4MT7A

Crystal structure of collybistin i
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
337
structure length
337
Chain Sequence
QNRDQMRANVINEIMSTERHYIKHLKDICEGYLKQCRKRRDMFSDEQLKVIFGNIEDIYRFQMGFVRDLEKQYNNDDPHLSEIGPCFLEHQDGFWIYSEYCNNHLDACMELSKLMKDSRYQHFFEACRLLQQMIDIAIDGFLLTPVQKICKYPLQLAELLKYTAQDHSDYRYVAAALAVMRNVTQQINERKRRLENIDKIAQWQASVLDWEGDDILDRSSELIYTGEMAWIYQPYGRNQQRVFFLFDHQMVLCKKDLIRRDILYYKGRIDMDKYEVIDIEDGRDDDFNVSMKNAFKLHNKETEEVHLFFAKKLEEKIRWLRAFREERKMVQEDEKIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A conformational switch in collybistin determines the differentiation of inhibitory postsynapses.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Protein binding
molecule keywords Rho guanine nucleotide exchange factor 9
total genus 115
structure length 337
sequence length 337
ec nomenclature
pdb deposition date 2013-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
A PF00169 PH PH domain
A PF00621 RhoGEF RhoGEF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.900.10 Mainly Alpha Up-down Bundle Dbl Homology Domain; Chain A Dbl homology (DH) domain 4mt7A01
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4mt7A02
1WJMA 4KHBB 2GS0A 5GOWB 2DYQA 4EJNA 1Y5OA 1EVHA 3SUZA 4MK0A 1GC6A 2D9ZA 2JP2A 1W1GA 1V89A 1DBHA 1M7EA 3KRWA 5CLQB 3PSCA 3VIAA 3AU4A 4IOYX 4PQ0A 2XQNM 4HAUB 1E5WA 4HB3B 1FGZA 3QBVB 3M1IB 4F7HA 4WJ7A 2DA0A 2COFA 2N23A 2MKRA 2W2XC 4DX90 2D10A 3PP2A 1KZ7A 1XKEA 2NMBA 3DXEA 1MAIA 3GYPA 5C5BA 5D27A 1QC6A 2Z0PA 3P7ZA 2YS1A 3NSUA 2HTHB 3N7CA 2AEHA 5D3WA 2RVBB 3HQCA 5JLJB 1FHWA 3FM8C 1K5GB 3JV3A 5J3TA 2ROZB 2D9YA 4HATB 2Y7BA 1OMWA 5D3YA 2R0DA 3BINA 1W1HA 4HAVB 1GC7A 4A6HA 1U5GA 2J0MA 3F5RA 4GN1A 2LULA 3GYOA 5DHAB 2D4QA 3GF9A 2KCJA 3DXCA 1V5MA 1I2HA 2DHKA 1OY2A 3PVUA 3RCPA 2P0FA 4A6FB 3LJUX 1MK9B 4GMXB 1TXDA 4A6KA 1U2BA 5HE0A 1UNPA 1EGXA 2DX1A 5DI9B 2COCA 3WA0A 1FB8A 2W2WA 2D11A 2COAA 3BJIA 1X86A 1PFJA 1M7RA 4KHAA 1MIZB 2M14A 4HHVA 4KAXB 1MPHA 2N0YA 3TW1A 2I1JA 4GZUA 2YT0A 2CRFA 1WGUA 4L6EA 4GMVA 5KQ1A 4GYVA 1V5UA 1OQNA 4IAPA 2YS3A 2LYDA 4B6HA 2QKLA 4CHJA 3PVLA 4HB0B 1GG3A 5EFXA 2UZRA 4Y94A 2YVCA 2YF0A 5L81A 2GCLA 1H10A 3D8DA 5J3QA 1FAOA 4Z2NA 2KR9A 1X1GA 3A8PA 3MDBC 1XCGA 1UPQA 1WGQA 4GPTB 3HK0A 3KRXA 2YT1A 1K5DB 5C5BB 1ZM0A 4TYZA 1DDMA 2BCJA 2ZPYA 1ZVRA 4NY0A 3SNHA 4XWXA 4BBKA 3U7DA 1U5FA 3AU5A 3WYFB 4HDQA 2AL6A 2ELBA 2DHJA 1Y19B 1IRSA 4F7UP 3KSYA 4HB2B 1ZC4B 5DH9B 4HAXB 1V88A 2IFSA 2DTCA 4MT7A 2LOXA 4D0NB 2RLOA 2K00A 2LG1A 3PG7A 5HE1A 2D9XA 2P0DA 1N3HA 1W1DA 2EJ8A 1WI1A 1XD4A 3TVVA 1AQCA 2VRWB 1B55A 2OTXA 2DFKA 2MFQA 1DDVA 1P3RA 1P5TA 2I5CA 1RRPB 1UNQA 1QQGA 2ADZA 1DYNA 3F0WA 4CYEA 4ZRJA 2CAYA 4HAZB 2UZSA 3MPXA 1MIXA 2K2JA 1V5PA 1ISNA 1J0WA 2D9WA 1X11A 4WVFB 4K17A 4F7GA 2EMTA 2H7EA 4C0AA 2MDXA 5KQ4A 2L1CA 1U27A 1BTNA 2QKMA 3ODOA 2IYBA 4HDOA 4EMOA 1NTVA 3PZDA 4ZRIA 1SHCA 3UZTA 2ROVA 1EAZA 1NU2A 3KY9A 3T06A 1U5DA 2E2XA 2I1KA 4PNKA 2LKOA 2M38A 4EKUA 5LOPB 3ODWA 1UEFA 3CIKA 1X05A 3FEHA 1FOEA 4DXAB 2KGXB 2RSGA 2DLWA 1BY1A 4D0OA 3SO6A 