  2J0J A;  4HB4 B;  4P7I A;  5FI0 A;  4QJ4 B;  3QWM A;  1GG3 A;  1EVH A;  1T77 A;  2GS0 A;  2DYN A;  3SYX A;  4EKU A;  2KUQ A;  4PQ0 A;  1XR0 B;  2AEH A;  3KSY A;  2RVB B;  2CY5 A;  2R2Y A; 
#chains in the Genus database with same CATH homology
 2FJL A;  4HB2 B;  5KQ1 A;  4GMV A;  4CYE A;  3X23 A;  4HAY B;  2J0M A;  2YSZ A;  2ELA A;  4MK0 A;  4WSF A;  2EC1 A;  4MT7 A;  1M7E A;  2DFK A;  1I2H A;  4GZU A;  4B6H A;  1RJ2 A;  2D9Z A;  1W1G A;  2G35 A;  2L1C A;  5L81 A;  1ZC4 B;  5KCV A;  2KGX B;  4NSW A;  1QQG A;  1XD4 A;  2K2U A;  2Y7B A;  5C79 A;  5D27 A;  1K5D B;  3HK0 A;  4GN1 A;  3PVL A;  2W2X D;  2RNR B;  3ZDT A;  2D9V A;  2D4Q A;  1W1D A;  1U5D A;  2P0F A;  5C5B A;  1WJM A;  4K17 A;  2YS3 A;  1WG7 A;  2Y8F A;  3O96 A;  2GCJ A;  5DHF B;  1W1H A;  1N3H A;  5DIF B;  2OQB A;  4HAU B;  1RRP B;  1KI1 B;  1U27 A;  1KZG A;  1FGY A;  3DXC A;  1E5W A;  4F7G A;  2DX1 A;  1BTK A;  2YF0 A;  4MY6 A;  2ELB A;  2DTC A;  4KHA A;  1V89 A;  2LYD A;  1Y19 B;  4BBK A;  2NZ8 B;  2D10 A;  1AWE A;  3FEH A;  1PLS A;  2LKO A;  2LOZ A;  2RUK B;  2K00 A;  2Y8G A;  3KRX A;  4L6E A;  1Q67 A;  1J19 A;  2DX5 A;  1DRO A;  1UPR A;  1GC7 A;  1LB1 A;  2P8V A;  2CY4 A;  3F5R A;  2RSG A;  2BCJ A;  1QC6 A;  2I5F A;  2D9Y A;  1X1F A;  1ZSQ A;  4HAX B;  1OY2 A;  3UZT A;  3AJ4 A;  4EMO A;  4TKN A;  2D9X A;  2VRW B;  1SHC A;  5FI1 A;  1FAO A;  4Z2N A;  3IVF A;  3ML4 A;  2H7E A;  1X1G A;  4EJN A;  1NTY A;  2L2I A;  2M14 A;  2MDX A;  2RGN B;  2GJY A;  2DHK A;  1X05 A;  5C6R A;  1B55 A;  5LOP B;  1TXD A;  1P5T A;  2UZR A;  3PZD A;  2IYB A;  3ODW A;  2W2W A;  2ROZ B;  4IFS A;  4XWX A;  2EJ8 A;  2I5C A;  1MIX A;  3FM8 C;  1UNR A;  2CAY A;  3TW1 A;  4PNK A;  3V5W A;  2N23 A;  1ZC3 B;  1U2B A;  3DXD A;  4WVF B;  4HHV A;  4KHB B;  2E2X A;  1MPH A;  1M7R A;  4WJ7 A;  5JHG A;  4HDO A;  3N7C A;  1FGZ A;  4A6F A;  4KHO A;  3G9W A;  2W2X C;  1FOE A;  4HAV B;  3PVW A;  4CHJ A;  1AQC A;  1MAI A;  1I7A A;  2DKP A;  4K81 A;  1TJ6 A;  2MKR A;  1FHX A;  2N0Y A;  4HAT B;  5J3T A;  1U5G A;  4HB3 B;  2DYQ A;  2DN6 A;  1OMW A;  1ISN A;  2D9W A;  3OAN A;  4GXB A;  1V5M A;  3BJI A;  3AU5 A;  2K2J A;  5HE1 A;  1UNQ A;  2COA A;  2HTH B;  5HE0 A;  1UPQ A;  1Y5O A;  3D8F A;  4Y94 A;  2NMB A;  1MKE A;  1J0W A;  2H7D A;  3GYO A;  2CRF A;  4HAZ B;  4TYZ A;  2Q13 A;  2DHI A;  2YT1 A;  4DXA B;  1WGQ A;  3P7Z A;  3A98 B;  1EGX A;  3KRW A;  1PMS A;  2P0D A;  2DKQ A;  4YON A;  5J3Q A;  4F7H A;  3QBV B;  2Z0Q A;  2EMT A;  4A6K A;  5CLQ B;  1BAK A;  1SGH A;  4H8S A;  1DDM A;  2OTX A;  2ZPY A;  3P6A A;  2V76 A;  3MPX A;  5C5B B;  5C16 A;  5EFX A;  2XQN M;  3MDB C;  1BTN A;  1NTV A;  1NI2 A;  1EF1 A;  3HW2 B;  3U7D A;  4DX8 A;  4NY0 A;  4C0A A;  3WYF B;  1DBH A;  1TQZ A;  2UZS A;  5JLJ B;  3D8D A;  3PEG A;  2PZ1 A;  3TVV A;  4DX9 0;  1XKE A;  1H10 A;  3LJU X;  2YRY A;  2QKM A;  2DA0 A;  2AL6 A;  2Z0P A;  5HE2 A;  2VKI A;  4YL8 A;  2D11 A;  2D2Q A;  2VSZ A;  5JP4 A;  2DHJ A;  5J3Y A;  3VIA A;  1LW3 A;  1X11 A;  5KQ4 A;  3QIJ A;  3ODX A;  3T06 A;  2YVC A;  1OQN A;  1P3R A;  4KAX B;  1WVH A;  3PVU A;  5DH9 B;  1MIZ B;  1K5G B;  4GMX B;  4A6H A;  1FHW A;  3A8Q A;  2J0K A;  3AU4 A;  3SUZ A;  4Z2M B;  3KY9 A;  1XOD A;  5JHH A;  5DHA B;  3SV1 A;  5DI9 B;  3KZ1 A;  1V61 A;  3ODO A;  5CLL B;  1FHO A;  2IFS A;  3A8P A;  4IAP A;  3ZVR A;  2YT0 A;  4KVG B;  2KCJ A;  1MK7 B;  1WGU A;  5D3Y A;  3TFM A;  1X86 A;  2LOX A;  1IRS A;  1DDV A;  2LG1 A;  1XX0 A;  4HB0 B;  2I1K A;  4A5K A;  1P6S A;  3CIK A;  2X18 A;  3M1I B;  4K2O A;  1ZVR A;  3PP2 A;  1EAZ A;  1MK9 B;  4F7U P;  3CXB B;  2I1J A;  2J59 M;  1ZM0 A;  4A6F B;  1U5F A;  3SNH A;  5GOW B;  1UEF A;  3PSC A;  2EMS A;  1WI1 A;  4ZRK A;  1V5P A;  2YS1 A;  3SO6 A;  1BWN A;  4ZRJ A;  2KUP A;  4K2P A;  1UNP A;  2COD A;  1U29 A;  1DYN A;  2UVM A;  1GC6 A;  4CHM A;  4IOY X;  3TO1 A;  3PG7 A;  2QKL A;  1H4R A;  2P0H A;  4GPT B;  2GCL A;  2DLW A;  5LON B;  5D3X A;  2M38 A;  2ROV A;  3F0W A;  4DBB A;  3ULC A;  3D8E A;  5HE3 A;  1XCG A;  2COF A;  2Z0O A;  3U8Z A;  1U5E A;  2MWN B;  2LUL A;  1V88 A;  3FSS A;  2JP2 A;  1KZ7 A;  2YS5 A;  5D3V A;  3ULB A;  4HAW B;  3DXE A;  3RCP A;  1WJ1 A;  2MFQ A;  2COC A;  3NSU A;  5D3W A;  1Z87 A;  3BIN A;  2ADZ A;  2RLO A;  4D0N B;  4ZRI A;  2R0D A;  2R09 A;  3HQC A;  1FB8 A;  4HDQ A;  1DDW A;  1V5U A;  3GYP A;  1NU2 A;  1PFJ A;  3TCA A;  3WA0 A;  3VOQ A;  2J0J A;  4HB4 B;  4P7I A;  5FI0 A;  3QWM A;  1GG3 A;  1EVH A;  2GS0 A;  2DYN A;  3SYX A;  4EKU A;  4PQ0 A;  1XR0 B;  2AEH A;  3KSY A;  2RVB B;  2CY5 A;  2HE7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...