4MT7A

Crystal structure of collybistin i
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
337
structure length
337
Chain Sequence
b'QNRDQMRANVINEIMSTERHYIKHLKDICEGYLKQCRKRRDMFSDEQLKVIFGNIEDIYRFQMGFVRDLEKQYNNDDPHLSEIGPCFLEHQDGFWIYSEYCNNHLDACMELSKLMKDSRYQHFFEACRLLQQMIDIAIDGFLLTPVQKICKYPLQLAELLKYTAQDHSDYRYVAAALAVMRNVTQQINERKRRLENIDKIAQWQASVLDWEGDDILDRSSELIYTGEMAWIYQPYGRNQQRVFFLFDHQMVLCKKDLIRRDILYYKGRIDMDKYEVIDIEDGRDDDFNVSMKNAFKLHNKETEEVHLFFAKKLEEKIRWLRAFREERKMVQEDEKIG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Rho guanine nucleotide exchange factor 9
publication title A conformational switch in collybistin determines the differentiation of inhibitory postsynapses.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Protein binding
total genus 115
structure length 337
sequence length 337
ec nomenclature
pdb deposition date 2013-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
A PF00169 PH PH domain
A PF00621 RhoGEF RhoGEF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.900.10 Mainly Alpha Up-down Bundle Dbl Homology Domain; Chain A Dbl homology (DH) domain 4mt7A01
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4mt7A02
2D11A 4YL8A 1AQCA 2RUKB 2YVCA 1V5MA 2Z0PA 3VOQA 3TW1A 3IVFA 3SUZA 3TVVA 1X1GA 5DH9B 4Y94A 1FHWA 4K2OA 2NMBA 4WJ7A 2ADZA 4C0AA 2UZRA 2RSGA 3P7ZA 4CYEA 5JLJB 2KR9A 2OQBA 1XODA 5HE1A 1N3HA 2D2QA 2LKOA 1J0WA 2D9XA 2MDXA 4EMOA 2EMTA 1WJMA 1BY1A 1PMSA 4MT7A 5CLQB 3F5RA 1PFJA 4HAYB 2KGXB 1SHCA 3AU4A 5KQ4A 2LULA 5J3QA 1GC6A 2ROVA 2DKQA 1OY2A 4GOUA 1ZM0A 2COCA 1ZC3B 4H8SA 3ZVRA 2FJLA 1MK9B 3RCPA 1DYNA 2H7DA 1FOEA 2DTCA 3HQCA 1U5FA 2AL6A 2DFKA 3SV1A 1ISNA 2N23A 1W1DA 4GMVA 2D10A 3EO2A 2P0HA 4A6HA 4HB4B 3WYFB 4WVFB 1RRPB 1XCGA 4D0NB 3AU5A 2MKRA 2COFA 2I5CA 3SNHA 1WGQA 4K17A 1NTVA 1ZVRA 5D3YA 1X05A 2Z0QA 4YONA 3HK0A 3KZ1A 4HAVB 2D9VA 2BCJA 2YT1A 2DX5A 5FI1A 2W2XC 5LONB 4KVGB 1P3RA 1AWEA 5C79A 2DX1A 1V61A 1P5TA 3ULCA 3DXCA 3FEHA 2LOZA 2YS1A 1DDWA 1RJ2A 2D9ZA 3AJ4A 4DXAB 2RGNB 2CAYA 3QWMA 2DHKA 3A8PA 3HW2B 3ODXA 2GJYA 3CIKA 1SGHA 1EF1A 2CRFA 2GCJA 3KRXA 2P0FA 3QIJA 2K2JA 5HE0A 2EJ8A 3KSYA 3FM8C 1FHXA 3A8QA 2HE7A 3BJIA 4F7UP 2J0MA 2W2XD 1IRSA 1V5PA 1U29A 3DXEA 4TYZA 3GF9A 2R09A 1Z87A 4A6FB 4K81A 4HHVA 3OANA 2PZ1A 2JP2A 5JP4A 3PVUA 1LB1A 2ZPYA 1EGXA 2DYNA 4IOYX 2DLWA 4Z2NA 1BWNA 1OMWA 3M1IB 2Q13A 1I7AA 4ZRKA 2CY4A 1OQNA 1FGZA 4DX90 4GPTB 2DN6A 1FB8A 3F0WA 2VSZA 3FSSA 4A5KA 1U2BA 2QKLA 2Z0OA 1V5UA 5L81A 2H7EA 3PP2A 1WI1A 5D3XA 