2RGNB 2GCJA 3OANA 4NSWA 2OQBA 3G9WA 5C6RA 2L2IA 2YRYA 2UVMA 5FI1A 2R09A 1KI1B 3V5WA 3P6AA 2V76A 1MKEA 1XODA 3EO2A 3QWMA 2DHIA 3AJ4A 4MY6A 1PMSA 2K2UA 4YL8A 3SYXA 1EF1A 1WG7A 1X1FA 2NZ8B 3ULCA 2J0KA 3TFMA 1LB1A 5CLLB 1J19A 3SV1A 2DKQA 3CXBB 2DYNA 1UPRA 2KUPA 2Y8FA 5JP4A 1FGYA 2DN6A 2GJYA 2YS5A 5J3YA 2CY4A 1DDWA 5C16A 3A98B 1ZC3B 4Z2MB 5DIFB 2DKPA 2LOZA 3ZVRA 5LONB 2DX5A 2Z0QA 1WJ1A 1NTYA 2YSZA 5FI0A 4K2OA 2P0HA 4KVGB 1P6SA 3X23A 2EC1A 1V61A 1UNRA 4DX8A 5JHGA 2CODA 3D8EA 2FJLA 2J0JA 2G35A 1F5XA 4CHMA 3HW2B 1FHXA 2VSZA 2W2XD 3VOQA 2I5FA 4A5KA 3ML4A 2PZ1A 4KHOA 4TKNA 1BAKA 1Z87A 2P8VA 3ULBA 3A8QA 5HE2A 1NI2A 3DXDA 1LW3A 5KCVA 1Q67A 1FHOA 2MWNB 4K81A 1TJ6A 4HAWB 2D9VA 1MK7B 1H4RA 1AWEA 3QIJA 1ZSQA 1BWNA 2H7DA 1KZGA 2Z0OA 1SGHA 4HB4B 5HE3A 4WSFA 2VKIA 3U8ZA 4GOUA 3TCAA 2X18A 2Q13A 4GXBA 1DROA 2EMSA 1U29A 2HE7A 1U5EA 1XX0A 5D3VA 3ODXA 1I7AA 2ELAA 1TQZA 1RJ2A 4IFSA 5C79A 3D8FA 3FSSA 2RNRB 4A6FA 4HAYB 3TO1A 3IVFA 3PVWA 2Y8GA 4YONA 4DBBA 5JHHA 1BTKA 1WVHA 3KZ1A 4H8SA 4K2PA 3PEGA 5D3XA 4ZRKA 2RUKB 2J59M 5DHFB 3O96A 4P7IA 2CY5A 3ZDTA 1XR0B 2D2QA 1PLSA
chains in the Genus database with same CATH superfamily
1WJMA 4KHBB 2GS0A 5GOWB 2DYQA 4EJNA 1Y5OA 1EVHA 3SUZA 4MK0A 1GC6A 2D9ZA 2JP2A 4QJ3B 1W1GA 2Z59A 1V89A 1DBHA 1M7EA 3KRWA 5CLQB 3PSCA 3VIAA 4L1RA 3AU4A 4IOYX 4PQ0A 2XQNM 4HAUB 1E5WA 4HB3B 3U12A 1FGZA 3QBVB 3M1IB 1ZYIA 4F7HA 4WJ7A 2DA0A 2COFA 2N23A 2MKRA 2W2XC 4DX90 2D10A 3PP2A 1KZ7A 1XKEA 2NMBA 3DXEA 1MAIA 3GYPA 3NWFA 5C5BA 2NBVA 5D27A 1QC6A 2Z0PA 3P7ZA 2YS1A 3NSUA 2HTHB 3N7CA 2AEHA 5D3WA 2RVBB 3HQCA 5JLJB 1FHWA 3FM8C 1K5GB 3JV3A 5IRSA 5J3TA 2ROZB 2D9YA 4HATB 2FJUB 2Y7BA 1OMWA 5D3YA 2R0DA 3BINA 1W1HA 4HAVB 1GC7A 4A6HA 1U5GA 2J0MA 3F5RA 4GN1A 2LULA 3GYOA 5DHAB 2D4QA 3GF9A 2KCJA 3DXCA 1V5MA 1I2HA 2DHKA 1OY2A 3PVUA 3RCPA 2P0FA 4A6FB 2K8EA 3LJUX 1MK9B 4GMXB 1TXDA 4A6KA 1U2BA 5HE0A 1UNPA 1EGXA 2DX1A 5DI9B 2COCA 3WA0A 1FB8A 2W2WA 2D11A 2COAA 3BJIA 1X86A 1PFJA 1M7RA 4KHAA 1MIZB 2M14A 4HHVA 4KAXB 1MPHA 2N0YA 3TW1A 2I1JA 4GZUA 2YT0A 2CRFA 1WGUA 4L6EA 3OHMB 4GMVA 5KQ1A 4GYVA 1V5UA 1OQNA 4IAPA 2ZKMX 2YS3A 2LYDA 4B6HA 2QKLA 4CHJA 3PVLA 4HB0B 1GG3A 4CSQA 5EFXA 2UZRA 4Y94A 2YVCA 2YF0A 5L81A 4GNKB 2GCLA 1H10A 3D8DA 4QJ4B 5J3QA 1FAOA 4Z2NA 2KR9A 1X1GA 3A8PA 3MDBC 1XCGA 1UPQA 1WGQA 4GPTB 3HK0A 3KRXA 2YT1A 1K5DB 5C5BB 1ZM0A 4TYZA 1DDMA 2BCJA 2ZPYA 1ZVRA 4NY0A 5M4YB 3SNHA 4XWXA 4BBKA 3U7DA 1U5FA 3AU5A 3WYFB 4HDQA 2AL6A 2ELBA 2DHJA 1Y19B 1IRSA 4F7UP 3KSYA 4HB2B 1ZC4B 5DH9B 4HAXB 4QJ5B 1V88A 2IFSA 2DTCA 4D6WA 4MT7A 2LOXA 4DIXA 4D0NB 2RLOA 2K00A 2LG1A 3PG7A 5HE1A 2D9XA 2P0DA 1N3HA 1W1DA 2EJ8A 1WI1A 1XD4A 3TVVA 1AQCA 2VRWB 5I2MA 1B55A 2OTXA 2DFKA 2MFQA 2RRFA 1DDVA 1P3RA 1P5TA 2I5CA 1RRPB 1UNQA 4OSNA 2Z4DA 3NW8A 1QQGA 2ADZA 5I2SA 1DYNA 3F0WA 4CYEA 4ZRJA 2CAYA 4HAZB 2UZSA 3MPXA 2KR0A 2KIEA 1MIXA 2K2JA 1V5PA 1ISNA 2Z13A 1J0WA 2D9WA 1X11A 4WVFB 4K17A 4F7GA 2EMTA 2H7EA 4C0AA 3NWDA 2MDXA 5KQ4A 2L1CA 1U27A 1BTNA 2QKMA 3ODOA 2IYBA 4HDOA 4EMOA 1NTVA 3PZDA 4ZRIA 1SHCA 3UZTA 2ROVA 1EAZA 1NU2A 3KY9A 3T06A 