4MT7A

Crystal structure of collybistin i
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
337
structure length
337
Chain Sequence
QNRDQMRANVINEIMSTERHYIKHLKDICEGYLKQCRKRRDMFSDEQLKVIFGNIEDIYRFQMGFVRDLEKQYNNDDPHLSEIGPCFLEHQDGFWIYSEYCNNHLDACMELSKLMKDSRYQHFFEACRLLQQMIDIAIDGFLLTPVQKICKYPLQLAELLKYTAQDHSDYRYVAAALAVMRNVTQQINERKRRLENIDKIAQWQASVLDWEGDDILDRSSELIYTGEMAWIYQPYGRNQQRVFFLFDHQMVLCKKDLIRRDILYYKGRIDMDKYEVIDIEDGRDDDFNVSMKNAFKLHNKETEEVHLFFAKKLEEKIRWLRAFREERKMVQEDEKIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Rho guanine nucleotide exchange factor 9
publication title A conformational switch in collybistin determines the differentiation of inhibitory postsynapses.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 115
structure length 337
sequence length 337
ec nomenclature
pdb deposition date 2013-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
A PF00169 PH PH domain
A PF00621 RhoGEF RhoGEF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.900.10 Mainly Alpha Up-down Bundle Dbl Homology Domain; Chain A Dbl homology (DH) domain 4mt7A01
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4mt7A02
2YS3A 5L81A 4MY6A 4IFSA 2V76A 4K81A 1FHWA 2YRYA 3V5WA 3GYOA 2CY5A 2I5CA 4NY0A 3HQCA 1ZC3B 3DXCA 2YS5A 5C5BA 1V5PA 1I2HA 2RLOA 5C16A 4D0OA 2DHJA 4KVGB 2D4QA 2R09A 4DX8A 1M7EA 1RJ2A 2DKQA 5HE1A 4A5KA 5JLJB 4HB2B 1XODA 1FB8A 3A8QA 4D0NB 3KY9A 4YL8A 3D8EA 1V88A 1QQGA 1XX0A 2E2XA 1V61A 2M38A 3PVLA 2EMSA 2HE7A 4CHJA 4F7HA 1BTNA 4KHOA 5GOWB 1LB1A 1WGUA 4DBBA 1MPHA 3JV3A 1QC6A 2Z0PA 1U5EA 1FOEA 1MK9B 2RUKB 3GYPA 2R0DA 5DIFB 1H10A 4MK0A 3HW2B 3FM8C 3KRWA 5D3VA 2W2XD 3PSCA 2DX1A 3QIJA 3AU5A 1U5GA 3QWMA 5LONB 4H8SA 1DDWA 1FGZA 5D3XA 5JHGA 4WSFA 1FGYA 3HK0A 4CYEA 2OTXA 2K2UA 1J0WA 4HAUB 2D11A 5KCVA 4GXBA 2COFA 1Y5OA 2MKRA 1GC7A 2DHKA 3KSYA 4HAVB 1P6SA 2D2QA 3SV1A 3EO2A 3ZVRA 4DX90 1NTVA 1DROA 3PP2A 2ROZB 5C5BB 5DHAB 2L1CA 4HB0B 1IRSA 2Q13A 4P7IA 3PEGA 1ZVRA 2MWNB 3OANA 1TJ6A 1NU2A 2YS1A 1EVHA 2VKIA 4K2PA 3SO6A 2RGNB 2DYQA 2NMBA 5C79A 2YT0A 2D9VA 2UZSA 3KRXA 4CHMA 4EKUA 2DYNA 2EC1A 4HAXB 3GF9A 3U8ZA 1W1GA 3FSSA 3G9WA 1U5DA 3RCPA 1PMSA 3WA0A 2Z0OA 1U2BA 4C0AA 1TXDA 2AEHA 3P7ZA 4TYZA 4A6KA 2D9XA 3AJ4A 4GPTB 2GCLA 2EMTA 2L2IA 1LW3A 3ODWA 3TO1A 3U7DA 1MK7B 1MAIA 1UPQA 1V5UA 2ELAA 3LJUX 1FHXA 1OY2A 3VIAA 4WJ7A 1EGXA 1KI1B 3TW1A 4HAWB 3ULCA 5C6RA 2J0MA 3IVFA 3X23A 2DKPA 3PVUA 4GZUA 1MIXA 2Y8FA 4HAZB 1U27A 2VSZA 1XR0B 4TKNA 1K5DB 3TFMA 1Z87A 2COAA 2LOZA 1XCGA 2DX5A 2LULA 2W2WA 5JHHA 1NTYA 1ZSQA 4ZRKA 4IAPA 1M7RA 1MIZB 1WVHA 2P0HA 1ZC4B 4HHVA 1OMWA 2PZ1A 2Y8GA 5DI9B 3SUZA 2YSZA 3PVWA 4XWXA 4EMOA 2J0KA 1X1GA 2J59M 5DH9B 2NZ8B 1BWNA 2D9WA 2DFKA 4HDOA 2AL6A 1EF1A 4KHBB 1W1DA 2K2JA 2GS0A 2ZPYA 2P8VA 4HB3B 3SNHA 1BTKA 1FAOA 2N0YA 2N23A 4MT7A 4L6EA 4A6FB 2ELBA 3TVVA 1BY1A 4GYVA 5D3WA 4DXAB 1ISNA 1U29A 2D10A 1X1FA 2DHIA 1UNRA 1I7AA 2DLWA 2QKLA 1XD4A 2IFSA 2QKMA 1WG7A 1ZM0A 1UNPA 2BCJA 2M14A 2YVCA 2I1KA 3T06A 3ZDTA 1TQZA 5KQ1A 2COCA 3D8FA 2Y7BA 1MKEA 3DXEA 1GG3A 2IYBA 2X18A 