2M38A 4MY6A 2MFQA 1FHOA 2R0DA 4GZUA 4CHMA 2EMSA 2OTXA 4XWXA 5KQ1A 2J0JA 1XKEA 1GG3A 3PVWA 3X23A 1MPHA 4A6FA 1TQZA 5JHGA 3TCAA 3ZDTA 1U5EA 3PSCA 3N7CA 2NZ8B 1WGUA 1K5GB 4B6HA 1FAOA 2J0KA 2UZSA 2GCLA 1W1GA 2RNRB 1EAZA 3PZDA 4TKNA 1MKEA 3WA0A 1DROA 5JHHA 3V5WA 2DA0A 2LOXA 4HAUB 4IFSA 4HAWB 1E5WA 1NTYA 2DKPA 4ZRIA 1UPQA 1ZC4B 4NSWA 4K2PA 1W1HA 5C5BA 4D0OA 5CLLB 4P7IA 1MIZB 2ROZB 4HAZB 4HATB 5DIFB 1X1FA 1V89A 4MK0A 5DHAB 4CHJA 4NY0A 1Q67A 4ZRJA 1Y19B 1V88A 4GMXB 2HTHB 3ODOA 1XR0B 5C6RA 4EJNA 3DXDA 1U5GA 2EC1A 4GYVA 4WSFA 2COAA 2DHJA 2XQNM 1XX0A 5KCVA 5J3TA 2LG1A 2VRWB 5D3WA 3VIAA 2G35A 2DYQA 3TO1A 2KUPA 3CXBB 2VKIA 1B55A 1J19A 2D4QA 2YF0A 2CY5A 2YS3A 3U8ZA 3A98B 2I1KA 4HB2B 1EVHA 3BINA 1NU2A 4HAXB 1NI2A 2RLOA 3PG7A 5FI0A 1WG7A 1MAIA 1KZ7A 2Y8GA 1UNPA 2MWNB 3GYOA 4PQ0A 3MPXA 1X86A 5EFXA 4PNKA 5C5BB 3KY9A 2E2XA 2CODA 1DBHA 2ELBA 4DBBA 1H10A 4A6KA 2L1CA 3ODWA 2Y8FA 2N0YA 4IAPA 3KRWA 1KI1B 3ULBA 1LW3A 1U5DA 2ELAA 1M7EA 1K5DB 5HE3A 5DHFB 1QQGA 1UNQA 4KHOA 2V76A 2IYBA 2P8VA 2D9YA 1Y5OA 1I2HA 4BBKA 3T06A 3D8EA 2DHIA 2I1JA 1H4RA 3PEGA 3NSUA 3P6AA 2K00A 2L2IA 2YSZA 4GXBA 1UEFA 1TXDA 4F7HA 3LJUX 3ML4A 1GC7A 2UVMA 4EKUA 2GS0A 1WVHA 2YRYA 2YT0A 5J3YA 2AEHA 2D9WA 3SYXA 1DDVA 1BTKA 5LOPB 2J59M 4DX8A 4HB3B 4KHAA 1ZSQA 2QKMA 5C16A 1BTNA 1FGYA 1UPRA 3D8FA 1QC6A 2W2WA 5D3VA 1BAKA 3PVLA 4HDOA 2YS5A 1MK7B 3TFMA 1MIXA 1F5XA 1TJ6A 1PLSA 2I5FA 4HB0B 5GOWB 2IFSA 4GN1A 2P0DA 5HE2A 1M7RA 1P6SA 3UZTA 3JV3A 1XD4A 1U27A 4HDQA 3D8DA 1DDMA 1X11A 2X18A 5DI9B 4KAXB 1UNRA 4L6EA 3QBVB 3O96A 1WJ1A 3G9WA 3U7DA 3GYPA 2RVBB 1KZGA 3SO6A 2LYDA 4Z2MB 2M14A 2K2UA 2KCJA 5D27A 4F7GA 2Y7BA 4KHBB 3MDBC
chains in the Genus database with same CATH superfamily
4QJ3B 2D11A 4YL8A 1AQCA 2RUKB 2YVCA 1V5MA 2Z0PA 3VOQA 3TW1A 3IVFA 3NWDA 3SUZA 3TVVA 1X1GA 4GNKB 5DH9B 4Y94A 1FHWA 4K2OA 2NMBA 4WJ7A 2ADZA 4C0AA 2UZRA 2RSGA 3P7ZA 4CYEA 5JLJB 2KR9A 2OQBA 1XODA 5HE1A 1N3HA 2D2QA 2LKOA 1J0WA 2D9XA 2MDXA 4EMOA 2EMTA 1WJMA 1BY1A 1PMSA 4MT7A 5CLQB 3F5RA 1PFJA 4HAYB 2KGXB 1SHCA 3AU4A 4QXAB 5KQ4A 2LULA 5J3QA 1GC6A 2ROVA 2DKQA 1OY2A 4GOUA 1ZM0A 2COCA 1ZC3B 4H8SA 3ZVRA 2FJLA 1MK9B 2R2YA 4KHBA 3RCPA 1DYNA 2H7DA 3NWAA 1FOEA 2DTCA 3HQCA 1U5FA 2AL6A 2DFKA 3SV1A 1ISNA 2N23A 1W1DA 3A58A 4GMVA 2D10A 3EO2A 2P0HA 4A6HA 2K8EA 4HB4B 3WYFB 4WVFB 1RRPB 1XCGA 4D0NB 3AU5A 2MKRA 2COFA 2I5CA 3SNHA 1WGQA 4K17A 1NTVA 1ZVRA 5D3YA 1X05A 2Z0QA 4YONA 3HK0A 3KZ1A 4HAVB 2D9VA 2BCJA 2YT1A 2DX5A 5FI1A 2W2XC 5LONB 4KVGB 1P3RA 1AWEA 5C79A 4D6WA 2DX1A 