1U5DA 2E2XA 2I1KA 4PNKA 2LKOA 2M38A 4EKUA 5LOPB 3ODWA 4QXAB 1UEFA 3CIKA 1X05A 3FEHA 1FOEA 4DXAB 2KGXB 2RSGA 4OT1A 2DLWA 1BY1A 4D0OA 3SO6A 2RGNB 2GCJA 3OANA 4NSWA 3B77A 2OQBA 3G9WA 5C6RA 2L2IA 2YRYA 2UVMA 5FI1A 2Z14A 2R09A 1KI1B 3V5WA 3P6AA 2V76A 1MKEA 1XODA 3EO2A 3QWMA 2DHIA 3AJ4A 4MY6A 1PMSA 2K2UA 4YL8A 3SYXA 1EF1A 2KIGA 1WG7A 1X1FA 3NWAA 2NZ8B 2YT2A 3ULCA 2J0KA 3TFMA 2R2YA 1LB1A 5CLLB 3HIEA 1J19A 3SV1A 2DKQA 3CXBB 2DYNA 1UPRA 2KUPA 2Y8FA 5JP4A 4KHBA 1FGYA 2DN6A 2GJYA 2YS5A 5J3YA 2CY4A 1DDWA 3FVCA 5C16A 3A98B 1ZC3B 4Z2MB 5DIFB 2DKPA 2LOZA 3ZVRA 5LONB 2DX5A 2Z0QA 1WJ1A 1NTYA 2YSZA 5FI0A 4K2OA 2P0HA 4KVGB 1P6SA 3X23A 2EC1A 1V61A 1UNRA 4DX8A 5JHGA 2CODA 3D8EA 3DCXA 3HSAA 2FJLA 2J0JA 2G35A 1F5XA 4CHMA 3HW2B 1FHXA 2VSZA 2W2XD 3VOQA 2I5FA 4A5KA 3ML4A 2PZ1A 4KHOA 4TKNA 1BAKA 1Z87A 2P8VA 3ULBA 3A8QA 5HE2A 1NI2A 3DXDA 1LW3A 5KCVA 1Q67A 1FHOA 2MWNB 4K81A 4HSIA 1TJ6A 4HAWB 2D9VA 1MK7B 1H4RA 1AWEA 3QIJA 1ZSQA 1BWNA 2H7DA 1KZGA 2Z0OA 1SGHA 4HB4B 5HE3A 4WSFA 2VKIA 3U8ZA 3A58A 4GOUA 3TCAA 2X18A 2Q13A 1T77A 4GXBA 1DROA 2EMSA 1U29A 2HE7A 1U5EA 1XX0A 5D3VA 3ODXA 1I7AA 2ELAA 1TQZA 1RJ2A 4IFSA 5C79A 3D8FA 3FSSA 5LG4B 2RNRB 4A6FA 1MI1A 4HAYB 3TO1A 3IVFA 3PVWA 2Y8GA 4YONA 4DBBA 5JHHA 2KUQA 2GUMA 1BTKA 1WVHA 3KZ1A 4H8SA 4K2PA 3PEGA 5D3XA 4ZRKA 2RUKB 2J59M 2K49A 5DHFB 3O96A 4P7IA 2CY5A 3ZDTA 1XR0B 2D2QA 1PLSA
chains in the Genus database with same CATH topology
1WJMA 4KHBB 2GS0A 5GOWB 2DYQA 4EJNA 1Y5OA 1EVHA 3SUZA 4MK0A 1GC6A 2D9ZA 2JP2A 1W1GA 1V89A 1DBHA 1M7EA 3KRWA 5CLQB 3PSCA 3VIAA 3AU4A 4IOYX 4PQ0A 2XQNM 4HAUB 1E5WA 4HB3B 1FGZA 3QBVB 3M1IB 4F7HA 4WJ7A 2DA0A 2COFA 2N23A 2MKRA 2W2XC 4DX90 2D10A 3PP2A 1KZ7A 1XKEA 2NMBA 3DXEA 1MAIA 3GYPA 5C5BA 5D27A 1QC6A 2Z0PA 3P7ZA 2YS1A 3NSUA 2HTHB 3N7CA 2AEHA 5D3WA 2RVBB 3HQCA 5JLJB 1FHWA 3FM8C 1K5GB 3JV3A 5J3TA 2ROZB 2D9YA 4HATB 2Y7BA 1OMWA 5D3YA 2R0DA 3BINA 1W1HA 4HAVB 1GC7A 4A6HA 1U5GA 2J0MA 3F5RA 4GN1A 2LULA 3GYOA 5DHAB 2D4QA 3GF9A 2KCJA 3DXCA 1V5MA 1I2HA 2DHKA 1OY2A 3PVUA 3RCPA 2P0FA 4A6FB 3LJUX 1MK9B 4GMXB 1TXDA 4A6KA 1U2BA 5HE0A 1UNPA 1EGXA 2DX1A 5DI9B 2COCA 3WA0A 1FB8A 2W2WA 2D11A 2COAA 3BJIA 1X86A 1PFJA 1M7RA 4KHAA 1MIZB 2M14A 4HHVA 4KAXB 1MPHA 2N0YA 3TW1A 2I1JA 4GZUA 2YT0A 2CRFA 1WGUA 4L6EA 4GMVA 5KQ1A 4GYVA 1V5UA 1OQNA 4IAPA 2YS3A 2LYDA 4B6HA 2QKLA 4CHJA 3PVLA 4HB0B 1GG3A 5EFXA 2UZRA 4Y94A 2YVCA 2YF0A 5L81A 2GCLA 1H10A 3D8DA 5J3QA 1FAOA 4Z2NA 2KR9A 1X1GA 3A8PA 3MDBC 1XCGA 1UPQA 1WGQA 4GPTB 3HK0A 3KRXA 2YT1A 1K5DB 5C5BB 1ZM0A 4TYZA 1DDMA 2BCJA 2ZPYA 1ZVRA 4NY0A 3SNHA 4XWXA 4BBKA 3U7DA 1U5FA 3AU5A 3WYFB 4HDQA 2AL6A 2ELBA 2DHJA 1Y19B 1IRSA 4F7UP 3KSYA 4HB2B 1ZC4B 5DH9B 4HAXB 1V88A 2IFSA 2DTCA 4MT7A 2LOXA 4D0NB 2RLOA 2K00A 2LG1A 3PG7A 5HE1A 2D9XA 2P0DA 1N3HA 1W1DA 2EJ8A 1WI1A 1XD4A 3TVVA 1AQCA 2VRWB 1B55A 2OTXA 2DFKA 2MFQA 1DDVA 1P3RA 1P5TA 2I5CA 1RRPB 1UNQA 1QQGA 2ADZA 1DYNA 3F0WA 4CYEA 4ZRJA 2CAYA 4HAZB 2UZSA 3MPXA 1MIXA 2K2JA 1V5PA 1ISNA 1J0WA 2D9WA 1X11A 4WVFB 4K17A 4F7GA 2EMTA 2H7EA 4C0AA 2MDXA 5KQ4A 2L1CA 1U27A 1BTNA 2QKMA 3ODOA 