5J3QA 1NI2A 3CIKA 2YT1A 5CLLB 4GMVA 1WGQA 5J3TA 4ZRJA 5CLQB 4Y94A 4PQ0A 2LOXA 2MDXA 3ODOA 4BBKA 3FEHA 1EAZA 2LKOA 1Q67A 2GJYA 2XQNM 5FI0A 1X05A 2H7DA 4A6FA 2KUPA 3BINA 2OQBA 3A8PA 4KHAA 3SYXA 2UZRA 4NSWA 2KGXB 1Y19B 1DDVA 3BJIA 2G35A 5HE3A 4F7UP 1WI1A 2Z0QA 4A6HA 3A98B 2I1JA 4K2OA 1V89A 1BAKA 2GCJA 4GN1A 3MDBC 3NSUA 3DXDA 4GMXB 1N3HA 1RRPB 2JP2A 2UVMA 1F5XA 3KZ1A 3O96A 2CODA 1SHCA 4Z2MB 1E5WA 1OQNA 2CY4A 2MFQA 4HATB 1P3RA 4HB4B 3P6AA 4HDQA 3QBVB 2D9YA 1J19A 3ML4A 2HTHB 5HE0A 3WYFB 1U5FA 2VRWB 3M1IB 2CRFA 4IOYX 1AWEA 1KZ7A 3VOQA 1P5TA 1WJMA 1X11A 2KCJA 4F7GA 2FJLA 2W2XC 3TCAA 4Z2NA 1SGHA 2YF0A 3PG7A 2DN6A 3AU4A 2H7EA 4HAYB 2CAYA 2P0FA 2LG1A 1WJ1A 5LOPB 4EJNA 1W1HA 4B6HA 1UPRA 2KR9A 2RVBB 2K00A 3F0WA 1KZGA 3ULBA 1FHOA 2D9ZA 3MPXA 3D8DA 4GOUA 2DTCA 2I5FA 5FI1A 4WVFB 2LYDA 5EFXA 1XKEA 5D3YA 1V5MA 1AQCA 2EJ8A 1X86A 5HE2A 1DBHA 1DDMA 1H4RA 3CXBB 4ZRIA 2ADZA 3N7CA 5KQ4A 2J0JA 4K17A 4PNKA 3ODXA 1DYNA 1K5GB 1PFJA 4KAXB 2P0DA 1GC6A 2ROVA 5JP4A 5J3YA 3PZDA 3F5RA 5DHFB 2RNRB 2RSGA 1B55A 3UZTA 2DA0A 4YONA 1PLSA 5D27A 1UNQA 1UEFA
chains in the Genus database with same CATH superfamily
2YS3A 3B77A 5L81A 4MY6A 4IFSA 2V76A 4K81A 1FHWA 2YRYA 3V5WA 3GYOA 2CY5A 2I5CA 4NY0A 3HQCA 1ZC3B 3DXCA 2YS5A 5C5BA 1V5PA 1I2HA 2RLOA 5C16A 4D0OA 2DHJA 4KVGB 5LG4B 4GNKB 2D4QA 2R09A 4DX8A 1M7EA 4QJ3B 1RJ2A 2DKQA 5HE1A 4QXAB 4A5KA 5JLJB 4HB2B 2K49A 1XODA 1FB8A 3A8QA 4D0NB 3KY9A 4YL8A 3D8EA 1V88A 1QQGA 4QJ4B 1XX0A 2R2YA 2E2XA 1V61A 2M38A 3PVLA 2EMSA 2HE7A 4CHJA 4F7HA 1BTNA 4KHOA 5GOWB 1LB1A 1WGUA 4DBBA 1MPHA 3JV3A 1QC6A 2Z0PA 1U5EA 1FOEA 1MK9B 2RUKB 3NWFA 3GYPA 3U12A 2R0DA 2KUQA 5DIFB 1H10A 4MK0A 3HW2B 3DCXA 3FM8C 3KRWA 2W2XD 3PSCA 2DX1A 3QIJA 5D3VA 3AU5A 1U5GA 3QWMA 5LONB 4H8SA 1DDWA 1FGZA 5D3XA 5JHGA 4WSFA 1FGYA 3HK0A 4CYEA 2OTXA 2K2UA 1J0WA 4HAUB 2D11A 2KIGA 4GXBA 2COFA 1Y5OA 2MKRA 1GC7A 5KCVA 2DHKA 2YT2A 5M4YB 3KSYA 4HAVB 1P6SA 2D2QA 3SV1A 3EO2A 3ZVRA 4DX90 1NTVA 1DROA 3PP2A 1T77A 2ROZB 4CSQA 5C5BB 5DHAB 2L1CA 4HB0B 1IRSA 2Q13A 4P7IA 3PEGA 1ZVRA 2MWNB 3A58A 3OANA 1TJ6A 1NU2A 2YS1A 1EVHA 2VKIA 4K2PA 3SO6A 2RGNB 2DYQA 2NMBA 5C79A 2YT0A 2D9VA 2UZSA 3KRXA 4CHMA 4DIXA 4EKUA 2DYNA 2EC1A 4HAXB 3GF9A 3U8ZA 1W1GA 3FSSA 3G9WA 1U5DA 4HSIA 3RCPA 1PMSA 3WA0A 2Z0OA 1U2BA 4C0AA 1TXDA 2AEHA 3P7ZA 4TYZA 4A6KA 3HSAA 2D9XA 2KIEA 3AJ4A 5IRSA 4GPTB 4L1RA 2GCLA 2EMTA 2L2IA 1LW3A 3ODWA 3TO1A 3U7DA 2Z59A 1MK7B 1MAIA 1UPQA 1V5UA 2ELAA 3LJUX 1FHXA 1OY2A 3VIAA 4WJ7A 1EGXA 1KI1B 2KR0A 3TW1A 4HAWB 3ULCA 5C6RA 2J0MA 4D6WA 3IVFA 3X23A 3NWDA 2DKPA 3PVUA 4GZUA 1MIXA 2Y8FA 4HAZB 4OT1A 1U27A 2VSZA 1XR0B 4TKNA 1K5DB 3TFMA 1Z87A 2COAA 2LOZA 1XCGA 2DX5A 2LULA 2W2WA 3NWAA 5JHHA 1NTYA 1ZSQA 4ZRKA 4IAPA 1M7RA 1MIZB 1WVHA 2P0HA 1ZC4B 4HHVA 1OMWA 4OSNA 5I2MA 2PZ1A 2Y8GA 5DI9B 2RRFA 3SUZA 2YSZA 3PVWA 4XWXA 4EMOA 2J0KA 1X1GA 2J59M 5DH9B 2NZ8B 1BWNA 2D9WA 2DFKA 4HDOA 2AL6A 1EF1A 4KHBB 1W1DA 2K2JA 2GS0A 2ZPYA 2P8VA 4HB3B 3SNHA 2FJUB 1BTKA 1FAOA 2N0YA 2N23A 4MT7A 4L6EA 4A6FB 2ELBA 3TVVA 1BY1A 4GYVA 5D3WA 4DXAB 1ISNA 1U29A 2D10A 1X1FA 