1X1FA

Solution structure of the ph domain of human docking protein brdg1
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
149
structure length
149
Chain Sequence
GSSGSSGQERLKITALPLYFEGFLLIKRSGYREYEHYWTELRGTTLFFYTDKKSIIYVDKLDIVDLTCLTEQNSTEKNCAKFTLVLPKEEVQLKTENTESGEEWRGFILTVTELSVPQNVSLLPGQVIKLHEVLEREKKRRIESGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Signal-transducing adaptor protein 1
publication title Solution structure of the PH domain of human Docking protein BRDG1
rcsb
source organism Homo sapiens
total genus 18
structure length 149
sequence length 149
ec nomenclature
pdb deposition date 2005-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1x1fA00
1X1FA 1TJ6A 2DYNA 1XX0A 3FEHA 4XWXA 1X11A 1FHXA 2OTXA 3TVVA 1MIXA 1SHCA 2D9ZA 3TCAA 3PP2A 1QC6A 1OY2A 3D8DA 3AU5A 1WGQA 1ZC3B 3CXBB 2QKMA 2I5CA 1LW3A 1ISNA 2LULA 3IVFA 4HDQA 2J59M 5J3YA 3SUZA 1U5EA 1N3HA 2K2UA 1WVHA 1KZ7A 1MK9B 3M1IB 5CLLB 1PMSA 5DHAB 3P6AA 3KY9A 2CODA 5D3YA 4DXAB 4HB3B 2YRYA 2MWNB 1U27A 1MAIA 2ROZB 3TW1A 2I1KA 1RRPB 1X05A 3HQCA 2AEHA 1V88A 3RCPA 1MKEA 2E2XA 1ZVRA 4Y94A 1DDVA 4KAXB 3ZDTA 4HB2B 2DHIA 4K17A 1WI1A 1U5GA 3PEGA 4TKNA 2YF0A 3SYXA 3ZVRA 3ODOA 1Q67A 2M14A 2DX5A 1RJ2A 1I7AA 1U5DA 2ELBA 2RNRB 1WGUA 1BWNA 2P0DA 4A6HA 1BTKA 5FI0A 1U29A 5HE3A 4HAZB 5JLJB 2DN6A 4KVGB 4ZRJA 1U2BA 2D11A 2EMTA 2KUPA 2LKOA 1M7EA 5C79A 3KRXA 4NSWA 2VSZA 4EJNA 5L81A 5DIFB 2Y7BA 3DXDA 3GYOA 5CLQB 4PNKA 1UNQA 4GN1A 2LG1A 4EKUA 1FGZA 1ZC4B 1K5DB 1J19A 4B6HA 5DI9B 3HK0A 1AWEA 2YS5A 3O96A 2NMBA 1EAZA 3SV1A 1J0WA 1NU2A 3U7DA 2MDXA 1LB1A 2UZRA 3ODWA 4YL8A 3QIJA 2DX1A 1W1GA 1Y5OA 3ULCA 2BCJA 1V5MA 2DHJA 2DLWA 2LOXA 4YONA 4HB0B 1DROA 3U8ZA 4F7HA 2HE7A 4BBKA 5KQ1A 3AJ4A 4MK0A 1XD4A 5FI1A 1WJMA 2Z0QA 2NZ8B 5EFXA 2L2IA 2IYBA 1UPRA 2J0MA 2UZSA 2D2QA 1DBHA 5D3VA 2RGNB 1KZGA 1OMWA 3UZTA 1PLSA 4D0NB 2MKRA 2W2XC 5KQ4A 3A98B 4HAYB 4HAXB 4WVFB 2R09A 2LOZA 3GYPA 1XR0B 1PFJA 1UNRA 4GPTB 3PSCA 1XODA 1DDMA 2KCJA 3VOQA 2ROVA 1AQCA 2YS3A 1X1GA 2GJYA 2W2WA 4HAUB 2PZ1A 1BAKA 4HHVA 3QWMA 2Q13A 4WJ7A 4HAWB 2RSGA 2D9YA 4DBBA 2V76A 3N7CA 4K81A 3WA0A 4HDOA 4WSFA 1V89A 2ADZA 2I5FA 1P6SA 4KHAA 3SNHA 2K00A 5D27A 1FAOA 1NI2A 5C5BB 1H4RA 2YT0A 2YT1A 3OANA 3MDBC 2RVBB 3DXEA 4MT7A 4IOYX 4CHJA 1TQZA 2XQNM 3VIAA 1EGXA 2HTHB 4IAPA 4CYEA 4A6KA 3MPXA 5C5BA 3TFMA 5HE1A 3NSUA 4P7IA 2P8VA 5GOWB 5HE2A 2R0DA 1QQGA 4A5KA 5JHHA 3QBVB 4HAVB 1GC6A 1XCGA 3PVWA 4HATB 3F5RA 4Z2NA 3HW2B 3D8EA 2P0HA 4KHOA 2DYQA 2RUKB 1FHWA 3FSSA 4GMVA 4H8SA 2X18A 2YSZA 4KHBB 4Z2MB 2QKLA 2G35A 2RLOA 3T06A 2EC1A 2COCA 2MFQA 1MPHA 5C6RA 3PG7A 2OQBA 1Y19B 3CIKA 1W1DA 4GMXB 1ZM0A 2CY4A 3F0WA 4NY0A 3P7ZA 2ELAA 4PQ0A 2H7EA 1V5PA 1P5TA 3G9WA 3V5WA 1TXDA 4HB4B 2COAA 2N0YA 1NTYA 3A8PA 4MY6A 2IFSA 3PVLA 4F7UP 3DXCA 3D8FA 1P3RA 4IFSA 2EJ8A 2Y8GA 2DKQA 2Y8FA 2M38A 4GZUA 2K2JA 3SO6A 4F7GA 1FB8A 3BINA 1NTVA 1BTNA 2GCLA 2UVMA 5D3WA 2N23A 5KCVA 2ZPYA 1V5UA 3A8QA 1U5FA 5J3TA 3X23A 