2IYBA 4HDOA 4EMOA 1NTVA 3PZDA 4ZRIA 1SHCA 3UZTA 2ROVA 1EAZA 1NU2A 3KY9A 3T06A 1U5DA 2E2XA 2I1KA 4PNKA 2LKOA 2M38A 4EKUA 5LOPB 3ODWA 1UEFA 3CIKA 1X05A 3FEHA 1FOEA 4DXAB 2KGXB 2RSGA 2DLWA 1BY1A 4D0OA 3SO6A 2RGNB 2GCJA 3OANA 4NSWA 2OQBA 3G9WA 5C6RA 2L2IA 2YRYA 2UVMA 5FI1A 2R09A 1KI1B 3V5WA 3P6AA 2V76A 1MKEA 1XODA 3EO2A 3QWMA 2DHIA 3AJ4A 4MY6A 1PMSA 2K2UA 4YL8A 3SYXA 1EF1A 1WG7A 1X1FA 2NZ8B 3ULCA 2J0KA 3TFMA 1LB1A 5CLLB 1J19A 3SV1A 2DKQA 3CXBB 2DYNA 1UPRA 2KUPA 2Y8FA 5JP4A 1FGYA 2DN6A 2GJYA 2YS5A 5J3YA 2CY4A 1DDWA 5C16A 3A98B 1ZC3B 4Z2MB 5DIFB 2DKPA 2LOZA 3ZVRA 5LONB 2DX5A 2Z0QA 1WJ1A 1NTYA 2YSZA 5FI0A 4K2OA 2P0HA 4KVGB 1P6SA 3X23A 2EC1A 1V61A 1UNRA 4DX8A 5JHGA 2CODA 3D8EA 2FJLA 2J0JA 2G35A 1F5XA 4CHMA 3HW2B 1FHXA 2VSZA 2W2XD 3VOQA 2I5FA 4A5KA 3ML4A 2PZ1A 4KHOA 4TKNA 1BAKA 1Z87A 2P8VA 3ULBA 3A8QA 5HE2A 1NI2A 3DXDA 1LW3A 5KCVA 1Q67A 1FHOA 2MWNB 4K81A 1TJ6A 4HAWB 2D9VA 1MK7B 1H4RA 1AWEA 3QIJA 1ZSQA 1BWNA 2H7DA 1KZGA 2Z0OA 1SGHA 4HB4B 5HE3A 4WSFA 2VKIA 3U8ZA 4GOUA 3TCAA 2X18A 2Q13A 4GXBA 1DROA 2EMSA 1U29A 2HE7A 1U5EA 1XX0A 5D3VA 3ODXA 1I7AA 2ELAA 1TQZA 1RJ2A 4IFSA 5C79A 3D8FA 3FSSA 2RNRB 4A6FA 4HAYB 3TO1A 3IVFA 3PVWA 2Y8GA 4YONA 4DBBA 5JHHA 1BTKA 1WVHA 3KZ1A 4H8SA 4K2PA 3PEGA 5D3XA 4ZRKA 2RUKB 2J59M 5DHFB 3O96A 4P7IA 2CY5A 3ZDTA 1XR0B 2D2QA 1PLSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WJM A;  4KHB B;  2GS0 A;  5GOW B;  2DYQ A;  4EJN A;  1Y5O A;  1EVH A;  3SUZ A;  4MK0 A;  1GC6 A;  2D9Z A;  2JP2 A;  1W1G A;  1V89 A;  1DBH A;  1M7E A;  3KRW A;  5CLQ B;  3PSC A;  3VIA A;  3AU4 A;  4IOY X;  4PQ0 A;  2XQN M;  4HAU B;  1E5W A;  4HB3 B;  1FGZ A;  3QBV B;  3M1I B;  4F7H A;  4WJ7 A;  2DA0 A;  2COF A;  2N23 A;  2MKR A;  2W2X C;  4DX9 0;  2D10 A;  3PP2 A;  1KZ7 A;  1XKE A;  2NMB A;  3DXE A;  1MAI A;  3GYP A;  5C5B A;  5D27 A;  1QC6 A;  2Z0P A;  3P7Z A;  2YS1 A;  3NSU A;  2HTH B;  3N7C A;  2AEH A;  5D3W A;  2RVB B;  3HQC A;  5JLJ B;  1FHW A;  3FM8 C;  1K5G B;  3JV3 A;  5J3T A;  2ROZ B;  2D9Y A;  4HAT B;  2Y7B A;  1OMW A;  5D3Y A;  2R0D A;  3BIN A;  1W1H A;  4HAV B;  1GC7 A;  4A6H A;  1U5G A;  2J0M A;  3F5R A;  4GN1 A;  2LUL A;  3GYO A;  5DHA B;  2D4Q A;  3GF9 A;  2KCJ A;  3DXC A;  1V5M A;  1I2H A;  2DHK A;  1OY2 A;  3PVU A;  3RCP A;  2P0F A;  4A6F B;  3LJU X;  1MK9 B;  4GMX B;  1TXD A;  4A6K A;  1U2B A;  5HE0 A;  1UNP A;  1EGX A;  2DX1 A;  5DI9 B;  2COC A;  3WA0 A;  1FB8 A;  2W2W A;  2D11 A;  2COA A;  3BJI A;  1X86 A;  1PFJ A;  1M7R A;  4KHA A;  1MIZ B;  2M14 A;  4HHV A;  4KAX B;  1MPH A;  2N0Y A;  3TW1 A;  2I1J A;  4GZU A;  2YT0 A;  2CRF A;  1WGU A;  4L6E A;  4GMV A;  5KQ1 A;  4GYV A;  1V5U A;  1OQN A;  4IAP A;  2YS3 A;  2LYD A;  4B6H A;  2QKL A;  4CHJ A;  3PVL A;  4HB0 B;  1GG3 A;  5EFX A;  2UZR A;  4Y94 A;  2YVC A;  2YF0 A;  5L81 A;  2GCL A;  1H10 A;  3D8D A;  5J3Q A;  1FAO A;  4Z2N A;  2KR9 A;  1X1G A;  3A8P A;  3MDB C;  1XCG A;  1UPQ A;  1WGQ A;  4GPT B;  3HK0 A;  3KRX A;  2YT1 A;  1K5D B;  5C5B B;  1ZM0 A;  4TYZ A;  1DDM A;  2BCJ A;  2ZPY A;  1ZVR A;  4NY0 A;  