2DHIA 1UNRA 1I7AA 2DLWA 2QKLA 1XD4A 2IFSA 2QKMA 1WG7A 1ZM0A 1UNPA 2BCJA 2M14A 2YVCA 2I1KA 3T06A 3ZDTA 1TQZA 5KQ1A 2COCA 3D8FA 2Y7BA 1MKEA 3DXEA 1GG3A 2IYBA 2X18A 5J3QA 1NI2A 3CIKA 2YT1A 5CLLB 4GMVA 1WGQA 5J3TA 4ZRJA 5CLQB 4KHBA 4Y94A 3OHMB 4PQ0A 2LOXA 2MDXA 3ODOA 4BBKA 3FEHA 1EAZA 2LKOA 1Q67A 2GJYA 2XQNM 2Z14A 5FI0A 2K8EA 1ZYIA 1X05A 2H7DA 4A6FA 2KUPA 2OQBA 3A8PA 3BINA 4KHAA 3SYXA 2UZRA 4NSWA 2KGXB 1Y19B 2Z4DA 1DDVA 3BJIA 2G35A 5HE3A 2ZKMX 4F7UP 1WI1A 2Z0QA 4A6HA 3A98B 2I1JA 4K2OA 1V89A 1BAKA 2GCJA 3HIEA 4GN1A 3MDBC 3NSUA 3DXDA 4GMXB 1N3HA 1RRPB 2JP2A 2UVMA 1F5XA 3KZ1A 5I2SA 3O96A 2CODA 2Z13A 1SHCA 4Z2MB 1E5WA 1OQNA 2CY4A 2MFQA 4HATB 1P3RA 3NW8A 4HB4B 3P6AA 4HDQA 3QBVB 2D9YA 1J19A 3ML4A 2HTHB 5HE0A 3WYFB 1U5FA 2VRWB 3M1IB 2CRFA 4IOYX 1AWEA 1KZ7A 3VOQA 1P5TA 1WJMA 1X11A 2KCJA 4F7GA 2FJLA 2W2XC 3TCAA 4Z2NA 1SGHA 2YF0A 3PG7A 2DN6A 3AU4A 2H7EA 4HAYB 2NBVA 1MI1A 2CAYA 2GUMA 2P0FA 2LG1A 1WJ1A 5LOPB 4EJNA 1W1HA 4B6HA 1UPRA 2KR9A 2RVBB 2K00A 3F0WA 1KZGA 3ULBA 1FHOA 2D9ZA 3MPXA 3D8DA 4GOUA 2DTCA 2I5FA 5FI1A 4WVFB 2LYDA 5EFXA 1XKEA 5D3YA 1V5MA 1AQCA 2EJ8A 1X86A 5HE2A 1DBHA 1DDMA 1H4RA 3CXBB 4ZRIA 2ADZA 3N7CA 5KQ4A 2J0JA 4K17A 4PNKA 3ODXA 1DYNA 1K5GB 1PFJA 4KAXB 2P0DA 1GC6A 2ROVA 5JP4A 5J3YA 3PZDA 3F5RA 5DHFB 2RNRB 2RSGA 1B55A 3UZTA 2DA0A 4YONA 1PLSA 5D27A 1UNQA 3FVCA 4QJ5B 1UEFA
chains in the Genus database with same CATH topology
2YS3A 5L81A 4MY6A 4IFSA 2V76A 4K81A 1FHWA 2YRYA 3V5WA 3GYOA 2CY5A 2I5CA 4NY0A 3HQCA 1ZC3B 3DXCA 2YS5A 5C5BA 1V5PA 1I2HA 2RLOA 5C16A 4D0OA 2DHJA 4KVGB 2D4QA 2R09A 4DX8A 1M7EA 1RJ2A 2DKQA 5HE1A 4A5KA 5JLJB 4HB2B 1XODA 1FB8A 3A8QA 4D0NB 3KY9A 4YL8A 3D8EA 1V88A 1QQGA 1XX0A 2E2XA 1V61A 2M38A 3PVLA 2EMSA 2HE7A 4CHJA 4F7HA 1BTNA 4KHOA 5GOWB 1LB1A 1WGUA 4DBBA 1MPHA 3JV3A 1QC6A 2Z0PA 1U5EA 1FOEA 1MK9B 2RUKB 3GYPA 2R0DA 5DIFB 1H10A 4MK0A 3HW2B 3FM8C 3KRWA 5D3VA 2W2XD 3PSCA 2DX1A 3QIJA 3AU5A 1U5GA 3QWMA 5LONB 4H8SA 1DDWA 1FGZA 5D3XA 5JHGA 4WSFA 1FGYA 3HK0A 4CYEA 2OTXA 2K2UA 1J0WA 4HAUB 2D11A 5KCVA 4GXBA 2COFA 1Y5OA 2MKRA 1GC7A 2DHKA 3KSYA 4HAVB 1P6SA 2D2QA 3SV1A 3EO2A 3ZVRA 4DX90 1NTVA 1DROA 3PP2A 2ROZB 5C5BB 5DHAB 2L1CA 4HB0B 1IRSA 2Q13A 4P7IA 3PEGA 1ZVRA 2MWNB 3OANA 1TJ6A 1NU2A 2YS1A 1EVHA 2VKIA 4K2PA 3SO6A 2RGNB 2DYQA 2NMBA 5C79A 2YT0A 2D9VA 2UZSA 3KRXA 4CHMA 4EKUA 2DYNA 2EC1A 4HAXB 3GF9A 3U8ZA 1W1GA 3FSSA 3G9WA 1U5DA 3RCPA 1PMSA 3WA0A 2Z0OA 1U2BA 4C0AA 1TXDA 2AEHA 3P7ZA 4TYZA 4A6KA 2D9XA 3AJ4A 4GPTB 2GCLA 2EMTA 2L2IA 1LW3A 3ODWA 3TO1A 3U7DA 1MK7B 1MAIA 1UPQA 1V5UA 2ELAA 3LJUX 1FHXA 1OY2A 3VIAA 4WJ7A 1EGXA 1KI1B 3TW1A 4HAWB 3ULCA 5C6RA 2J0MA 3IVFA 3X23A 2DKPA 3PVUA 4GZUA 1MIXA 2Y8FA 4HAZB 1U27A 2VSZA 1XR0B 4TKNA 1K5DB 3TFMA 1Z87A 2COAA 2LOZA 1XCGA 2DX5A 2LULA 2W2WA 5JHHA 1NTYA 1ZSQA 4ZRKA 4IAPA 1M7RA 1MIZB 1WVHA 2P0HA 1ZC4B 4HHVA 1OMWA 2PZ1A 2Y8GA 5DI9B 3SUZA 2YSZA 3PVWA 4XWXA 4EMOA 2J0KA 1X1GA 2J59M 5DH9B 2NZ8B 1BWNA 2D9WA 2DFKA 4HDOA 2AL6A 1EF1A 4KHBB 1W1DA 2K2JA 2GS0A 2ZPYA 2P8VA 4HB3B 3SNHA 1BTKA 1FAOA 2N0YA 2N23A 4MT7A 4L6EA 4A6FB 2ELBA 3TVVA 