1V61A 1P5TA 3ULCA 3DXCA 3FEHA 2LOZA 2YS1A 1DDWA 1RJ2A 2NBVA 2D9ZA 3AJ4A 3FVCA 4DXAB 2RGNB 2CAYA 3QWMA 2DHKA 3A8PA 3HW2B 4CSQA 3ODXA 2GJYA 3CIKA 1SGHA 1EF1A 2CRFA 2GCJA 3KRXA 2Z59A 2P0FA 3QIJA 2K2JA 5HE0A 2EJ8A 3KSYA 3FM8C 1FHXA 3A8QA 2HE7A 3BJIA 2RRFA 4F7UP 2J0MA 2W2XD 1IRSA 1V5PA 3U12A 1U29A 3DXEA 4TYZA 2GUMA 4OSNA 3GF9A 2R09A 1Z87A 4A6FB 4K81A 4HHVA 3OANA 2PZ1A 2JP2A 5JP4A 3PVUA 1LB1A 2ZPYA 1EGXA 2DYNA 4IOYX 4DIXA 2K49A 2DLWA 4Z2NA 1BWNA 1OMWA 3M1IB 2Q13A 1I7AA 4ZRKA 2CY4A 1OQNA 1FGZA 4DX90 4GPTB 2DN6A 1FB8A 3F0WA 2VSZA 3FSSA 4A5KA 1U2BA 2QKLA 2Z0OA 1V5UA 5L81A 2H7EA 3PP2A 1WI1A 2YT2A 5D3XA 2M38A 4MY6A 2MFQA 4OT1A 1FHOA 2R0DA 4GZUA 4CHMA 2EMSA 2OTXA 4XWXA 5KQ1A 2J0JA 1XKEA 1GG3A 3PVWA 3X23A 1MPHA 4A6FA 4L1RA 1TQZA 5JHGA 3TCAA 3ZDTA 1U5EA 3PSCA 3N7CA 2NZ8B 1WGUA 1K5GB 4B6HA 1FAOA 2J0KA 2UZSA 2GCLA 1W1GA 2RNRB 1EAZA 3PZDA 4TKNA 1MKEA 3WA0A 4HSIA 1DROA 5JHHA 3V5WA 2KIGA 2DA0A 2LOXA 4HAUB 4IFSA 4HAWB 1E5WA 1NTYA 2DKPA 4ZRIA 1UPQA 1ZC4B 4NSWA 4K2PA 1W1HA 5C5BA 4D0OA 2KIEA 2Z13A 5CLLB 4P7IA 1MIZB 2ROZB 4HAZB 4QJ5B 4HATB 5DIFB 1X1FA 1V89A 4MK0A 5DHAB 4CHJA 4NY0A 1Q67A 4ZRJA 1Y19B 1V88A 4GMXB 2HTHB 3ODOA 3DCXA 1XR0B 5C6RA 4EJNA 2KUQA 3DXDA 1T77A 1U5GA 2EC1A 4GYVA 3HSAA 4WSFA 2COAA 2DHJA 2XQNM 1XX0A 1MI1A 5KCVA 5J3TA 2LG1A 3OHMB 2VRWB 3NW8A 5D3WA 3VIAA 2G35A 2DYQA 3TO1A 2KUPA 3CXBB 2VKIA 1B55A 1J19A 2D4QA 5IRSA 2YF0A 2CY5A 2YS3A 3U8ZA 3A98B 2I1KA 4HB2B 1EVHA 3BINA 1NU2A 2KR0A 4HAXB 1NI2A 2RLOA 3PG7A 3NWFA 5FI0A 1WG7A 1MAIA 1KZ7A 2Y8GA 1UNPA 2MWNB 3GYOA 4PQ0A 3MPXA 1X86A 5EFXA 4PNKA 5C5BB 3KY9A 2E2XA 2CODA 5I2SA 1DBHA 2ELBA 4DBBA 1H10A 3B77A 4A6KA 2L1CA 3ODWA 2Y8FA 2N0YA 4IAPA 3KRWA 1KI1B 3ULBA 1LW3A 1U5DA 2ELAA 1M7EA 1K5DB 5HE3A 2ZKMX 5DHFB 1QQGA 1UNQA 2FJUB 2V76A 2Z14A 4KHOA 2IYBA 2P8VA 2D9YA 5M4YB 1Y5OA 1I2HA 4BBKA 5LG4B 3T06A 3D8EA 2DHIA 2I1JA 1H4RA 2Z4DA 3PEGA 3NSUA 3P6AA 2K00A 2L2IA 2YSZA 4GXBA 1UEFA 1TXDA 4F7HA 3LJUX 3ML4A 1GC7A 2UVMA 4EKUA 2GS0A 1WVHA 2YRYA 2YT0A 5I2MA 5J3YA 2AEHA 2D9WA 3SYXA 1DDVA 3HIEA 1BTKA 5LOPB 2J59M 4DX8A 4HB3B 4KHAA 1ZSQA 2QKMA 5C16A 1BTNA 1FGYA 1UPRA 3D8FA 1QC6A 2W2WA 5D3VA 1BAKA 3PVLA 4HDOA 2YS5A 1MK7B 3TFMA 1MIXA 1F5XA 1TJ6A 1PLSA 2I5FA 4HB0B 1ZYIA 5GOWB 2IFSA 4GN1A 2P0DA 5HE2A 1M7RA 1P6SA 3UZTA 3JV3A 1XD4A 1U27A 4HDQA 3D8DA 1DDMA 4QJ4B 1X11A 2X18A 5DI9B 4KAXB 1UNRA 4L6EA 3QBVB 3O96A 1WJ1A 3G9WA 3U7DA 3GYPA 2RVBB 1KZGA 3SO6A 2LYDA 4Z2MB 2M14A 2K2UA 2KCJA 5D27A 4F7GA 2Y7BA 4KHBB 3MDBC
chains in the Genus database with same CATH topology