3SNH A;  4XWX A;  4BBK A;  3U7D A;  1U5F A;  3AU5 A;  3WYF B;  4HDQ A;  2AL6 A;  2ELB A;  2DHJ A;  1Y19 B;  1IRS A;  4F7U P;  3KSY A;  4HB2 B;  1ZC4 B;  5DH9 B;  4HAX B;  1V88 A;  2IFS A;  2DTC A;  4MT7 A;  2LOX A;  4D0N B;  2RLO A;  2K00 A;  2LG1 A;  3PG7 A;  5HE1 A;  2D9X A;  2P0D A;  1N3H A;  1W1D A;  2EJ8 A;  1WI1 A;  1XD4 A;  3TVV A;  1AQC A;  2VRW B;  1B55 A;  2OTX A;  2DFK A;  2MFQ A;  1DDV A;  1P3R A;  1P5T A;  2I5C A;  1RRP B;  1UNQ A;  1QQG A;  2ADZ A;  1DYN A;  3F0W A;  4CYE A;  4ZRJ A;  2CAY A;  4HAZ B;  2UZS A;  3MPX A;  1MIX A;  2K2J A;  1V5P A;  1ISN A;  1J0W A;  2D9W A;  1X11 A;  4WVF B;  4K17 A;  4F7G A;  2EMT A;  2H7E A;  4C0A A;  2MDX A;  5KQ4 A;  2L1C A;  1U27 A;  1BTN A;  2QKM A;  3ODO A;  2IYB A;  4HDO A;  4EMO A;  1NTV A;  3PZD A;  4ZRI A;  1SHC A;  3UZT A;  2ROV A;  1EAZ A;  1NU2 A;  3KY9 A;  3T06 A;  1U5D A;  2E2X A;  2I1K A;  4PNK A;  2LKO A;  2M38 A;  4EKU A;  5LOP B;  3ODW A;  1UEF A;  3CIK A;  1X05 A;  3FEH A;  1FOE A;  4DXA B;  2KGX B;  2RSG A;  2DLW A;  1BY1 A;  4D0O A;  3SO6 A;  2RGN B;  2GCJ A;  3OAN A;  4NSW A;  2OQB A;  3G9W A;  5C6R A;  2L2I A;  2YRY A;  2UVM A;  5FI1 A;  2R09 A;  1KI1 B;  3V5W A;  3P6A A;  2V76 A;  1MKE A;  1XOD A;  3EO2 A;  3QWM A;  2DHI A;  3AJ4 A;  4MY6 A;  1PMS A;  2K2U A;  4YL8 A;  3SYX A;  1EF1 A;  1WG7 A;  1X1F A;  2NZ8 B;  3ULC A;  2J0K A;  3TFM A;  1LB1 A;  5CLL B;  1J19 A;  3SV1 A;  2DKQ A;  3CXB B;  2DYN A;  1UPR A;  2KUP A;  2Y8F A;  5JP4 A;  1FGY A;  2DN6 A;  2GJY A;  2YS5 A;  5J3Y A;  2CY4 A;  1DDW A;  5C16 A;  3A98 B;  1ZC3 B;  4Z2M B;  5DIF B;  2DKP A;  2LOZ A;  3ZVR A;  5LON B;  2DX5 A;  2Z0Q A;  1WJ1 A;  1NTY A;  2YSZ A;  5FI0 A;  4K2O A;  2P0H A;  4KVG B;  1P6S A;  3X23 A;  2EC1 A;  1V61 A;  1UNR A;  4DX8 A;  5JHG A;  2COD A;  3D8E A;  2FJL A;  2J0J A;  2G35 A;  1F5X A;  4CHM A;  3HW2 B;  1FHX A;  2VSZ A;  2W2X D;  3VOQ A;  2I5F A;  4A5K A;  3ML4 A;  2PZ1 A;  4KHO A;  4TKN A;  1BAK A;  1Z87 A;  2P8V A;  3ULB A;  3A8Q A;  5HE2 A;  1NI2 A;  3DXD A;  1LW3 A;  5KCV A;  1Q67 A;  1FHO A;  2MWN B;  4K81 A;  1TJ6 A;  4HAW B;  2D9V A;  1MK7 B;  1H4R A;  1AWE A;  3QIJ A;  1ZSQ A;  1BWN A;  2H7D A;  1KZG A;  2Z0O A;  1SGH A;  4HB4 B;  5HE3 A;  4WSF A;  2VKI A;  3U8Z A;  4GOU A;  3TCA A;  2X18 A;  2Q13 A;  4GXB A;  1DRO A;  2EMS A;  1U29 A;  2HE7 A;  1U5E A;  1XX0 A;  5D3V A;  3ODX A;  1I7A A;  2ELA A;  1TQZ A;  1RJ2 A;  4IFS A;  5C79 A;  3D8F A;  3FSS A;  2RNR B;  4A6F A;  4HAY B;  3TO1 A;  3IVF A;  3PVW A;  2Y8G A;  4YON A;  4DBB A;  5JHH A;  1BTK A;  1WVH A;  3KZ1 A;  4H8S A;  4K2P A;  3PEG A;  5D3X A;  4ZRK A;  2RUK B;  2J59 M;  5DHF B;  3O96 A;  4P7I A;  2CY5 A;  3ZDT A;  1XR0 B;  2D2Q A;  1PLS A; 
#chains in the Genus database with same CATH topology