1BY1A 4GYVA 5D3WA 4DXAB 1ISNA 1U29A 2D10A 1X1FA 2DHIA 1UNRA 1I7AA 2DLWA 2QKLA 1XD4A 2IFSA 2QKMA 1WG7A 1ZM0A 1UNPA 2BCJA 2M14A 2YVCA 2I1KA 3T06A 3ZDTA 1TQZA 5KQ1A 2COCA 3D8FA 2Y7BA 1MKEA 3DXEA 1GG3A 2IYBA 2X18A 5J3QA 1NI2A 3CIKA 2YT1A 5CLLB 4GMVA 1WGQA 5J3TA 4ZRJA 5CLQB 4Y94A 4PQ0A 2LOXA 2MDXA 3ODOA 4BBKA 3FEHA 1EAZA 2LKOA 1Q67A 2GJYA 2XQNM 5FI0A 1X05A 2H7DA 4A6FA 2KUPA 3BINA 2OQBA 3A8PA 4KHAA 3SYXA 2UZRA 4NSWA 2KGXB 1Y19B 1DDVA 3BJIA 2G35A 5HE3A 4F7UP 1WI1A 2Z0QA 4A6HA 3A98B 2I1JA 4K2OA 1V89A 1BAKA 2GCJA 4GN1A 3MDBC 3NSUA 3DXDA 4GMXB 1N3HA 1RRPB 2JP2A 2UVMA 1F5XA 3KZ1A 3O96A 2CODA 1SHCA 4Z2MB 1E5WA 1OQNA 2CY4A 2MFQA 4HATB 1P3RA 4HB4B 3P6AA 4HDQA 3QBVB 2D9YA 1J19A 3ML4A 2HTHB 5HE0A 3WYFB 1U5FA 2VRWB 3M1IB 2CRFA 4IOYX 1AWEA 1KZ7A 3VOQA 1P5TA 1WJMA 1X11A 2KCJA 4F7GA 2FJLA 2W2XC 3TCAA 4Z2NA 1SGHA 2YF0A 3PG7A 2DN6A 3AU4A 2H7EA 4HAYB 2CAYA 2P0FA 2LG1A 1WJ1A 5LOPB 4EJNA 1W1HA 4B6HA 1UPRA 2KR9A 2RVBB 2K00A 3F0WA 1KZGA 3ULBA 1FHOA 2D9ZA 3MPXA 3D8DA 4GOUA 2DTCA 2I5FA 5FI1A 4WVFB 2LYDA 5EFXA 1XKEA 5D3YA 1V5MA 1AQCA 2EJ8A 1X86A 5HE2A 1DBHA 1DDMA 1H4RA 3CXBB 4ZRIA 2ADZA 3N7CA 5KQ4A 2J0JA 4K17A 4PNKA 3ODXA 1DYNA 1K5GB 1PFJA 4KAXB 2P0DA 1GC6A 2ROVA 5JP4A 5J3YA 3PZDA 3F5RA 5DHFB 2RNRB 2RSGA 1B55A 3UZTA 2DA0A 4YONA 1PLSA 5D27A 1UNQA 1UEFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YS3 A;  5L81 A;  4MY6 A;  4IFS A;  2V76 A;  4K81 A;  1FHW A;  2YRY A;  3V5W A;  3GYO A;  2CY5 A;  2I5C A;  4NY0 A;  3HQC A;  1ZC3 B;  3DXC A;  2YS5 A;  5C5B A;  1V5P A;  1I2H A;  2RLO A;  5C16 A;  4D0O A;  2DHJ A;  4KVG B;  2D4Q A;  2R09 A;  4DX8 A;  1M7E A;  1RJ2 A;  2DKQ A;  5HE1 A;  4A5K A;  5JLJ B;  4HB2 B;  1XOD A;  1FB8 A;  3A8Q A;  4D0N B;  3KY9 A;  4YL8 A;  3D8E A;  1V88 A;  1QQG A;  1XX0 A;  2E2X A;  1V61 A;  2M38 A;  3PVL A;  2EMS A;  2HE7 A;  4CHJ A;  4F7H A;  1BTN A;  4KHO A;  5GOW B;  1LB1 A;  1WGU A;  4DBB A;  1MPH A;  3JV3 A;  1QC6 A;  2Z0P A;  1U5E A;  1FOE A;  1MK9 B;  2RUK B;  3GYP A;  2R0D A;  5DIF B;  1H10 A;  4MK0 A;  3HW2 B;  3FM8 C;  3KRW A;  5D3V A;  2W2X D;  3PSC A;  2DX1 A;  3QIJ A;  3AU5 A;  1U5G A;  3QWM A;  5LON B;  4H8S A;  1DDW A;  1FGZ A;  5D3X A;  5JHG A;  4WSF A;  1FGY A;  3HK0 A;  4CYE A;  2OTX A;  2K2U A;  1J0W A;  4HAU B;  2D11 A;  5KCV A;  4GXB A;  2COF A;  1Y5O A;  2MKR A;  1GC7 A;  2DHK A;  3KSY A;  4HAV B;  1P6S A;  2D2Q A;  3SV1 A;  3EO2 A;  3ZVR A;  4DX9 0;  1NTV A;  1DRO A;  3PP2 A;  2ROZ B;  5C5B B;  5DHA B;  2L1C A;  4HB0 B;  1IRS A;  2Q13 A;  4P7I A;  3PEG A;  1ZVR A;  2MWN B;  3OAN A;  1TJ6 A;  1NU2 A;  2YS1 A;  1EVH A;  2VKI A;  4K2P A;  3SO6 A;  2RGN B;  2DYQ A;  2NMB A;  5C79 A;  2YT0 A;  2D9V A;  2UZS A;  3KRX A;  4CHM A;  4EKU A;  2DYN A;  2EC1 A;  4HAX B;  3GF9 A;  3U8Z A;  1W1G A;  3FSS A;  3G9W A;  1U5D A;  3RCP A;  1PMS A;  3WA0 A;  2Z0O A;  1U2B A;  4C0A A;  1TXD A;  2AEH A;  3P7Z A;  4TYZ A;  4A6K A;  2D9X A;  3AJ4 A;  4GPT B;  2GCL A;  2EMT A;  2L2I A;  1LW3 A;  3ODW A;  3TO1 A;  3U7D A;  1MK7 B;  1MAI A;  1UPQ A;  1V5U A;  2ELA