2D11A 4YL8A 1AQCA 2RUKB 2YVCA 1V5MA 2Z0PA 3VOQA 3TW1A 3IVFA 3SUZA 3TVVA 1X1GA 5DH9B 4Y94A 1FHWA 4K2OA 2NMBA 4WJ7A 2ADZA 4C0AA 2UZRA 2RSGA 3P7ZA 4CYEA 5JLJB 2KR9A 2OQBA 1XODA 5HE1A 1N3HA 2D2QA 2LKOA 1J0WA 2D9XA 2MDXA 4EMOA 2EMTA 1WJMA 1BY1A 1PMSA 4MT7A 5CLQB 3F5RA 1PFJA 4HAYB 2KGXB 1SHCA 3AU4A 5KQ4A 2LULA 5J3QA 1GC6A 2ROVA 2DKQA 1OY2A 4GOUA 1ZM0A 2COCA 1ZC3B 4H8SA 3ZVRA 2FJLA 1MK9B 3RCPA 1DYNA 2H7DA 1FOEA 2DTCA 3HQCA 1U5FA 2AL6A 2DFKA 3SV1A 1ISNA 2N23A 1W1DA 4GMVA 2D10A 3EO2A 2P0HA 4A6HA 4HB4B 3WYFB 4WVFB 1RRPB 1XCGA 4D0NB 3AU5A 2MKRA 2COFA 2I5CA 3SNHA 1WGQA 4K17A 1NTVA 1ZVRA 5D3YA 1X05A 2Z0QA 4YONA 3HK0A 3KZ1A 4HAVB 2D9VA 2BCJA 2YT1A 2DX5A 5FI1A 2W2XC 5LONB 4KVGB 1P3RA 1AWEA 5C79A 2DX1A 1V61A 1P5TA 3ULCA 3DXCA 3FEHA 2LOZA 2YS1A 1DDWA 1RJ2A 2D9ZA 3AJ4A 4DXAB 2RGNB 2CAYA 3QWMA 2DHKA 3A8PA 3HW2B 3ODXA 2GJYA 3CIKA 1SGHA 1EF1A 2CRFA 2GCJA 3KRXA 2P0FA 3QIJA 2K2JA 5HE0A 2EJ8A 3KSYA 3FM8C 1FHXA 3A8QA 2HE7A 3BJIA 4F7UP 2J0MA 2W2XD 1IRSA 1V5PA 1U29A 3DXEA 4TYZA 3GF9A 2R09A 1Z87A 4A6FB 4K81A 4HHVA 3OANA 2PZ1A 2JP2A 5JP4A 3PVUA 1LB1A 2ZPYA 1EGXA 2DYNA 4IOYX 2DLWA 4Z2NA 1BWNA 1OMWA 3M1IB 2Q13A 1I7AA 4ZRKA 2CY4A 1OQNA 1FGZA 4DX90 4GPTB 2DN6A 1FB8A 3F0WA 2VSZA 3FSSA 4A5KA 1U2BA 2QKLA 2Z0OA 1V5UA 5L81A 2H7EA 3PP2A 1WI1A 5D3XA 2M38A 4MY6A 2MFQA 1FHOA 2R0DA 4GZUA 4CHMA 2EMSA 2OTXA 4XWXA 5KQ1A 2J0JA 1XKEA 1GG3A 3PVWA 3X23A 1MPHA 4A6FA 1TQZA 5JHGA 3TCAA 3ZDTA 1U5EA 3PSCA 3N7CA 2NZ8B 1WGUA 1K5GB 4B6HA 1FAOA 2J0KA 2UZSA 2GCLA 1W1GA 2RNRB 1EAZA 3PZDA 4TKNA 1MKEA 3WA0A 1DROA 5JHHA 3V5WA 2DA0A 2LOXA 4HAUB 4IFSA 4HAWB 1E5WA 1NTYA 2DKPA 4ZRIA 1UPQA 1ZC4B 4NSWA 4K2PA 1W1HA 5C5BA 4D0OA 5CLLB 4P7IA 1MIZB 2ROZB 4HAZB 4HATB 5DIFB 1X1FA 1V89A 4MK0A 5DHAB 4CHJA 4NY0A 1Q67A 4ZRJA 1Y19B 1V88A 4GMXB 2HTHB 3ODOA 1XR0B 5C6RA 4EJNA 3DXDA 1U5GA 2EC1A 4GYVA 4WSFA 2COAA 2DHJA 2XQNM 1XX0A 5KCVA 5J3TA 2LG1A 2VRWB 5D3WA 3VIAA 2G35A 2DYQA 3TO1A 2KUPA 3CXBB 2VKIA 1B55A 1J19A 2D4QA 2YF0A 2CY5A 2YS3A 3U8ZA 3A98B 2I1KA 4HB2B 1EVHA 3BINA 1NU2A 4HAXB 1NI2A 2RLOA 3PG7A 5FI0A 1WG7A 1MAIA 1KZ7A 2Y8GA 1UNPA 2MWNB 3GYOA 4PQ0A 3MPXA 1X86A 5EFXA 4PNKA 5C5BB 3KY9A 2E2XA 2CODA 1DBHA 2ELBA 4DBBA 1H10A 4A6KA 2L1CA 3ODWA 2Y8FA 2N0YA 4IAPA 3KRWA 1KI1B 3ULBA 1LW3A 1U5DA 2ELAA 1M7EA 1K5DB 5HE3A 5DHFB 1QQGA 1UNQA 4KHOA 2V76A 2IYBA 2P8VA 2D9YA 1Y5OA 1I2HA 4BBKA 3T06A 3D8EA 2DHIA 2I1JA 1H4RA 3PEGA 3NSUA 3P6AA 2K00A 2L2IA 2YSZA 4GXBA 1UEFA 1TXDA 4F7HA 3LJUX 3ML4A 1GC7A 2UVMA 4EKUA 2GS0A 1WVHA 2YRYA 2YT0A 5J3YA 