 1WJM A;  4KHB B;  2GS0 A;  5GOW B;  2DYQ A;  4EJN A;  1Y5O A;  1EVH A;  3SUZ A;  4MK0 A;  1GC6 A;  2D9Z A;  2JP2 A;  4QJ3 B;  1W1G A;  2Z59 A;  1V89 A;  1DBH A;  1M7E A;  3KRW A;  5CLQ B;  3PSC A;  3VIA A;  4L1R A;  3AU4 A;  4IOY X;  4PQ0 A;  2XQN M;  4HAU B;  1E5W A;  4HB3 B;  3U12 A;  1FGZ A;  3QBV B;  3M1I B;  1ZYI A;  4F7H A;  4WJ7 A;  2DA0 A;  2COF A;  2N23 A;  2MKR A;  2W2X C;  4DX9 0;  2D10 A;  3PP2 A;  1KZ7 A;  1XKE A;  2NMB A;  3DXE A;  1MAI A;  3GYP A;  3NWF A;  5C5B A;  2NBV A;  5D27 A;  1QC6 A;  2Z0P A;  3P7Z A;  2YS1 A;  3NSU A;  2HTH B;  3N7C A;  2AEH A;  5D3W A;  2RVB B;  3HQC A;  5JLJ B;  1FHW A;  3FM8 C;  1K5G B;  3JV3 A;  5IRS A;  5J3T A;  2ROZ B;  2D9Y A;  4HAT B;  2FJU B;  2Y7B A;  1OMW A;  5D3Y A;  2R0D A;  3BIN A;  1W1H A;  4HAV B;  1GC7 A;  4A6H A;  1U5G A;  2J0M A;  3F5R A;  4GN1 A;  2LUL A;  3GYO A;  5DHA B;  2D4Q A;  3GF9 A;  2KCJ A;  3DXC A;  1V5M A;  1I2H A;  2DHK A;  1OY2 A;  3PVU A;  3RCP A;  2P0F A;  4A6F B;  2K8E A;  3LJU X;  1MK9 B;  4GMX B;  1TXD A;  4A6K A;  1U2B A;  5HE0 A;  1UNP A;  1EGX A;  2DX1 A;  5DI9 B;  2COC A;  3WA0 A;  1FB8 A;  2W2W A;  2D11 A;  2COA A;  3BJI A;  1X86 A;  1PFJ A;  1M7R A;  4KHA A;  1MIZ B;  2M14 A;  4HHV A;  4KAX B;  1MPH A;  2N0Y A;  3TW1 A;  2I1J A;  4GZU A;  2YT0 A;  2CRF A;  1WGU A;  4L6E A;  3OHM B;  4GMV A;  5KQ1 A;  4GYV A;  1V5U A;  1OQN A;  4IAP A;  2ZKM X;  2YS3 A;  2LYD A;  4B6H A;  2QKL A;  4CHJ A;  3PVL A;  4HB0 B;  1GG3 A;  4CSQ A;  5EFX A;  2UZR A;  4Y94 A;  2YVC A;  2YF0 A;  5L81 A;  4GNK B;  2GCL A;  1H10 A;  3D8D A;  4QJ4 B;  5J3Q A;  1FAO A;  4Z2N A;  2KR9 A;  1X1G A;  3A8P A;  3MDB C;  1XCG A;  1UPQ A;  1WGQ A;  4GPT B;  3HK0 A;  3KRX A;  2YT1 A;  1K5D B;  5C5B B;  1ZM0 A;  4TYZ A;  1DDM A;  2BCJ A;  2ZPY A;  1ZVR A;  4NY0 A;  5M4Y B;  3SNH A;  4XWX A;  4BBK A;  3U7D A;  1U5F A;  3AU5 A;  3WYF B;  4HDQ A;  2AL6 A;  2ELB A;  2DHJ A;  1Y19 B;  1IRS A;  4F7U P;  3KSY A;  4HB2 B;  1ZC4 B;  5DH9 B;  4HAX B;  4QJ5 B;  1V88 A;  2IFS A;  2DTC A;  4D6W A;  4MT7 A;  2LOX A;  4DIX A;  4D0N B;  2RLO A;  2K00 A;  2LG1 A;  3PG7 A;  5HE1 A;  2D9X A;  2P0D A;  1N3H A;  1W1D A;  2EJ8 A;  1WI1 A;  1XD4 A;  3TVV A;  1AQC A;  2VRW B;  5I2M A;  1B55 A;  2OTX A;  2DFK A;  2MFQ A;  2RRF A;  1DDV A;  1P3R A;  1P5T A;  2I5C A;  1RRP B;  1UNQ A;  4OSN A;  2Z4D A;  3NW8 A;  1QQG A;  2ADZ A;  5I2S A;  1DYN A;  3F0W A;  4CYE A;  4ZRJ A;  2CAY A;  4HAZ B;  2UZS A;  3MPX A;  2KR0 A;  2KIE A;  1MIX A;  2K2J A;  1V5P A;  1ISN A;  2Z13 A;  1J0W A;  2D9W A;  1X11 A;  4WVF B;  4K17 A;  4F7G A;  2EMT A;  2H7E A;  4C0A A;  3NWD A;  2MDX A;  5KQ4 A;  2L1C A;  1U27 A;  1BTN A;  2QKM A;  3ODO A;  2IYB A;  4HDO A;  4EMO A;  1NTV A;  3PZD A;  4ZRI A;  1SHC A;  3UZT A;  2ROV A;  1EAZ A;  1NU2 A;  3KY9 A;  3T06 A;  1U5D A;  2E2X A;  2I1K A;  4PNK A;  2LKO A;  2M38 A;  4EKU A;  5LOP B;  3ODW A;  4QXA B;  1UEF A;  3CIK A;  1X05 A;  3FEH A;  1FOE A;  4DXA B;  2KGX B;  2RSG A;  4OT1 A;  2DLW A;  1BY1 A;  4D0O A;  3SO6 A;  2RGN B;  2GCJ A;  3OAN A;  4NSW A;  3B77 A;  2OQB A;  3G9W A;  5C6R A;  2L2I A;  2YRY A;  2UVM A;  5FI1 A;  2Z14 A;  2R09 A;  1KI1 B;  3V5W A;  3P6A A;  2V76 A;  1MKE A;  1XOD A;  3EO2 A;  3QWM A;  2DHI A;  3AJ4 A;  4MY6 A;  1PMS A;  2K2U A;  4YL8 A;  