A;  3LJU X;  1FHX A;  1OY2 A;  3VIA A;  4WJ7 A;  1EGX A;  1KI1 B;  3TW1 A;  4HAW B;  3ULC A;  5C6R A;  2J0M A;  3IVF A;  3X23 A;  2DKP A;  3PVU A;  4GZU A;  1MIX A;  2Y8F A;  4HAZ B;  1U27 A;  2VSZ A;  1XR0 B;  4TKN A;  1K5D B;  3TFM A;  1Z87 A;  2COA A;  2LOZ A;  1XCG A;  2DX5 A;  2LUL A;  2W2W A;  5JHH A;  1NTY A;  1ZSQ A;  4ZRK A;  4IAP A;  1M7R A;  1MIZ B;  1WVH A;  2P0H A;  1ZC4 B;  4HHV A;  1OMW A;  2PZ1 A;  2Y8G A;  5DI9 B;  3SUZ A;  2YSZ A;  3PVW A;  4XWX A;  4EMO A;  2J0K A;  1X1G A;  2J59 M;  5DH9 B;  2NZ8 B;  1BWN A;  2D9W A;  2DFK A;  4HDO A;  2AL6 A;  1EF1 A;  4KHB B;  1W1D A;  2K2J A;  2GS0 A;  2ZPY A;  2P8V A;  4HB3 B;  3SNH A;  1BTK A;  1FAO A;  2N0Y A;  2N23 A;  4MT7 A;  4L6E A;  4A6F B;  2ELB A;  3TVV A;  1BY1 A;  4GYV A;  5D3W A;  4DXA B;  1ISN A;  1U29 A;  2D10 A;  1X1F A;  2DHI A;  1UNR A;  1I7A A;  2DLW A;  2QKL A;  1XD4 A;  2IFS A;  2QKM A;  1WG7 A;  1ZM0 A;  1UNP A;  2BCJ A;  2M14 A;  2YVC A;  2I1K A;  3T06 A;  3ZDT A;  1TQZ A;  5KQ1 A;  2COC A;  3D8F A;  2Y7B A;  1MKE A;  3DXE A;  1GG3 A;  2IYB A;  2X18 A;  5J3Q A;  1NI2 A;  3CIK A;  2YT1 A;  5CLL B;  4GMV A;  1WGQ A;  5J3T A;  4ZRJ A;  5CLQ B;  4Y94 A;  4PQ0 A;  2LOX A;  2MDX A;  3ODO A;  4BBK A;  3FEH A;  1EAZ A;  2LKO A;  1Q67 A;  2GJY A;  2XQN M;  5FI0 A;  1X05 A;  2H7D A;  4A6F A;  2KUP A;  3BIN A;  2OQB A;  3A8P A;  4KHA A;  3SYX A;  2UZR A;  4NSW A;  2KGX B;  1Y19 B;  1DDV A;  3BJI A;  2G35 A;  5HE3 A;  4F7U P;  1WI1 A;  2Z0Q A;  4A6H A;  3A98 B;  2I1J A;  4K2O A;  1V89 A;  1BAK A;  2GCJ A;  4GN1 A;  3MDB C;  3NSU A;  3DXD A;  4GMX B;  1N3H A;  1RRP B;  2JP2 A;  2UVM A;  1F5X A;  3KZ1 A;  3O96 A;  2COD A;  1SHC A;  4Z2M B;  1E5W A;  1OQN A;  2CY4 A;  2MFQ A;  4HAT B;  1P3R A;  4HB4 B;  3P6A A;  4HDQ A;  3QBV B;  2D9Y A;  1J19 A;  3ML4 A;  2HTH B;  5HE0 A;  3WYF B;  1U5F A;  2VRW B;  3M1I B;  2CRF A;  4IOY X;  1AWE A;  1KZ7 A;  3VOQ A;  1P5T A;  1WJM A;  1X11 A;  2KCJ A;  4F7G A;  2FJL A;  2W2X C;  3TCA A;  4Z2N A;  1SGH A;  2YF0 A;  3PG7 A;  2DN6 A;  3AU4 A;  2H7E A;  4HAY B;  2CAY A;  2P0F A;  2LG1 A;  1WJ1 A;  5LOP B;  4EJN A;  1W1H A;  4B6H A;  1UPR A;  2KR9 A;  2RVB B;  2K00 A;  3F0W A;  1KZG A;  3ULB A;  1FHO A;  2D9Z A;  3MPX A;  3D8D A;  4GOU A;  2DTC A;  2I5F A;  5FI1 A;  4WVF B;  2LYD A;  5EFX A;  1XKE A;  5D3Y A;  1V5M A;  1AQC A;  2EJ8 A;  1X86 A;  5HE2 A;  1DBH A;  1DDM A;  1H4R A;  3CXB B;  4ZRI A;  2ADZ A;  3N7C A;  5KQ4 A;  2J0J A;  4K17 A;  4PNK A;  3ODX A;  1DYN A;  1K5G B;  1PFJ A;  4KAX B;  2P0D A;  1GC6 A;  2ROV A;  5JP4 A;  5J3Y A;  3PZD A;  3F5R A;  5DHF B;  2RNR B;  2RSG A;  1B55 A;  3UZT A;  2DA0 A;  4YON A;  1PLS A;  5D27 A;  1UNQ A;  1UEF A; 
#chains in the Genus database with same CATH topology