2AEHA 2D9WA 3SYXA 1DDVA 1BTKA 5LOPB 2J59M 4DX8A 4HB3B 4KHAA 1ZSQA 2QKMA 5C16A 1BTNA 1FGYA 1UPRA 3D8FA 1QC6A 2W2WA 5D3VA 1BAKA 3PVLA 4HDOA 2YS5A 1MK7B 3TFMA 1MIXA 1F5XA 1TJ6A 1PLSA 2I5FA 4HB0B 5GOWB 2IFSA 4GN1A 2P0DA 5HE2A 1M7RA 1P6SA 3UZTA 3JV3A 1XD4A 1U27A 4HDQA 3D8DA 1DDMA 1X11A 2X18A 5DI9B 4KAXB 1UNRA 4L6EA 3QBVB 3O96A 1WJ1A 3G9WA 3U7DA 3GYPA 2RVBB 1KZGA 3SO6A 2LYDA 4Z2MB 2M14A 2K2UA 2KCJA 5D27A 4F7GA 2Y7BA 4KHBB 3MDBC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D11 A;  4YL8 A;  1AQC A;  2RUK B;  2YVC A;  1V5M A;  2Z0P A;  3VOQ A;  3TW1 A;  3IVF A;  3SUZ A;  3TVV A;  1X1G A;  5DH9 B;  4Y94 A;  1FHW A;  4K2O A;  2NMB A;  4WJ7 A;  2ADZ A;  4C0A A;  2UZR A;  2RSG A;  3P7Z A;  4CYE A;  5JLJ B;  2KR9 A;  2OQB A;  1XOD A;  5HE1 A;  1N3H A;  2D2Q A;  2LKO A;  1J0W A;  2D9X A;  2MDX A;  4EMO A;  2EMT A;  1WJM A;  1BY1 A;  1PMS A;  4MT7 A;  5CLQ B;  3F5R A;  1PFJ A;  4HAY B;  2KGX B;  1SHC A;  3AU4 A;  5KQ4 A;  2LUL A;  5J3Q A;  1GC6 A;  2ROV A;  2DKQ A;  1OY2 A;  4GOU A;  1ZM0 A;  2COC A;  1ZC3 B;  4H8S A;  3ZVR A;  2FJL A;  1MK9 B;  3RCP A;  1DYN A;  2H7D A;  1FOE A;  2DTC A;  3HQC A;  1U5F A;  2AL6 A;  2DFK A;  3SV1 A;  1ISN A;  2N23 A;  1W1D A;  4GMV A;  2D10 A;  3EO2 A;  2P0H A;  4A6H A;  4HB4 B;  3WYF B;  4WVF B;  1RRP B;  1XCG A;  4D0N B;  3AU5 A;  2MKR A;  2COF A;  2I5C A;  3SNH A;  1WGQ A;  4K17 A;  1NTV A;  1ZVR A;  5D3Y A;  1X05 A;  2Z0Q A;  4YON A;  3HK0 A;  3KZ1 A;  4HAV B;  2D9V A;  2BCJ A;  2YT1 A;  2DX5 A;  5FI1 A;  2W2X C;  5LON B;  4KVG B;  1P3R A;  1AWE A;  5C79 A;  2DX1 A;  1V61 A;  1P5T A;  3ULC A;  3DXC A;  3FEH A;  2LOZ A;  2YS1 A;  1DDW A;  1RJ2 A;  2D9Z A;  3AJ4 A;  4DXA B;  2RGN B;  2CAY A;  3QWM A;  2DHK A;  3A8P A;  3HW2 B;  3ODX A;  2GJY A;  3CIK A;  1SGH A;  1EF1 A;  2CRF A;  2GCJ A;  3KRX A;  2P0F A;  3QIJ A;  2K2J A;  5HE0 A;  2EJ8 A;  3KSY A;  3FM8 C;  1FHX A;  3A8Q A;  2HE7 A;  3BJI A;  4F7U P;  2J0M A;  2W2X D;  1IRS A;  1V5P A;  1U29 A;  3DXE A;  4TYZ A;  3GF9 A;  2R09 A;  1Z87 A;  4A6F B;  4K81 A;  4HHV A;  3OAN A;  2PZ1 A;  2JP2 A;  5JP4 A;  3PVU A;  1LB1 A;  2ZPY A;  1EGX A;  2DYN A;  4IOY X;  2DLW A;  4Z2N A;  1BWN A;  1OMW A;  3M1I B;  2Q13 A;  1I7A A;  4ZRK A;  2CY4 A;  1OQN A;  1FGZ A;  4DX9 0;  4GPT B;  2DN6 A;  1FB8 A;  3F0W A;  2VSZ A;  3FSS A;  4A5K A;  1U2B A;  2QKL A;  2Z0O A;  1V5U A;  5L81 A;  2H7E A;  3PP2 A;  1WI1 A;  5D3X A;  2M38 A;  4MY6 A;  2MFQ A;  1FHO A;  2R0D A;  4GZU A;  4CHM A;  2EMS