3SYX A;  1EF1 A;  2KIG A;  1WG7 A;  1X1F A;  3NWA A;  2NZ8 B;  2YT2 A;  3ULC A;  2J0K A;  3TFM A;  2R2Y A;  1LB1 A;  5CLL B;  3HIE A;  1J19 A;  3SV1 A;  2DKQ A;  3CXB B;  2DYN A;  1UPR A;  2KUP A;  2Y8F A;  5JP4 A;  4KHB A;  1FGY A;  2DN6 A;  2GJY A;  2YS5 A;  5J3Y A;  2CY4 A;  1DDW A;  3FVC A;  5C16 A;  3A98 B;  1ZC3 B;  4Z2M B;  5DIF B;  2DKP A;  2LOZ A;  3ZVR A;  5LON B;  2DX5 A;  2Z0Q A;  1WJ1 A;  1NTY A;  2YSZ A;  5FI0 A;  4K2O A;  2P0H A;  4KVG B;  1P6S A;  3X23 A;  2EC1 A;  1V61 A;  1UNR A;  4DX8 A;  5JHG A;  2COD A;  3D8E A;  3DCX A;  3HSA A;  2FJL A;  2J0J A;  2G35 A;  1F5X A;  4CHM A;  3HW2 B;  1FHX A;  2VSZ A;  2W2X D;  3VOQ A;  2I5F A;  4A5K A;  3ML4 A;  2PZ1 A;  4KHO A;  4TKN A;  1BAK A;  1Z87 A;  2P8V A;  3ULB A;  3A8Q A;  5HE2 A;  1NI2 A;  3DXD A;  1LW3 A;  5KCV A;  1Q67 A;  1FHO A;  2MWN B;  4K81 A;  4HSI A;  1TJ6 A;  4HAW B;  2D9V A;  1MK7 B;  1H4R A;  1AWE A;  3QIJ A;  1ZSQ A;  1BWN A;  2H7D A;  1KZG A;  2Z0O A;  1SGH A;  4HB4 B;  5HE3 A;  4WSF A;  2VKI A;  3U8Z A;  3A58 A;  4GOU A;  3TCA A;  2X18 A;  2Q13 A;  1T77 A;  4GXB A;  1DRO A;  2EMS A;  1U29 A;  2HE7 A;  1U5E A;  1XX0 A;  5D3V A;  3ODX A;  1I7A A;  2ELA A;  1TQZ A;  1RJ2 A;  4IFS A;  5C79 A;  3D8F A;  3FSS A;  5LG4 B;  2RNR B;  4A6F A;  1MI1 A;  4HAY B;  3TO1 A;  3IVF A;  3PVW A;  2Y8G A;  4YON A;  4DBB A;  5JHH A;  2KUQ A;  2GUM A;  1BTK A;  1WVH A;  3KZ1 A;  4H8S A;  4K2P A;  3PEG A;  5D3X A;  4ZRK A;  2RUK B;  2J59 M;  2K49 A;  5DHF B;  3O96 A;  4P7I A;  2CY5 A;  3ZDT A;  1XR0 B;  2D2Q A;  1PLS A; 
#chains in the Genus database with same CATH homology
 1WJM A;  4KHB B;  2GS0 A;  5GOW B;  2DYQ A;  4EJN A;  1Y5O A;  1EVH A;  3SUZ A;  4MK0 A;  1GC6 A;  2D9Z A;  2JP2 A;  1W1G A;  1V89 A;  1DBH A;  1M7E A;  3KRW A;  5CLQ B;  3PSC A;  3VIA A;  3AU4 A;  4IOY X;  4PQ0 A;  2XQN M;  4HAU B;  1E5W A;  4HB3 B;  1FGZ A;  3QBV B;  3M1I B;  4F7H A;  4WJ7 A;  2DA0 A;  2COF A;  2N23 A;  2MKR A;  2W2X C;  4DX9 0;  2D10 A;  3PP2 A;  1KZ7 A;  1XKE A;  2NMB A;  3DXE A;  1MAI A;  3GYP A;  5C5B A;  5D27 A;  1QC6 A;  2Z0P A;  3P7Z A;  2YS1 A;  3NSU A;  2HTH B;  3N7C A;  2AEH A;  5D3W A;  2RVB B;  3HQC A;  5JLJ B;  1FHW A;  3FM8 C;  1K5G B;  3JV3 A;  5J3T A;  2ROZ B;  2D9Y A;  4HAT B;  2Y7B A;  1OMW A;  5D3Y A;  2R0D A;  3BIN A;  1W1H A;  4HAV B;  1GC7 A;  4A6H A;  1U5G A;  2J0M A;  3F5R A;  4GN1 A;  2LUL A;  3GYO A;  5DHA B;  2D4Q A;  3GF9 A;  2KCJ A;  3DXC A;  1V5M A;  1I2H A;  2DHK A;  1OY2 A;  3PVU A;  3RCP A;  2P0F A;  4A6F B;  3LJU X;  1MK9 B;  4GMX B;  1TXD A;  4A6K A;  1U2B A;  5HE0 A;  1UNP A;  1EGX A;  2DX1 A;  5DI9 B;  2COC A;  3WA0 A;  1FB8 A;  2W2W A;  2D11 A;  2COA A;  3BJI A;  1X86 A;  1PFJ A;  1M7R A;  4KHA A;  1MIZ B;  2M14 A;  4HHV A;  4KAX B;  1MPH A;  2N0Y A;  3TW1 A;  2I1J A;  4GZU A;  2YT0 A;  2CRF A;  1WGU A;  4L6E A;  4GMV A;  5KQ1 A;  4GYV A;  1V5U A;  1OQN A;  4IAP A;  2YS3 A;  2LYD A;  4B6H A;  2QKL A;  4CHJ A;  3PVL A;  4HB0 B;  1GG3 A;  5EFX A;  2UZR A;  4Y94 A;  2YVC A;  