2EMSA 2Z0PA 3KRWA 4DX90 5J3QA 2CY5A 1GC7A 1MK7B 2J0JA 2I1JA 1OQNA 4EMOA 2VKIA 2DKPA 3AU4A 1H10A 2L1CA 1FOEA 2D4QA 1DDWA 1MIZB 2DFKA 2FJLA 4K2OA 1K5GB 2Z0OA 2D9XA 4ZRKA 4CHMA 1I2HA 1E5WA 4GXBA 1B55A 3PZDA 3ML4A 1Z87A 3ODXA 1IRSA 2LYDA 1FHOA 2D10A 1UEFA 2CAYA 3KSYA 1EF1A 3KZ1A 2KGXB 2H7DA 1EVHA 1GG3A 1X86A 1V61A 2P0FA 3PVUA 4K2PA 1ZSQA 2COFA 4ZRIA 5C16A 1M7RA 2DA0A 4A6FB 1W1HA 1XKEA 1SGHA 5LONB 1UNPA 3ULBA 2J0KA 4L6EA 5JHGA 2YVCA 4C0AA 1WJ1A 2DTCA 2YS1A 3LJUX 1DYNA 2D9VA 5DH9B 3FM8C 2W2XD 2D9WA 2JP2A 2CRFA 5D3XA 4A6FA 1FGYA 4DX8A 2GS0A 1UPQA 3WYFB 3TO1A 5JP4A 3BJIA 1KI1B 2AL6A 5LOPB 4TYZA 5DHFB 5HE0A 1WG7A 2VRWB 2GCJA 2DHKA
chains in the Genus database with same CATH superfamily
1X1FA 1TJ6A 2Z4DA 2DYNA 1XX0A 2KIGA 3FEHA 4XWXA 1X11A 1FHXA 2OTXA 3TVVA 1MIXA 1SHCA 2D9ZA 3TCAA 3PP2A 1QC6A 1OY2A 3D8DA 3AU5A 1WGQA 1ZC3B 3CXBB 2QKMA 2I5CA 1LW3A 1ISNA 2LULA 2Z59A 3IVFA 4HDQA 2J59M 5J3YA 3SUZA 1U5EA 1N3HA 2K2UA 1WVHA 1KZ7A 1MK9B 3M1IB 2NBVA 5CLLB 1PMSA 1MI1A 5DHAB 3P6AA 3KY9A 2CODA 5D3YA 4DXAB 4HB3B 2YRYA 2MWNB 1U27A 1MAIA 2ROZB 3TW1A 2I1KA 1RRPB 1X05A 3HQCA 3HSAA 2AEHA 4QXAB 1V88A 3RCPA 1MKEA 2E2XA 1ZVRA 4Y94A 1DDVA 4KAXB 3ZDTA 4OT1A 4HB2B 5I2MA 2DHIA 4K17A 1WI1A 1U5GA 3PEGA 4TKNA 2YF0A 3SYXA 3ZVRA 3ODOA 2KR0A 1Q67A 2M14A 2DX5A 1RJ2A 1I7AA 1U5DA 2ELBA 2RNRB 1WGUA 1BWNA 2P0DA 4A6HA 1BTKA 5FI0A 1U29A 5HE3A 4HAZB 5JLJB 2DN6A 4KVGB 4ZRJA 1U2BA 2D11A 2EMTA 2KUPA 2YT2A 2LKOA 1M7EA 5C79A 3KRXA 4NSWA 2VSZA 4EJNA 5L81A 5DIFB 2Y7BA 3DXDA 3HIEA 3GYOA 1T77A 5CLQB 4PNKA 1UNQA 4GN1A 2LG1A 4EKUA 1FGZA 1ZC4B 1K5DB 1J19A 4B6HA 5DI9B 3HK0A 1AWEA 2YS5A 3O96A 2NMBA 1EAZA 3SV1A 1J0WA 1NU2A 5IRSA 3U7DA 2MDXA 1LB1A 2UZRA 3ODWA 4YL8A 3QIJA 4GOUA 1ZYIA 2DX1A 1W1GA 1Y5OA 3ULCA 2BCJA 1V5MA 2DHJA 5M4YB 2DLWA 2LOXA 4YONA 4HB0B 1DROA 3U8ZA 4HSIA 4F7HA 2HE7A 4BBKA 5KQ1A 3AJ4A 4MK0A 1XD4A 4KHBA 3NW8A 2GUMA 1WJMA 2Z0QA 2NZ8B 5FI1A 5EFXA 2L2IA 2IYBA 1UPRA 3FVCA 2J0MA 2UZSA 2D2QA 1DBHA 5D3VA 2RGNB 1KZGA 1OMWA 2Z14A 1PLSA 3UZTA 5I2SA 4D0NB 2MKRA 2W2XC 5KQ4A 3A98B 4HAYB 4HAXB 4WVFB 2R09A 2LOZA 3GYPA 1XR0B 1PFJA 1UNRA 4GPTB 3PSCA 1XODA 1DDMA 2KCJA 3VOQA 2ROVA 1AQCA 2YS3A 1X1GA 2GJYA 2W2WA 4HAUB 2PZ1A 1BAKA 4HHVA 3QWMA 2Q13A 4WJ7A 4HAWB 2RSGA 2D9YA 2RRFA 4DBBA 2V76A 3N7CA 4K81A 3WA0A 4HDOA 4WSFA 1V89A 2ADZA 5LG4B 2I5FA 2R2YA 1P6SA 4KHAA 3SNHA 2K00A 5D27A 1FAOA 1NI2A 5C5BB 1H4RA 2YT0A 2YT1A 3OANA 3MDBC 2RVBB 3DXEA 4MT7A 4IOYX 4CHJA 1TQZA 2XQNM 3VIAA 3NWFA 1EGXA 2HTHB 4IAPA 4CYEA 4A6KA 3MPXA 3B77A 5C5BA 3TFMA 5HE1A 3NSUA 4P7IA 2P8VA 3U12A 5GOWB 5HE2A 2R0DA 1QQGA 4A5KA 5JHHA 3QBVB 4HAVB 1GC6A 1XCGA 3PVWA 4HATB 3F5RA 4Z2NA 3HW2B 3D8EA 2P0HA 4KHOA 2DYQA 2RUKB 1FHWA 3FSSA 4GMVA 4H8SA 2X18A 2YSZA 4KHBB 4Z2MB 2QKLA 2G35A 2RLOA 3T06A 2EC1A 2COCA 2MFQA 1MPHA 5C6RA 2ZKMX 3PG7A 2OQBA 1Y19B 3CIKA 1W1DA 4GMXB 1ZM0A 2FJUB 2CY4A 3F0WA 4NY0A 3P7ZA 2ELAA 4PQ0A 2H7EA 1V5PA 1P5TA 3G9WA 3V5WA 4DIXA 1TXDA 3NWAA 4HB4B 