A;  2OTX A;  4XWX A;  5KQ1 A;  2J0J A;  1XKE A;  1GG3 A;  3PVW A;  3X23 A;  1MPH A;  4A6F A;  1TQZ A;  5JHG A;  3TCA A;  3ZDT A;  1U5E A;  3PSC A;  3N7C A;  2NZ8 B;  1WGU A;  1K5G B;  4B6H A;  1FAO A;  2J0K A;  2UZS A;  2GCL A;  1W1G A;  2RNR B;  1EAZ A;  3PZD A;  4TKN A;  1MKE A;  3WA0 A;  1DRO A;  5JHH A;  3V5W A;  2DA0 A;  2LOX A;  4HAU B;  4IFS A;  4HAW B;  1E5W A;  1NTY A;  2DKP A;  4ZRI A;  1UPQ A;  1ZC4 B;  4NSW A;  4K2P A;  1W1H A;  5C5B A;  4D0O A;  5CLL B;  4P7I A;  1MIZ B;  2ROZ B;  4HAZ B;  4HAT B;  5DIF B;  1X1F A;  1V89 A;  4MK0 A;  5DHA B;  4CHJ A;  4NY0 A;  1Q67 A;  4ZRJ A;  1Y19 B;  1V88 A;  4GMX B;  2HTH B;  3ODO A;  1XR0 B;  5C6R A;  4EJN A;  3DXD A;  1U5G A;  2EC1 A;  4GYV A;  4WSF A;  2COA A;  2DHJ A;  2XQN M;  1XX0 A;  5KCV A;  5J3T A;  2LG1 A;  2VRW B;  5D3W A;  3VIA A;  2G35 A;  2DYQ A;  3TO1 A;  2KUP A;  3CXB B;  2VKI A;  1B55 A;  1J19 A;  2D4Q A;  2YF0 A;  2CY5 A;  2YS3 A;  3U8Z A;  3A98 B;  2I1K A;  4HB2 B;  1EVH A;  3BIN A;  1NU2 A;  4HAX B;  1NI2 A;  2RLO A;  3PG7 A;  5FI0 A;  1WG7 A;  1MAI A;  1KZ7 A;  2Y8G A;  1UNP A;  2MWN B;  3GYO A;  4PQ0 A;  3MPX A;  1X86 A;  5EFX A;  4PNK A;  5C5B B;  3KY9 A;  2E2X A;  2COD A;  1DBH A;  2ELB A;  4DBB A;  1H10 A;  4A6K A;  2L1C A;  3ODW A;  2Y8F A;  2N0Y A;  4IAP A;  3KRW A;  1KI1 B;  3ULB A;  1LW3 A;  1U5D A;  2ELA A;  1M7E A;  1K5D B;  5HE3 A;  5DHF B;  1QQG A;  1UNQ A;  4KHO A;  2V76 A;  2IYB A;  2P8V A;  2D9Y A;  1Y5O A;  1I2H A;  4BBK A;  3T06 A;  3D8E A;  2DHI A;  2I1J A;  1H4R A;  3PEG A;  3NSU A;  3P6A A;  2K00 A;  2L2I A;  2YSZ A;  4GXB A;  1UEF A;  1TXD A;  4F7H A;  3LJU X;  3ML4 A;  1GC7 A;  2UVM A;  4EKU A;  2GS0 A;  1WVH A;  2YRY A;  2YT0 A;  5J3Y A;  2AEH A;  2D9W A;  3SYX A;  1DDV A;  1BTK A;  5LOP B;  2J59 M;  4DX8 A;  4HB3 B;  4KHA A;  1ZSQ A;  2QKM A;  5C16 A;  1BTN A;  1FGY A;  1UPR A;  3D8F A;  1QC6 A;  2W2W A;  5D3V A;  1BAK A;  3PVL A;  4HDO A;  2YS5 A;  1MK7 B;  3TFM A;  1MIX A;  1F5X A;  1TJ6 A;  1PLS A;  2I5F A;  4HB0 B;  5GOW B;  2IFS A;  4GN1 A;  2P0D A;  5HE2 A;  1M7R A;  1P6S A;  3UZT A;  3JV3 A;  1XD4 A;  1U27 A;  4HDQ A;  3D8D A;  1DDM A;  1X11 A;  2X18 A;  5DI9 B;  4KAX B;  1UNR A;  4L6E A;  3QBV B;  3O96 A;  1WJ1 A;  3G9W A;  3U7D A;  3GYP A;  2RVB B;  1KZG A;  3SO6 A;  2LYD A;  4Z2M B;  2M14 A;  2K2U A;  2KCJ A;  5D27 A;  4F7G A;  2Y7B A;  4KHB B;  3MDB C; 
#chains in the Genus database with same CATH topology