 2YS3 A;  3B77 A;  5L81 A;  4MY6 A;  4IFS A;  2V76 A;  4K81 A;  1FHW A;  2YRY A;  3V5W A;  3GYO A;  2CY5 A;  2I5C A;  4NY0 A;  3HQC A;  1ZC3 B;  3DXC A;  2YS5 A;  5C5B A;  1V5P A;  1I2H A;  2RLO A;  5C16 A;  4D0O A;  2DHJ A;  4KVG B;  5LG4 B;  4GNK B;  2D4Q A;  2R09 A;  4DX8 A;  1M7E A;  4QJ3 B;  1RJ2 A;  2DKQ A;  5HE1 A;  4QXA B;  4A5K A;  5JLJ B;  4HB2 B;  2K49 A;  1XOD A;  1FB8 A;  3A8Q A;  4D0N B;  3KY9 A;  4YL8 A;  3D8E A;  1V88 A;  1QQG A;  4QJ4 B;  1XX0 A;  2R2Y A;  2E2X A;  1V61 A;  2M38 A;  3PVL A;  2EMS A;  2HE7 A;  4CHJ A;  4F7H A;  1BTN A;  4KHO A;  5GOW B;  1LB1 A;  1WGU A;  4DBB A;  1MPH A;  3JV3 A;  1QC6 A;  2Z0P A;  1U5E A;  1FOE A;  1MK9 B;  2RUK B;  3NWF A;  3GYP A;  3U12 A;  2R0D A;  2KUQ A;  5DIF B;  1H10 A;  4MK0 A;  3HW2 B;  3DCX A;  3FM8 C;  3KRW A;  2W2X D;  3PSC A;  2DX1 A;  3QIJ A;  5D3V A;  3AU5 A;  1U5G A;  3QWM A;  5LON B;  4H8S A;  1DDW A;  1FGZ A;  5D3X A;  5JHG A;  4WSF A;  1FGY A;  3HK0 A;  4CYE A;  2OTX A;  2K2U A;  1J0W A;  4HAU B;  2D11 A;  2KIG A;  4GXB A;  2COF A;  1Y5O A;  2MKR A;  1GC7 A;  5KCV A;  2DHK A;  2YT2 A;  5M4Y B;  3KSY A;  4HAV B;  1P6S A;  2D2Q A;  3SV1 A;  3EO2 A;  3ZVR A;  4DX9 0;  1NTV A;  1DRO A;  3PP2 A;  1T77 A;  2ROZ B;  4CSQ A;  5C5B B;  5DHA B;  2L1C A;  4HB0 B;  1IRS A;  2Q13 A;  4P7I A;  3PEG A;  1ZVR A;  2MWN B;  3A58 A;  3OAN A;  1TJ6 A;  1NU2 A;  2YS1 A;  1EVH A;  2VKI A;  4K2P A;  3SO6 A;  2RGN B;  2DYQ A;  2NMB A;  5C79 A;  2YT0 A;  2D9V A;  2UZS A;  3KRX A;  4CHM A;  4DIX A;  4EKU A;  2DYN A;  2EC1 A;  4HAX B;  3GF9 A;  3U8Z A;  1W1G A;  3FSS A;  3G9W A;  1U5D A;  4HSI A;  3RCP A;  1PMS A;  3WA0 A;  2Z0O A;  1U2B A;  4C0A A;  1TXD A;  2AEH A;  3P7Z A;  4TYZ A;  4A6K A;  3HSA A;  2D9X A;  2KIE A;  3AJ4 A;  5IRS A;  4GPT B;  4L1R A;  2GCL A;  2EMT A;  2L2I A;  1LW3 A;  3ODW A;  3TO1 A;  3U7D A;  2Z59 A;  1MK7 B;  1MAI A;  1UPQ A;  1V5U A;  2ELA A;  3LJU X;  1FHX A;  1OY2 A;  3VIA A;  4WJ7 A;  1EGX A;  1KI1 B;  2KR0 A;  3TW1 A;  4HAW B;  3ULC A;  5C6R A;  2J0M A;  4D6W A;  3IVF A;  3X23 A;  3NWD A;  2DKP A;  3PVU A;  4GZU A;  1MIX A;  2Y8F A;  4HAZ B;  4OT1 A;  1U27 A;  2VSZ A;  1XR0 B;  4TKN A;  1K5D B;  3TFM A;  1Z87 A;  2COA A;  2LOZ A;  1XCG A;  2DX5 A;  2LUL A;  2W2W A;  3NWA A;  5JHH A;  1NTY A;  1ZSQ A;  4ZRK A;  4IAP A;  1M7R A;  1MIZ B;  1WVH A;  2P0H A;  1ZC4 B;  4HHV A;  1OMW A;  4OSN A;  5I2M A;  2PZ1 A;  2Y8G A;  5DI9 B;  2RRF A;  3SUZ A;  2YSZ A;  3PVW A;  4XWX A;  4EMO A;  2J0K A;  1X1G A;  2J59 M;  5DH9 B;  2NZ8 B;  1BWN A;  2D9W A;  2DFK A;  4HDO A;  2AL6 A;  1EF1 A;  4KHB B;  1W1D A;  2K2J A;  2GS0 A;  2ZPY A;  2P8V A;  4HB3 B;  3SNH A;  2FJU B;  1BTK A;  1FAO A;  2N0Y A;  2N23 A;  4MT7 A;  4L6E A;  4A6F B;  2ELB A;  3TVV A;  1BY1 A;  4GYV A;  5D3W A;  4DXA B;  1ISN A;  1U29 A;  2D10 A;  1X1F A;  2DHI A;  1UNR A;  1I7A A;  2DLW A;  2QKL A;  1XD4 A;  2IFS A;  2QKM A;  1WG7 A;  1ZM0 A;  1UNP A;  2BCJ A;  2M14 A;  2YVC A;  2I1K A;  3T06 A;  3ZDT A;  1TQZ A;  5KQ1 A;  2COC A;  3D8F A;  2Y7B A;  1MKE A;  3DXE A;  1GG3 A;  2IYB A;  2X18 A;  5J3Q A;  1NI2 A;  3CIK A;  2YT1 A;  5CLL B;  4GMV A;  1WGQ A;  5J3T A;  4ZRJ A;  5CLQ B;  4KHB A;  4Y94 A;  3OHM B;  4PQ0 A;  2LOX A;  2MDX A;  3ODO A;  4BBK A;  3FEH A;  1EAZ A;  2LKO A;  1Q67 