2COAA 2N0YA 1NTYA 3A8PA 4MY6A 2IFSA 3PVLA 3DCXA 4F7UP 3DXCA 3D8FA 1P3RA 4IFSA 2EJ8A 2Y8GA 4QJ3B 2DKQA 2Y8FA 2M38A 4GZUA 2K2JA 3NWDA 3SO6A 1FB8A 4F7GA 3BINA 4D6WA 1NTVA 1BTNA 4GNKB 2GCLA 2UVMA 5D3WA 2N23A 5KCVA 4CSQA 2ZPYA 1V5UA 3A8QA 1U5FA 5J3TA 3X23A 2EMSA 2Z0PA 4OSNA 3KRWA 4DX90 5J3QA 2CY5A 1GC7A 1MK7B 2J0JA 2I1JA 1OQNA 4EMOA 2VKIA 2DKPA 3AU4A 1H10A 2L1CA 1FOEA 3OHMB 2D4QA 1DDWA 1MIZB 2DFKA 2FJLA 4K2OA 1K5GB 2Z0OA 2D9XA 4ZRKA 4QJ5B 4CHMA 1I2HA 1E5WA 3A58A 4GXBA 1B55A 3PZDA 3ML4A 1Z87A 2KIEA 3ODXA 1IRSA 2LYDA 1FHOA 2D10A 1UEFA 2CAYA 3KSYA 1EF1A 3KZ1A 2KGXB 2H7DA 1EVHA 1GG3A 1X86A 1V61A 2P0FA 3PVUA 4K2PA 1ZSQA 2COFA 4ZRIA 5C16A 1M7RA 2DA0A 4A6FB 1W1HA 1XKEA 1SGHA 5LONB 1UNPA 3ULBA 2J0KA 4L6EA 5JHGA 2YVCA 2Z13A 4QJ4B 4C0AA 1WJ1A 2DTCA 2YS1A 3LJUX 2KUQA 1DYNA 2D9VA 2K49A 5DH9B 3FM8C 2W2XD 2D9WA 2JP2A 2CRFA 5D3XA 4A6FA 1FGYA 4DX8A 2K8EA 2GS0A 1UPQA 3WYFB 3TO1A 5JP4A 3BJIA 1KI1B 2AL6A 5LOPB 4TYZA 5DHFB 5HE0A 1WG7A 2VRWB 2GCJA 4L1RA 2DHKA
chains in the Genus database with same CATH topology
1X1FA 1TJ6A 2DYNA 1XX0A 3FEHA 4XWXA 1X11A 1FHXA 2OTXA 3TVVA 1MIXA 1SHCA 2D9ZA 3TCAA 3PP2A 1QC6A 1OY2A 3D8DA 3AU5A 1WGQA 1ZC3B 3CXBB 2QKMA 2I5CA 1LW3A 1ISNA 2LULA 3IVFA 4HDQA 2J59M 5J3YA 3SUZA 1U5EA 1N3HA 2K2UA 1WVHA 1KZ7A 1MK9B 3M1IB 5CLLB 1PMSA 5DHAB 3P6AA 3KY9A 2CODA 5D3YA 4DXAB 4HB3B 2YRYA 2MWNB 1U27A 1MAIA 2ROZB 3TW1A 2I1KA 1RRPB 1X05A 3HQCA 2AEHA 1V88A 3RCPA 1MKEA 2E2XA 1ZVRA 4Y94A 1DDVA 4KAXB 3ZDTA 4HB2B 2DHIA 4K17A 1WI1A 1U5GA 3PEGA 4TKNA 2YF0A 3SYXA 3ZVRA 3ODOA 1Q67A 2M14A 2DX5A 1RJ2A 1I7AA 1U5DA 2ELBA 2RNRB 1WGUA 1BWNA 2P0DA 4A6HA 1BTKA 5FI0A 1U29A 5HE3A 4HAZB 5JLJB 2DN6A 4KVGB 4ZRJA 1U2BA 2D11A 2EMTA 2KUPA 2LKOA 1M7EA 5C79A 3KRXA 4NSWA 2VSZA 4EJNA 5L81A 5DIFB 2Y7BA 3DXDA 3GYOA 5CLQB 4PNKA 1UNQA 4GN1A 2LG1A 4EKUA 1FGZA 1ZC4B 1K5DB 1J19A 4B6HA 5DI9B 3HK0A 1AWEA 2YS5A 3O96A 2NMBA 1EAZA 3SV1A 1J0WA 1NU2A 3U7DA 2MDXA 1LB1A 2UZRA 3ODWA 4YL8A 3QIJA 2DX1A 1W1GA 1Y5OA 3ULCA 2BCJA 1V5MA 2DHJA 2DLWA 2LOXA 4YONA 4HB0B 1DROA 3U8ZA 4F7HA 2HE7A 4BBKA 5KQ1A 3AJ4A 4MK0A 1XD4A 5FI1A 1WJMA 2Z0QA 2NZ8B 5EFXA 2L2IA 2IYBA 1UPRA 2J0MA 2UZSA 2D2QA 1DBHA 5D3VA 2RGNB 1KZGA 1OMWA 3UZTA 1PLSA 4D0NB 2MKRA 2W2XC 5KQ4A 3A98B 4HAYB 4HAXB 4WVFB 2R09A 2LOZA 3GYPA 1XR0B 1PFJA 1UNRA 4GPTB 3PSCA 1XODA 1DDMA 2KCJA 3VOQA 2ROVA 1AQCA 2YS3A 1X1GA 2GJYA 2W2WA 4HAUB 2PZ1A 1BAKA 4HHVA 3QWMA 2Q13A 4WJ7A 4HAWB 2RSGA 2D9YA 4DBBA 2V76A 3N7CA 4K81A 3WA0A 4HDOA 4WSFA 1V89A 2ADZA 2I5FA 1P6SA 4KHAA 3SNHA 2K00A 5D27A 1FAOA 1NI2A 5C5BB 1H4RA 2YT0A 2YT1A 3OANA 3MDBC 2RVBB 3DXEA 4MT7A 4IOYX 4CHJA 1TQZA 2XQNM 3VIAA 1EGXA 2HTHB 4IAPA 4CYEA 4A6KA 3MPXA 5C5BA 3TFMA 5HE1A 3NSUA 4P7IA 2P8VA 5GOWB 5HE2A 2R0DA 1QQGA 4A5KA 5JHHA 3QBVB 4HAVB 1GC6A 1XCGA 3PVWA 4HATB 3F5RA 4Z2NA 3HW2B 3D8EA 2P0HA 4KHOA 2DYQA 2RUKB 1FHWA 3FSSA 4GMVA 4H8SA 2X18A 2YSZA 4KHBB 4Z2MB 2QKLA 2G35A 2RLOA 3T06A 2EC1A 2COCA 2MFQA 1MPHA 5C6RA 3PG7A 2OQBA 1Y19B 