 4QJ3 B;  2D11 A;  4YL8 A;  1AQC A;  2RUK B;  2YVC A;  1V5M A;  2Z0P A;  3VOQ A;  3TW1 A;  3IVF A;  3NWD A;  3SUZ A;  3TVV A;  1X1G A;  4GNK B;  5DH9 B;  4Y94 A;  1FHW A;  4K2O A;  2NMB A;  4WJ7 A;  2ADZ A;  4C0A A;  2UZR A;  2RSG A;  3P7Z A;  4CYE A;  5JLJ B;  2KR9 A;  2OQB A;  1XOD A;  5HE1 A;  1N3H A;  2D2Q A;  2LKO A;  1J0W A;  2D9X A;  2MDX A;  4EMO A;  2EMT A;  1WJM A;  1BY1 A;  1PMS A;  4MT7 A;  5CLQ B;  3F5R A;  1PFJ A;  4HAY B;  2KGX B;  1SHC A;  3AU4 A;  4QXA B;  5KQ4 A;  2LUL A;  5J3Q A;  1GC6 A;  2ROV A;  2DKQ A;  1OY2 A;  4GOU A;  1ZM0 A;  2COC A;  1ZC3 B;  4H8S A;  3ZVR A;  2FJL A;  1MK9 B;  2R2Y A;  4KHB A;  3RCP A;  1DYN A;  2H7D A;  3NWA A;  1FOE A;  2DTC A;  3HQC A;  1U5F A;  2AL6 A;  2DFK A;  3SV1 A;  1ISN A;  2N23 A;  1W1D A;  3A58 A;  4GMV A;  2D10 A;  3EO2 A;  2P0H A;  4A6H A;  2K8E A;  4HB4 B;  3WYF B;  4WVF B;  1RRP B;  1XCG A;  4D0N B;  3AU5 A;  2MKR A;  2COF A;  2I5C A;  3SNH A;  1WGQ A;  4K17 A;  1NTV A;  1ZVR A;  5D3Y A;  1X05 A;  2Z0Q A;  4YON A;  3HK0 A;  3KZ1 A;  4HAV B;  2D9V A;  2BCJ A;  2YT1 A;  2DX5 A;  5FI1 A;  2W2X C;  5LON B;  4KVG B;  1P3R A;  1AWE A;  5C79 A;  4D6W A;  2DX1 A;  1V61 A;  1P5T A;  3ULC A;  3DXC A;  3FEH A;  2LOZ A;  2YS1 A;  1DDW A;  1RJ2 A;  2NBV A;  2D9Z A;  3AJ4 A;  3FVC A;  4DXA B;  2RGN B;  2CAY A;  3QWM A;  2DHK A;  3A8P A;  3HW2 B;  4CSQ A;  3ODX A;  2GJY A;  3CIK A;  1SGH A;  1EF1 A;  2CRF A;  2GCJ A;  3KRX A;  2Z59 A;  2P0F A;  3QIJ A;  2K2J A;  5HE0 A;  2EJ8 A;  3KSY A;  3FM8 C;  1FHX A;  3A8Q A;  2HE7 A;  3BJI A;  2RRF A;  4F7U P;  2J0M A;  2W2X D;  1IRS A;  1V5P A;  3U12 A;  1U29 A;  3DXE A;  4TYZ A;  2GUM A;  4OSN A;  3GF9 A;  2R09 A;  1Z87 A;  4A6F B;  4K81 A;  4HHV A;  3OAN A;  2PZ1 A;  2JP2 A;  5JP4 A;  3PVU A;  1LB1 A;  2ZPY A;  1EGX A;  2DYN A;  4IOY X;  4DIX A;  2K49 A;  2DLW A;  4Z2N A;  1BWN A;  1OMW A;  3M1I B;  2Q13 A;  1I7A A;  4ZRK A;  2CY4 A;  1OQN A;  1FGZ A;  4DX9 0;  4GPT B;  2DN6 A;  1FB8 A;  3F0W A;  2VSZ A;  3FSS A;  4A5K A;  1U2B A;  2QKL A;  2Z0O A;  1V5U A;  5L81 A;  2H7E A;  3PP2 A;  1WI1 A;  2YT2 A;  5D3X A;  2M38 A;  4MY6 A;  2MFQ A;  4OT1 A;  1FHO A;  2R0D A;  4GZU A;  4CHM A;  2EMS A;  2OTX A;  4XWX A;  5KQ1 A;  2J0J A;  1XKE A;  1GG3 A;  3PVW A;  3X23 A;  1MPH A;  4A6F A;  4L1R A;  1TQZ A;  5JHG A;  3TCA A;  3ZDT A;  1U5E A;  3PSC A;  3N7C A;  2NZ8 B;  1WGU A;  1K5G B;  4B6H A;  1FAO A;  2J0K A;  2UZS A;  2GCL A;  1W1G A;  2RNR B;  1EAZ A;  3PZD A;  4TKN A;  1MKE A;  3WA0 A;  4HSI A;  1DRO A;  5JHH