A;  2GJY A;  2XQN M;  2Z14 A;  5FI0 A;  2K8E A;  1ZYI A;  1X05 A;  2H7D A;  4A6F A;  2KUP A;  2OQB A;  3A8P A;  3BIN A;  4KHA A;  3SYX A;  2UZR A;  4NSW A;  2KGX B;  1Y19 B;  2Z4D A;  1DDV A;  3BJI A;  2G35 A;  5HE3 A;  2ZKM X;  4F7U P;  1WI1 A;  2Z0Q A;  4A6H A;  3A98 B;  2I1J A;  4K2O A;  1V89 A;  1BAK A;  2GCJ A;  3HIE A;  4GN1 A;  3MDB C;  3NSU A;  3DXD A;  4GMX B;  1N3H A;  1RRP B;  2JP2 A;  2UVM A;  1F5X A;  3KZ1 A;  5I2S A;  3O96 A;  2COD A;  2Z13 A;  1SHC A;  4Z2M B;  1E5W A;  1OQN A;  2CY4 A;  2MFQ A;  4HAT B;  1P3R A;  3NW8 A;  4HB4 B;  3P6A A;  4HDQ A;  3QBV B;  2D9Y A;  1J19 A;  3ML4 A;  2HTH B;  5HE0 A;  3WYF B;  1U5F A;  2VRW B;  3M1I B;  2CRF A;  4IOY X;  1AWE A;  1KZ7 A;  3VOQ A;  1P5T A;  1WJM A;  1X11 A;  2KCJ A;  4F7G A;  2FJL A;  2W2X C;  3TCA A;  4Z2N A;  1SGH A;  2YF0 A;  3PG7 A;  2DN6 A;  3AU4 A;  2H7E A;  4HAY B;  2NBV A;  1MI1 A;  2CAY A;  2GUM A;  2P0F A;  2LG1 A;  1WJ1 A;  5LOP B;  4EJN A;  1W1H A;  4B6H A;  1UPR A;  2KR9 A;  2RVB B;  2K00 A;  3F0W A;  1KZG A;  3ULB A;  1FHO A;  2D9Z A;  3MPX A;  3D8D A;  4GOU A;  2DTC A;  2I5F A;  5FI1 A;  4WVF B;  2LYD A;  5EFX A;  1XKE A;  5D3Y A;  1V5M A;  1AQC A;  2EJ8 A;  1X86 A;  5HE2 A;  1DBH A;  1DDM A;  1H4R A;  3CXB B;  4ZRI A;  2ADZ A;  3N7C A;  5KQ4 A;  2J0J A;  4K17 A;  4PNK A;  3ODX A;  1DYN A;  1K5G B;  1PFJ A;  4KAX B;  2P0D A;  1GC6 A;  2ROV A;  5JP4 A;  5J3Y A;  3PZD A;  3F5R A;  5DHF B;  2RNR B;  2RSG A;  1B55 A;  3UZT A;  2DA0 A;  4YON A;  1PLS A;  5D27 A;  1UNQ A;  3FVC A;  4QJ5 B;  1UEF A; 
#chains in the Genus database with same CATH homology
 2YS3 A;  5L81 A;  4MY6 A;  4IFS A;  2V76 A;  4K81 A;  1FHW A;  2YRY A;  3V5W A;  3GYO A;  2CY5 A;  2I5C A;  4NY0 A;  3HQC A;  1ZC3 B;  3DXC A;  2YS5 A;  5C5B A;  1V5P A;  1I2H A;  2RLO A;  5C16 A;  4D0O A;  2DHJ A;  4KVG B;  2D4Q A;  2R09 A;  4DX8 A;  1M7E A;  1RJ2 A;  2DKQ A;  5HE1 A;  4A5K A;  5JLJ B;  4HB2 B;  1XOD A;  1FB8 A;  3A8Q A;  4D0N B;  3KY9 A;  4YL8 A;  3D8E A;  1V88 A;  1QQG A;  1XX0 A;  2E2X A;  1V61 A;  2M38 A;  3PVL A;  2EMS A;  2HE7 A;  4CHJ A;  4F7H A;  1BTN A;  4KHO A;  5GOW B;  1LB1 A;  1WGU A;  4DBB A;  1MPH A;  3JV3 A;  1QC6 A;  2Z0P A;  1U5E A;  1FOE A;  1MK9 B;  2RUK B;  3GYP A;  2R0D A;  5DIF B;  1H10 A;  4MK0 A;  3HW2 B;  3FM8 C;  3KRW A;  5D3V A;  2W2X D;  3PSC A;  2DX1 A;  3QIJ A;  3AU5 A;  1U5G A;  3QWM A;  5LON B;  4H8S A;  1DDW A;  1FGZ A;  5D3X A;  5JHG A;  4WSF A;  1FGY A;  3HK0 A;  4CYE A;  2OTX A;  2K2U A;  1J0W A;  4HAU B;  2D11 A;  5KCV A;  4GXB A;  2COF A;  1Y5O A;  2MKR A;  1GC7 A;  2DHK A;  3KSY A;  4HAV B;  1P6S A;  2D2Q A;  3SV1 A;  3EO2 A;  3ZVR A;  4DX9 0;  1NTV A;  1DRO A;  3PP2 A;  2ROZ B;  5C5B B;  5DHA B;  2L1C A;  4HB0 B;  1IRS A;  2Q13 A;  4P7I A;  3PEG A;  1ZVR A;  2MWN B;  3OAN A;  1TJ6 A;  1NU2 A;  2YS1 A;  1EVH A;  2VKI A;  4K2P A;  3SO6 A;  2RGN B;  2DYQ A;  2NMB A;  5C79 A;  2YT0 A;  2D9V A;  2UZS A;  3KRX A;  4CHM A;  4EKU A;  2DYN A;  2EC1 A;  4HAX B;  3GF9 A;  3U8Z A;  1W1G