3CIKA 1W1DA 4GMXB 1ZM0A 2CY4A 3F0WA 4NY0A 3P7ZA 2ELAA 4PQ0A 2H7EA 1V5PA 1P5TA 3G9WA 3V5WA 1TXDA 4HB4B 2COAA 2N0YA 1NTYA 3A8PA 4MY6A 2IFSA 3PVLA 4F7UP 3DXCA 3D8FA 1P3RA 4IFSA 2EJ8A 2Y8GA 2DKQA 2Y8FA 2M38A 4GZUA 2K2JA 3SO6A 4F7GA 1FB8A 3BINA 1NTVA 1BTNA 2GCLA 2UVMA 5D3WA 2N23A 5KCVA 2ZPYA 1V5UA 3A8QA 1U5FA 5J3TA 3X23A 2EMSA 2Z0PA 3KRWA 4DX90 5J3QA 2CY5A 1GC7A 1MK7B 2J0JA 2I1JA 1OQNA 4EMOA 2VKIA 2DKPA 3AU4A 1H10A 2L1CA 1FOEA 2D4QA 1DDWA 1MIZB 2DFKA 2FJLA 4K2OA 1K5GB 2Z0OA 2D9XA 4ZRKA 4CHMA 1I2HA 1E5WA 4GXBA 1B55A 3PZDA 3ML4A 1Z87A 3ODXA 1IRSA 2LYDA 1FHOA 2D10A 1UEFA 2CAYA 3KSYA 1EF1A 3KZ1A 2KGXB 2H7DA 1EVHA 1GG3A 1X86A 1V61A 2P0FA 3PVUA 4K2PA 1ZSQA 2COFA 4ZRIA 5C16A 1M7RA 2DA0A 4A6FB 1W1HA 1XKEA 1SGHA 5LONB 1UNPA 3ULBA 2J0KA 4L6EA 5JHGA 2YVCA 4C0AA 1WJ1A 2DTCA 2YS1A 3LJUX 1DYNA 2D9VA 5DH9B 3FM8C 2W2XD 2D9WA 2JP2A 2CRFA 5D3XA 4A6FA 1FGYA 4DX8A 2GS0A 1UPQA 3WYFB 3TO1A 5JP4A 3BJIA 1KI1B 2AL6A 5LOPB 4TYZA 5DHFB 5HE0A 1WG7A 2VRWB 2GCJA 2DHKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X1F A;  1TJ6 A;  2DYN A;  1XX0 A;  3FEH A;  4XWX A;  1X11 A;  1FHX A;  2OTX A;  3TVV A;  1MIX A;  1SHC A;  2D9Z A;  3TCA A;  3PP2 A;  1QC6 A;  1OY2 A;  3D8D A;  3AU5 A;  1WGQ A;  1ZC3 B;  3CXB B;  2QKM A;  2I5C A;  1LW3 A;  1ISN A;  2LUL A;  3IVF A;  4HDQ A;  2J59 M;  5J3Y A;  3SUZ A;  1U5E A;  1N3H A;  2K2U A;  1WVH A;  1KZ7 A;  1MK9 B;  3M1I B;  5CLL B;  1PMS A;  5DHA B;  3P6A A;  3KY9 A;  2COD A;  5D3Y A;  4DXA B;  4HB3 B;  2YRY A;  2MWN B;  1U27 A;  1MAI A;  2ROZ B;  3TW1 A;  2I1K A;  1RRP B;  1X05 A;  3HQC A;  2AEH A;  1V88 A;  3RCP A;  1MKE A;  2E2X A;  1ZVR A;  4Y94 A;  1DDV A;  4KAX B;  3ZDT A;  4HB2 B;  2DHI A;  4K17 A;  1WI1 A;  1U5G A;  3PEG A;  4TKN A;  2YF0 A;  3SYX A;  3ZVR A;  3ODO A;  1Q67 A;  2M14 A;  2DX5 A;  1RJ2 A;  1I7A A;  1U5D A;  2ELB A;  2RNR B;  1WGU A;  1BWN A;  2P0D A;  4A6H A;  1BTK A;  5FI0 A;  1U29 A;  5HE3 A;  4HAZ B;  5JLJ B;  2DN6 A;  4KVG B;  4ZRJ A;  1U2B A;  2D11 A;  2EMT A;  2KUP A;  2LKO A;  1M7E A;  5C79 A;  3KRX A;  4NSW A;  2VSZ A;  4EJN A;  5L81 A;  5DIF B;  2Y7B A;  3DXD A;  3GYO A;  5CLQ B;  4PNK A;  1UNQ A;  4GN1 A;  2LG1 A;  4EKU A;  1FGZ A;  1ZC4 B;  1K5D B;  1J19 A;  4B6H A;  5DI9 B;  3HK0 A;  1AWE A;  2YS5 A;  3O96 A;  2NMB A;  1EAZ A;  3SV1 A;  1J0W A;  1NU2 A;  3U7D A;  2MDX A;  1LB1 A;  2UZR A;  3ODW A;  4YL8 A;  3QIJ A;  2DX1 A;  1W1G A;  1Y5O A;  3ULC A;  2BCJ A;  1V5M A;  2DHJ A;  2DLW A;  2LOX A;  4YON A;  4HB0 B;  1DRO A;  3U8Z A;  4F7H A;  2HE7 A;  4BBK A;  5KQ1 A;  3AJ4 A;  4MK0 A;  1XD4 A;  5FI1 A;  1WJM A;  2Z0Q A;  2NZ8 B;  5EFX A;  2L2I A;  2IYB A;  1UPR A;  2J0M A;  2UZS A;  2D2Q A;  1DBH A;  5D3V A;  2RGN B;  1KZG A;  1OMW A;  3UZT A;  1PLS A;  4D0N B;  2MKR A;  2W2X C;  5KQ4 A;  3A98 B;  4HAY B;  4HAX B;  4WVF B;  2R09 A;  2LOZ A;  3GYP A;  1XR0 B;  1PFJ A;  1UNR A;  4GPT B;  3PSC A;  1XOD A;  1DDM A;  2KCJ A;  3VOQ A;  2ROV A;  1AQC A;  2YS3 A;  1X1G A;  2GJY A;  2W2W A;  4HAU B;  2PZ1 A;  1BAK A;  4HHV A;  3QWM A;  2Q13 A;  4WJ7 A;  4HAW B;  2RSG A;  2D9Y A;  4DBB A;  2V76 A;  3N7C A;  4K81 A;  3WA0 A;  4HDO A;  4WSF A;  1V89 A;  2ADZ A;  2I5F A;  1P6S A;  4KHA A;  3SNH A;  2K00 A;  5D27 A;  1FAO A;  1NI2 A;  5C5B B;  1H4R A;  2YT0 A;  2YT1 A;  3OAN A;  3MDB C;  2RVB B;  3DXE A;  4MT7 A;  4IOY X;  4CHJ A;  1TQZ A;  2XQN M;  3VIA A;  1EGX A;  2HTH B;  4IAP A;  4CYE A;  4A6K A;  3MPX A;  5C5B A;  3TFM A;  5HE1 A;  3NSU A;  4P7I A;  2P8V A;  5GOW B;  5HE2 A;  2R0D A;  1QQG A;  4A5K A;  5JHH A;  3QBV B;  4HAV B;  1GC6 A;  1XCG A;  3PVW A;  4HAT B;  3F5R A;  4Z2N A;  3HW2 B;  3D8E A;  2P0H A;  4KHO A;  2DYQ A;  2RUK B;  1FHW A;  3FSS A;  4GMV A;  4H8S A;  2X18 A;  2YSZ A;  4KHB B;  4Z2M B;  2QKL A;  2G35 A;  2RLO A;  3T06 A;  2EC1 A;  2COC A;  2MFQ A;  1MPH A;  5C6R A;  3PG7 A;  2OQB A;  1Y19 B;  3CIK A;  1W1D A;  4GMX B;  1ZM0 A;  2CY4 A;  3F0W A;  4NY0 A;  3P7Z A;  2ELA A;  4PQ0 A;  2H7E A;  1V5P A;  1P5T A;  3G9W A;  3V5W A;  1TXD A;  4HB4 B;  2COA A;  2N0Y A;  1NTY A;  3A8P A;  4MY6 A;  2IFS A;  3PVL A;  4F7U P;  3DXC A;  3D8F A;  1P3R A;  4IFS A;  2EJ8 A;  2Y8G A;  2DKQ A;  2Y8F A;  2M38 A;  4GZU A;  2K2J A;  3SO6 A;  4F7G A;  1FB8 A;  3BIN A;  1NTV A;  1BTN A;  2GCL A;  2UVM A;  5D3W A;  2N23 A;  5KCV A;  2ZPY A;  1V5U A;  3A8Q A;  1U5F A;  5J3T A;  3X23 A;  2EMS A;  2Z0P A;  3KRW A;  4DX9 0;  5J3Q A;  2CY5 A;  1GC7 A;  1MK7 B;  2J0J A;  2I1J A;  1OQN A;  4EMO A;  2VKI A;  2DKP A;  3AU4 A;  1H10 A;  2L1C A;  1FOE A;  2D4Q A;  1DDW A;  1MIZ B;  2DFK A;  2FJL A;  4K2O A;  1K5G B;  2Z0O A;  2D9X A;  4ZRK A;  4CHM A;  1I2H A;  1E5W A;  4GXB A;  1B55 A;  3PZD A;  3ML4 A;  1Z87 A;  3ODX A;  1IRS A;  2LYD A;  1FHO A;  2D10 A;  1UEF A;  2CAY A;  3KSY A;  1EF1 A;  3KZ1 A;  2KGX B;  2H7D A;  1EVH A;  1GG3 A;  1X86 A;  1V61 A;  2P0F A;  3PVU A;  4K2P A;  1ZSQ A;  2COF A;  4ZRI A;  5C16 A;  1M7R A;  2DA0 A;  4A6F B;  1W1H A;  1XKE A;  1SGH A;  5LON B;  1UNP A;  3ULB A;  2J0K A;  4L6E A;  5JHG A;  2YVC A;  4C0A A;  1WJ1 A;  2DTC A;  2YS1 A;  3LJU X;  1DYN A;  2D9V A;  5DH9 B;  3FM8 C;  2W2X D;  2D9W A;  2JP2 A;  2CRF A;  5D3X A;  4A6F A;  1FGY A;  4DX8 A;  2GS0 A;  1UPQ A;  3WYF B;  3TO1 A;  5JP4 A;  3BJI A;  1KI1 B;  2AL6 A;  5LOP B;  4TYZ A;  5DHF B;  5HE0 A;  1WG7 A;  2VRW B;  2GCJ A;  2DHK A; 
#chains in the Genus database with same CATH topology
 1X1F A;  1TJ6 A;  2Z4D A;  2DYN A;  1XX0 A;  2KIG A;  3FEH A;  4XWX A;  1X11 A;  1FHX A;  2OTX A;  3TVV A;  1MIX A;  1SHC A;  2D9Z A;  3TCA A;  3PP2 A;  1QC6 A;  1OY2 A;  3D8D A;  3AU5 A;  1WGQ A;  1ZC3 B;  3CXB B;  2QKM A;  2I5C A;  1LW3 A;  1ISN A;  2LUL A;  2Z59 A;  3IVF A;  4HDQ A;  2J59 M;  5J3Y A;  3SUZ A;  1U5E A;  1N3H A;  2K2U A;  1WVH A;  1KZ7 A;  1MK9 B;  3M1I B;  2NBV A;  5CLL B;  1PMS A;  1MI1 A;  5DHA