2YF0 A;  5L81 A;  2GCL A;  1H10 A;  3D8D A;  5J3Q A;  1FAO A;  4Z2N A;  2KR9 A;  1X1G A;  3A8P A;  3MDB C;  1XCG A;  1UPQ A;  1WGQ A;  4GPT B;  3HK0 A;  3KRX A;  2YT1 A;  1K5D B;  5C5B B;  1ZM0 A;  4TYZ A;  1DDM A;  2BCJ A;  2ZPY A;  1ZVR A;  4NY0 A;  3SNH A;  4XWX A;  4BBK A;  3U7D A;  1U5F A;  3AU5 A;  3WYF B;  4HDQ A;  2AL6 A;  2ELB A;  2DHJ A;  1Y19 B;  1IRS A;  4F7U P;  3KSY A;  4HB2 B;  1ZC4 B;  5DH9 B;  4HAX B;  1V88 A;  2IFS A;  2DTC A;  4MT7 A;  2LOX A;  4D0N B;  2RLO A;  2K00 A;  2LG1 A;  3PG7 A;  5HE1 A;  2D9X A;  2P0D A;  1N3H A;  1W1D A;  2EJ8 A;  1WI1 A;  1XD4 A;  3TVV A;  1AQC A;  2VRW B;  1B55 A;  2OTX A;  2DFK A;  2MFQ A;  1DDV A;  1P3R A;  1P5T A;  2I5C A;  1RRP B;  1UNQ A;  1QQG A;  2ADZ A;  1DYN A;  3F0W A;  4CYE A;  4ZRJ A;  2CAY A;  4HAZ B;  2UZS A;  3MPX A;  1MIX A;  2K2J A;  1V5P A;  1ISN A;  1J0W A;  2D9W A;  1X11 A;  4WVF B;  4K17 A;  4F7G A;  2EMT A;  2H7E A;  4C0A A;  2MDX A;  5KQ4 A;  2L1C A;  1U27 A;  1BTN A;  2QKM A;  3ODO A;  2IYB A;  4HDO A;  4EMO A;  1NTV A;  3PZD A;  4ZRI A;  1SHC A;  3UZT A;  2ROV A;  1EAZ A;  1NU2 A;  3KY9 A;  3T06 A;  1U5D A;  2E2X A;  2I1K A;  4PNK A;  2LKO A;  2M38 A;  4EKU A;  5LOP B;  3ODW A;  1UEF A;  3CIK A;  1X05 A;  3FEH A;  1FOE A;  4DXA B;  2KGX B;  2RSG A;  2DLW A;  1BY1 A;  4D0O A;  3SO6 A;  2RGN B;  2GCJ A;  3OAN A;  4NSW A;  2OQB A;  3G9W A;  5C6R A;  2L2I A;  2YRY A;  2UVM A;  5FI1 A;  2R09 A;  1KI1 B;  3V5W A;  3P6A A;  2V76 A;  1MKE A;  1XOD A;  3EO2 A;  3QWM A;  2DHI A;  3AJ4 A;  4MY6 A;  1PMS A;  2K2U A;  4YL8 A;  3SYX A;  1EF1 A;  1WG7 A;  1X1F A;  2NZ8 B;  3ULC A;  2J0K A;  3TFM A;  1LB1 A;  5CLL B;  1J19 A;  3SV1 A;  2DKQ A;  3CXB B;  2DYN A;  1UPR A;  2KUP A;  2Y8F A;  5JP4 A;  1FGY A;  2DN6 A;  2GJY A;  2YS5 A;  5J3Y A;  2CY4 A;  1DDW A;  5C16 A;  3A98 B;  1ZC3 B;  4Z2M B;  5DIF B;  2DKP A;  2LOZ A;  3ZVR A;  5LON B;  2DX5 A;  2Z0Q A;  1WJ1 A;  1NTY A;  2YSZ A;  5FI0 A;  4K2O A;  2P0H A;  4KVG B;  1P6S A;  3X23 A;  2EC1 A;  1V61 A;  1UNR A;  4DX8 A;  5JHG A;  2COD A;  3D8E A;  2FJL A;  2J0J A;  2G35 A;  1F5X A;  4CHM A;  3HW2 B;  1FHX A;  2VSZ A;  2W2X D;  3VOQ A;  2I5F A;  4A5K A;  3ML4 A;  2PZ1 A;  4KHO A;  4TKN A;  1BAK A;  1Z87 A;  2P8V A;  3ULB A;  3A8Q A;  5HE2 A;  1NI2 A;  3DXD A;  1LW3 A;  5KCV A;  1Q67 A;  1FHO A;  2MWN B;  4K81 A;  1TJ6 A;  4HAW B;  2D9V A;  1MK7 B;  1H4R A;  1AWE A;  3QIJ A;  1ZSQ A;  1BWN A;  2H7D A;  1KZG A;  2Z0O A;  1SGH A;  4HB4 B;  5HE3 A;  4WSF A;  2VKI A;  3U8Z A;  4GOU A;  3TCA A;  2X18 A;  2Q13 A;  4GXB A;  1DRO A;  2EMS A;  1U29 A;  2HE7 A;  1U5E A;  1XX0 A;  5D3V A;  3ODX A;  1I7A A;  2ELA A;  1TQZ A;  1RJ2 A;  4IFS A;  5C79 A;  3D8F A;  3FSS A;  2RNR B;  4A6F A;  4HAY B;  3TO1 A;  3IVF A;  3PVW A;  2Y8G A;  4YON A;  4DBB A;  5JHH A;  1BTK A;  1WVH A;  3KZ1 A;  4H8S A;  4K2P A;  3PEG A;  5D3X A;  4ZRK A;  2RUK B;  2J59 M;  5DHF B;  3O96 A;  4P7I A;  2CY5 A;  3ZDT A;  1XR0 B;  2D2Q A;  1PLS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...