A;  3FSS A;  3G9W A;  1U5D A;  3RCP A;  1PMS A;  3WA0 A;  2Z0O A;  1U2B A;  4C0A A;  1TXD A;  2AEH A;  3P7Z A;  4TYZ A;  4A6K A;  2D9X A;  3AJ4 A;  4GPT B;  2GCL A;  2EMT A;  2L2I A;  1LW3 A;  3ODW A;  3TO1 A;  3U7D A;  1MK7 B;  1MAI A;  1UPQ A;  1V5U A;  2ELA A;  3LJU X;  1FHX A;  1OY2 A;  3VIA A;  4WJ7 A;  1EGX A;  1KI1 B;  3TW1 A;  4HAW B;  3ULC A;  5C6R A;  2J0M A;  3IVF A;  3X23 A;  2DKP A;  3PVU A;  4GZU A;  1MIX A;  2Y8F A;  4HAZ B;  1U27 A;  2VSZ A;  1XR0 B;  4TKN A;  1K5D B;  3TFM A;  1Z87 A;  2COA A;  2LOZ A;  1XCG A;  2DX5 A;  2LUL A;  2W2W A;  5JHH A;  1NTY A;  1ZSQ A;  4ZRK A;  4IAP A;  1M7R A;  1MIZ B;  1WVH A;  2P0H A;  1ZC4 B;  4HHV A;  1OMW A;  2PZ1 A;  2Y8G A;  5DI9 B;  3SUZ A;  2YSZ A;  3PVW A;  4XWX A;  4EMO A;  2J0K A;  1X1G A;  2J59 M;  5DH9 B;  2NZ8 B;  1BWN A;  2D9W A;  2DFK A;  4HDO A;  2AL6 A;  1EF1 A;  4KHB B;  1W1D A;  2K2J A;  2GS0 A;  2ZPY A;  2P8V A;  4HB3 B;  3SNH A;  1BTK A;  1FAO A;  2N0Y A;  2N23 A;  4MT7 A;  4L6E A;  4A6F B;  2ELB A;  3TVV A;  1BY1 A;  4GYV A;  5D3W A;  4DXA B;  1ISN A;  1U29 A;  2D10 A;  1X1F A;  2DHI A;  1UNR A;  1I7A A;  2DLW A;  2QKL A;  1XD4 A;  2IFS A;  2QKM A;  1WG7 A;  1ZM0 A;  1UNP A;  2BCJ A;  2M14 A;  2YVC A;  2I1K A;  3T06 A;  3ZDT A;  1TQZ A;  5KQ1 A;  2COC A;  3D8F A;  2Y7B A;  1MKE A;  3DXE A;  1GG3 A;  2IYB A;  2X18 A;  5J3Q A;  1NI2 A;  3CIK A;  2YT1 A;  5CLL B;  4GMV A;  1WGQ A;  5J3T A;  4ZRJ A;  5CLQ B;  4Y94 A;  4PQ0 A;  2LOX A;  2MDX A;  3ODO A;  4BBK A;  3FEH A;  1EAZ A;  2LKO A;  1Q67 A;  2GJY A;  2XQN M;  5FI0 A;  1X05 A;  2H7D A;  4A6F A;  2KUP A;  3BIN A;  2OQB A;  3A8P A;  4KHA A;  3SYX A;  2UZR A;  4NSW A;  2KGX B;  1Y19 B;  1DDV A;  3BJI A;  2G35 A;  5HE3 A;  4F7U P;  1WI1 A;  2Z0Q A;  4A6H A;  3A98 B;  2I1J A;  4K2O A;  1V89 A;  1BAK A;  2GCJ A;  4GN1 A;  3MDB C;  3NSU A;  3DXD A;  4GMX B;  1N3H A;  1RRP B;  2JP2 A;  2UVM A;  1F5X A;  3KZ1 A;  3O96 A;  2COD A;  1SHC A;  4Z2M B;  1E5W A;  1OQN A;  2CY4 A;  2MFQ A;  4HAT B;  1P3R A;  4HB4 B;  3P6A A;  4HDQ A;  3QBV B;  2D9Y A;  1J19 A;  3ML4 A;  2HTH B;  5HE0 A;  3WYF B;  1U5F A;  2VRW B;  3M1I B;  2CRF A;  4IOY X;  1AWE A;  1KZ7 A;  3VOQ A;  1P5T A;  1WJM A;  1X11 A;  2KCJ A;  4F7G A;  2FJL A;  2W2X C;  3TCA A;  4Z2N A;  1SGH A;  2YF0 A;  3PG7 A;  2DN6 A;  3AU4 A;  2H7E A;  4HAY B;  2CAY A;  2P0F A;  2LG1 A;  1WJ1 A;  5LOP B;  4EJN A;  1W1H A;  4B6H A;  1UPR A;  2KR9 A;  2RVB B;  2K00 A;  3F0W A;  1KZG A;  3ULB A;  1FHO A;  2D9Z A;  3MPX A;  3D8D A;  4GOU A;  2DTC A;  2I5F A;  5FI1 A;  4WVF B;  2LYD A;  5EFX A;  1XKE A;  5D3Y A;  1V5M A;  1AQC A;  2EJ8 A;  1X86 A;  5HE2 A;  1DBH A;  1DDM A;  1H4R A;  3CXB B;  4ZRI A;  2ADZ A;  3N7C A;  5KQ4 A;  2J0J A;  4K17 A;  4PNK A;  3ODX A;  1DYN A;  1K5G B;  1PFJ A;  4KAX B;  2P0D A;  1GC6 A;  2ROV A;  5JP4 A;  5J3Y A;  3PZD A;  3F5R A;  5DHF B;  2RNR B;  2RSG A;  1B55 A;  3UZT A;  2DA0 A;  4YON A;  1PLS A;  5D27 A;  1UNQ A;  1UEF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...