B;  3P6A A;  3KY9 A;  2COD A;  5D3Y A;  4DXA B;  4HB3 B;  2YRY A;  2MWN B;  1U27 A;  1MAI A;  2ROZ B;  3TW1 A;  2I1K A;  1RRP B;  1X05 A;  3HQC A;  3HSA A;  2AEH A;  4QXA B;  1V88 A;  3RCP A;  1MKE A;  2E2X A;  1ZVR A;  4Y94 A;  1DDV A;  4KAX B;  3ZDT A;  4OT1 A;  4HB2 B;  5I2M A;  2DHI A;  4K17 A;  1WI1 A;  1U5G A;  3PEG A;  4TKN A;  2YF0 A;  3SYX A;  3ZVR A;  3ODO A;  2KR0 A;  1Q67 A;  2M14 A;  2DX5 A;  1RJ2 A;  1I7A A;  1U5D A;  2ELB A;  2RNR B;  1WGU A;  1BWN A;  2P0D A;  4A6H A;  1BTK A;  5FI0 A;  1U29 A;  5HE3 A;  4HAZ B;  5JLJ B;  2DN6 A;  4KVG B;  4ZRJ A;  1U2B A;  2D11 A;  2EMT A;  2KUP A;  2YT2 A;  2LKO A;  1M7E A;  5C79 A;  3KRX A;  4NSW A;  2VSZ A;  4EJN A;  5L81 A;  5DIF B;  2Y7B A;  3DXD A;  3HIE A;  3GYO A;  1T77 A;  5CLQ B;  4PNK A;  1UNQ A;  4GN1 A;  2LG1 A;  4EKU A;  1FGZ A;  1ZC4 B;  1K5D B;  1J19 A;  4B6H A;  5DI9 B;  3HK0 A;  1AWE A;  2YS5 A;  3O96 A;  2NMB A;  1EAZ A;  3SV1 A;  1J0W A;  1NU2 A;  5IRS A;  3U7D A;  2MDX A;  1LB1 A;  2UZR A;  3ODW A;  4YL8 A;  3QIJ A;  4GOU A;  1ZYI A;  2DX1 A;  1W1G A;  1Y5O A;  3ULC A;  2BCJ A;  1V5M A;  2DHJ A;  5M4Y B;  2DLW A;  2LOX A;  4YON A;  4HB0 B;  1DRO A;  3U8Z A;  4HSI A;  4F7H A;  2HE7 A;  4BBK A;  5KQ1 A;  3AJ4 A;  4MK0 A;  1XD4 A;  4KHB A;  3NW8 A;  2GUM A;  1WJM A;  2Z0Q A;  2NZ8 B;  5FI1 A;  5EFX A;  2L2I A;  2IYB A;  1UPR A;  3FVC A;  2J0M A;  2UZS A;  2D2Q A;  1DBH A;  5D3V A;  2RGN B;  1KZG A;  1OMW A;  2Z14 A;  1PLS A;  3UZT A;  5I2S A;  4D0N B;  2MKR A;  2W2X C;  5KQ4 A;  3A98 B;  4HAY B;  4HAX B;  4WVF B;  2R09 A;  2LOZ A;  3GYP A;  1XR0 B;  1PFJ A;  1UNR A;  4GPT B;  3PSC A;  1XOD A;  1DDM A;  2KCJ A;  3VOQ A;  2ROV A;  1AQC A;  2YS3 A;  1X1G A;  2GJY A;  2W2W A;  4HAU B;  2PZ1 A;  1BAK A;  4HHV A;  3QWM A;  2Q13 A;  4WJ7 A;  4HAW B;  2RSG A;  2D9Y A;  2RRF A;  4DBB A;  2V76 A;  3N7C A;  4K81 A;  3WA0 A;  4HDO A;  4WSF A;  1V89 A;  2ADZ A;  5LG4 B;  2I5F A;  2R2Y A;  1P6S A;  4KHA A;  3SNH A;  2K00 A;  5D27 A;  1FAO A;  1NI2 A;  5C5B B;  1H4R A;  2YT0 A;  2YT1 A;  3OAN A;  3MDB C;  2RVB B;  3DXE A;  4MT7 A;  4IOY X;  4CHJ A;  1TQZ A;  2XQN M;  3VIA A;  3NWF A;  1EGX A;  2HTH B;  4IAP A;  4CYE A;  4A6K A;  3MPX A;  3B77 A;  5C5B A;  3TFM A;  5HE1 A;  3NSU A;  4P7I A;  2P8V A;  3U12 A;  5GOW B;  5HE2 A;  2R0D A;  1QQG A;  4A5K A;  5JHH A;  3QBV B;  4HAV B;  1GC6 A;  1XCG A;  3PVW A;  4HAT B;  3F5R A;  4Z2N A;  3HW2 B;  3D8E A;  2P0H A;  4KHO A;  2DYQ A;  2RUK B;  1FHW A;  3FSS A;  4GMV A;  4H8S A;  2X18 A;  2YSZ A;  4KHB B;  4Z2M B;  2QKL A;  2G35 A;  2RLO A;  3T06 A;  2EC1 A;  2COC A;  2MFQ A;  1MPH A;  5C6R A;  2ZKM X;  3PG7 A;  2OQB A;  1Y19 B;  3CIK A;  1W1D A;  4GMX B;  1ZM0 A;  2FJU B;  2CY4 A;  3F0W A;  4NY0 A;  3P7Z A;  2ELA A;  4PQ0 A;  2H7E A;  1V5P A;  1P5T A;  3G9W A;  3V5W A;  4DIX A;  1TXD A;  3NWA A;  4HB4 B;  2COA A;  2N0Y A;  1NTY A;  3A8P A;  4MY6 A;  2IFS A;  3PVL A;  3DCX A;  4F7U P;  3DXC A;  3D8F A;  1P3R A;  4IFS A;  2EJ8 A;  2Y8G A;  4QJ3 B;  2DKQ A;  2Y8F A;  2M38 A;  4GZU A;  2K2J A;  3NWD A;  3SO6 A;  1FB8 A;  4F7G A;  3BIN A;  4D6W A;  1NTV A;  1BTN A;  4GNK B;  2GCL A;  2UVM A;  5D3W A;  2N23 A;  5KCV A;  4CSQ A;  2ZPY A;  1V5U A;  3A8Q A;  1U5F A;  5J3T A;  3X23 A;  2EMS A;  2Z0P A;  4OSN A;  3KRW A;  4DX9 0;  5J3Q A;  2CY5 A;  1GC7 A;  1MK7 B;  2J0J A;  2I1J A;  1OQN A;  4EMO A;  2VKI A;  2DKP A;  3AU4 A;  1H10 A;  2L1C A;  1FOE A;  3OHM B;  2D4Q A;  1DDW A;  1MIZ B;  2DFK A;  2FJL A;  4K2O A;  1K5G B;  2Z0O A;  2D9X A;  4ZRK A;  4QJ5 B;  4CHM A;  1I2H A;  1E5W A;  3A58 A;  4GXB A;  1B55 A;  3PZD A;  3ML4 A;  1Z87 A;  2KIE A;  3ODX A;  1IRS A;  2LYD A;  1FHO A;  2D10 A;  1UEF A;  2CAY A;  3KSY A;  1EF1 A;  3KZ1 A;  2KGX B;  2H7D A;  1EVH A;  1GG3 A;  1X86 A;  1V61 A;  2P0F A;  3PVU A;  4K2P A;  1ZSQ A;  2COF A;  4ZRI A;  5C16 A;  1M7R A;  2DA0 A;  4A6F B;  1W1H A;  1XKE A;  1SGH A;  5LON B;  1UNP A;  3ULB A;  2J0K A;  4L6E A;  5JHG A;  2YVC A;  2Z13 A;  4QJ4 B;  4C0A A;  1WJ1 A;  2DTC A;  2YS1 A;  3LJU X;  2KUQ A;  1DYN A;  2D9V A;  2K49 A;  5DH9 B;  3FM8 C;  2W2X D;  2D9W A;  2JP2 A;  2CRF A;  5D3X A;  4A6F A;  1FGY A;  4DX8 A;  2K8E A;  2GS0 A;  1UPQ A;  3WYF B;  3TO1 A;  5JP4 A;  3BJI A;  1KI1 B;  2AL6 A;  5LOP B;  4TYZ A;  5DHF B;  5HE0 A;  1WG7 A;  2VRW B;  2GCJ A;  4L1R A;  2DHK A; 
#chains in the Genus database with same CATH homology
 1X1F A;  1TJ6 A;  2DYN A;  1XX0 A;  3FEH A;  4XWX A;  1X11 A;  1FHX A;  2OTX A;  3TVV A;  1MIX A;  1SHC A;  2D9Z A;  3TCA A;  3PP2 A;  1QC6 A;  1OY2 A;  3D8D A;  3AU5 A;  1WGQ A;  1ZC3 B;  3CXB B;  2QKM A;  2I5C A;  1LW3 A;  1ISN A;  2LUL A;  3IVF A;  4HDQ A;  2J59 M;  5J3Y A;  3SUZ A;  1U5E A;  1N3H A;  2K2U A;  1WVH A;  1KZ7 A;  1MK9 B;  3M1I B;  5CLL B;  1PMS A;  5DHA B;  3P6A A;  3KY9 A;  2COD A;  5D3Y A;  4DXA B;  4HB3 B;  2YRY A;  2MWN B;  1U27 A;  1MAI A;  2ROZ B;  3TW1 A;  2I1K A;  1RRP B;  1X05 A;  3HQC A;  2AEH A;  1V88 A;  3RCP A;  1MKE A;  2E2X A;  1ZVR A;  4Y94 A;  1DDV A;  4KAX B;  3ZDT A;  4HB2 B;  2DHI A;  4K17 A;  1WI1 A;  1U5G A;  3PEG A;  4TKN A;  2YF0 A;  3SYX A;  3ZVR A;  3ODO A;  1Q67 A;  2M14 A;  2DX5 A;  1RJ2 A;  1I7A A;  1U5D A;  2ELB A;  2RNR B;  1WGU A;  1BWN A;  2P0D A;  4A6H A;  1BTK A;  5FI0 A;  1U29 A;  5HE3 A;  4HAZ B;  5JLJ B;  2DN6 A;  4KVG B;  4ZRJ A;  1U2B A;  2D11 A;  2EMT A;  2KUP A;  2LKO A;  1M7E A;  5C79 A;  3KRX A;  4NSW A;  2VSZ A;  4EJN A;  5L81 A;  5DIF B;  2Y7B A;  3DXD A;  3GYO A;  5CLQ B;  4PNK A;  1UNQ A;  4GN1 A;  2LG1 A;  4EKU A;  1FGZ A;  1ZC4 B;  1K5D B;  1J19 A;  4B6H A;  5DI9 B;  3HK0 A;  1AWE A;  2YS5 A;  3O96 A;  2NMB A;  1EAZ A;  3SV1 A;  1J0W A;  1NU2 A;  3U7D A;  2MDX A;  1LB1 A;  2UZR A;  3ODW A;  4YL8 A;  3QIJ A;  2DX1 A;  1W1G A;  1Y5O A;  3ULC A;  2BCJ A;  1V5M A;  2DHJ A;  2DLW A;  2LOX A;  4YON A;  4HB0 B;  1DRO A;  3U8Z A;  4F7H A;  2HE7 A;  4BBK A;  5KQ1 A;  3AJ4 A;  4MK0 A;  1XD4 A;  5FI1 A;  1WJM A;  2Z0Q A;  2NZ8 B;  5EFX A;  2L2I A;  2IYB A;  1UPR A;  2J0M A;  2UZS A;  2D2Q A;  1DBH A;  5D3V A;  2RGN B;  1KZG A;  1OMW A;  3UZT A;  1PLS A;  4D0N B;  2MKR A;  2W2X C;  5KQ4 A;  3A98 B;  4HAY B;  4HAX B;  4WVF B;  2R09 A;  2LOZ A;  3GYP A;  1XR0 B;  1PFJ A;  1UNR A;  4GPT B;  3PSC A;  1XOD A;  1DDM A;  2KCJ A;  3VOQ A;  2ROV A;  1AQC A;  2YS3 A;  1X1G A;  2GJY A;  2W2W A;  4HAU B;  2PZ1 A;  1BAK A;  4HHV A;  3QWM A;  2Q13 A;  4WJ7 A;  4HAW B;  2RSG A;  2D9Y A;  4DBB A;  2V76 A;  3N7C A;  4K81 A;  3WA0 A;  4HDO A;  4WSF A;  1V89 A;  2ADZ A;  2I5F A;  1P6S A;  4KHA A;  3SNH A;  2K00 A;  5D27 A;  1FAO A;  1NI2 A;  5C5B B;  1H4R A;  2YT0 A;  2YT1 A;  3OAN A;  3MDB C;  2RVB B;  3DXE A;  4MT7 A;  4IOY X;  4CHJ A;  1TQZ A;  2XQN M;  3VIA A;  1EGX A;  2HTH B;  4IAP A;  4CYE A;  4A6K A;  3MPX A;  5C5B A;  3TFM A;  5HE1 A;  3NSU A;  4P7I A;  2P8V A;  5GOW B;  5HE2 A;  2R0D A;  1QQG A;  4A5K A;  5JHH A;  3QBV B;  4HAV B;  1GC6 A;  1XCG A;  3PVW A;  4HAT B;  3F5R A;  4Z2N A;  3HW2 B;  3D8E A;  2P0H A;  4KHO A;  2DYQ A;  2RUK B;  1FHW A;  3FSS A;  4GMV A;  4H8S A;  2X18 A;  2YSZ A;  4KHB B;  4Z2M B;  2QKL A;  2G35 A;  2RLO A;  3T06 A;  2EC1 A;  2COC A;  2MFQ A;  1MPH A;  5C6R A;  3PG7 A;  2OQB A;  1Y19 B;  3CIK A;  1W1D A;  4GMX B;  1ZM0 A;  2CY4 A;  3F0W A;  4NY0 A;  3P7Z A;  2ELA A;  4PQ0 A;  2H7E A;  1V5P A;  1P5T A;  3G9W A;  3V5W A;  1TXD A;  4HB4 B;  2COA A;  2N0Y A;  1NTY A;  3A8P A;  4MY6 A;  2IFS A;  3PVL A;  4F7U P;  3DXC A;  3D8F A;  1P3R A;  4IFS A;  2EJ8 A;  2Y8G A;  2DKQ A;  2Y8F A;  2M38 A;  4GZU A;  2K2J A;  3SO6 A;  4F7G A;  1FB8 A;  3BIN A;  1NTV A;  1BTN A;  2GCL A;  2UVM A;  5D3W A;  2N23 A;  5KCV A;  2ZPY A;  1V5U A;  3A8Q A;  1U5F A;  5J3T A;  3X23 A;  2EMS A;  2Z0P A;  3KRW A;  4DX9 0;  5J3Q A;  2CY5 A;  1GC7 A;  1MK7 B;  2J0J A;  2I1J A;  1OQN A;  4EMO A;  2VKI A;  2DKP A;  3AU4 A;  1H10 A;  2L1C A;  1FOE A;  2D4Q A;  1DDW A;  1MIZ B;  2DFK A;  2FJL A;  4K2O A;  1K5G B;  2Z0O A;  2D9X A;  4ZRK A;  4CHM A;  1I2H A;  1E5W A;  4GXB A;  1B55 A;  3PZD A;  3ML4 A;  1Z87 A;  3ODX A;  1IRS A;  2LYD A;  1FHO A;  2D10 A;  1UEF A;  2CAY A;  3KSY A;  1EF1 A;  3KZ1 A;  2KGX B;  2H7D A;  1EVH A;  1GG3 A;  1X86 A;  1V61 A;  2P0F A;  3PVU A;  4K2P A;  1ZSQ A;  2COF A;  4ZRI A;  5C16 A;  1M7R A;  2DA0 A;  4A6F B;  1W1H A;  1XKE A;  1SGH A;  5LON B;  1UNP A;  3ULB A;  2J0K A;  4L6E A;  5JHG A;  2YVC A;  4C0A A;  1WJ1 A;  2DTC A;  2YS1 A;  3LJU X;  1DYN A;  2D9V A;  5DH9 B;  3FM8 C;  2W2X D;  2D9W A;  2JP2 A;  2CRF A;  5D3X A;  4A6F A;  1FGY A;  4DX8 A;  2GS0 A;  1UPQ A;  3WYF B;  3TO1 A;  5JP4 A;  3BJI A;  1KI1 B;  2AL6 A;  5LOP B;  4TYZ A;  5DHF B;  5HE0 A;  1WG7 A;  2VRW B;  2GCJ A;  2DHK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...