A;  3V5W A;  2KIG A;  2DA0 A;  2LOX A;  4HAU B;  4IFS A;  4HAW B;  1E5W A;  1NTY A;  2DKP A;  4ZRI A;  1UPQ A;  1ZC4 B;  4NSW A;  4K2P A;  1W1H A;  5C5B A;  4D0O A;  2KIE A;  2Z13 A;  5CLL B;  4P7I A;  1MIZ B;  2ROZ B;  4HAZ B;  4QJ5 B;  4HAT B;  5DIF B;  1X1F A;  1V89 A;  4MK0 A;  5DHA B;  4CHJ A;  4NY0 A;  1Q67 A;  4ZRJ A;  1Y19 B;  1V88 A;  4GMX B;  2HTH B;  3ODO A;  3DCX A;  1XR0 B;  5C6R A;  4EJN A;  2KUQ A;  3DXD A;  1T77 A;  1U5G A;  2EC1 A;  4GYV A;  3HSA A;  4WSF A;  2COA A;  2DHJ A;  2XQN M;  1XX0 A;  1MI1 A;  5KCV A;  5J3T A;  2LG1 A;  3OHM B;  2VRW B;  3NW8 A;  5D3W A;  3VIA A;  2G35 A;  2DYQ A;  3TO1 A;  2KUP A;  3CXB B;  2VKI A;  1B55 A;  1J19 A;  2D4Q A;  5IRS A;  2YF0 A;  2CY5 A;  2YS3 A;  3U8Z A;  3A98 B;  2I1K A;  4HB2 B;  1EVH A;  3BIN A;  1NU2 A;  2KR0 A;  4HAX B;  1NI2 A;  2RLO A;  3PG7 A;  3NWF A;  5FI0 A;  1WG7 A;  1MAI A;  1KZ7 A;  2Y8G A;  1UNP A;  2MWN B;  3GYO A;  4PQ0 A;  3MPX A;  1X86 A;  5EFX A;  4PNK A;  5C5B B;  3KY9 A;  2E2X A;  2COD A;  5I2S A;  1DBH A;  2ELB A;  4DBB A;  1H10 A;  3B77 A;  4A6K A;  2L1C A;  3ODW A;  2Y8F A;  2N0Y A;  4IAP A;  3KRW A;  1KI1 B;  3ULB A;  1LW3 A;  1U5D A;  2ELA A;  1M7E A;  1K5D B;  5HE3 A;  2ZKM X;  5DHF B;  1QQG A;  1UNQ A;  2FJU B;  2V76 A;  2Z14 A;  4KHO A;  2IYB A;  2P8V A;  2D9Y A;  5M4Y B;  1Y5O A;  1I2H A;  4BBK A;  5LG4 B;  3T06 A;  3D8E A;  2DHI A;  2I1J A;  1H4R A;  2Z4D A;  3PEG A;  3NSU A;  3P6A A;  2K00 A;  2L2I A;  2YSZ A;  4GXB A;  1UEF A;  1TXD A;  4F7H A;  3LJU X;  3ML4 A;  1GC7 A;  2UVM A;  4EKU A;  2GS0 A;  1WVH A;  2YRY A;  2YT0 A;  5I2M A;  5J3Y A;  2AEH A;  2D9W A;  3SYX A;  1DDV A;  3HIE A;  1BTK A;  5LOP B;  2J59 M;  4DX8 A;  4HB3 B;  4KHA A;  1ZSQ A;  2QKM A;  5C16 A;  1BTN A;  1FGY A;  1UPR A;  3D8F A;  1QC6 A;  2W2W A;  5D3V A;  1BAK A;  3PVL A;  4HDO A;  2YS5 A;  1MK7 B;  3TFM A;  1MIX A;  1F5X A;  1TJ6 A;  1PLS A;  2I5F A;  4HB0 B;  1ZYI A;  5GOW B;  2IFS A;  4GN1 A;  2P0D A;  5HE2 A;  1M7R A;  1P6S A;  3UZT A;  3JV3 A;  1XD4 A;  1U27 A;  4HDQ A;  3D8D A;  1DDM A;  4QJ4 B;  1X11 A;  2X18 A;  5DI9 B;  4KAX B;  1UNR A;  4L6E A;  3QBV B;  3O96 A;  1WJ1 A;  3G9W A;  3U7D A;  3GYP A;  2RVB B;  1KZG A;  3SO6 A;  2LYD A;  4Z2M B;  2M14 A;  2K2U A;  2KCJ A;  5D27 A;  4F7G A;  2Y7B A;  4KHB B;  3MDB C; 
#chains in the Genus database with same CATH homology
 2D11 A;  4YL8 A;  1AQC A;  2RUK B;  2YVC A;  1V5M A;  2Z0P A;  3VOQ A;  3TW1 A;  3IVF A;  3SUZ A;  3TVV A;  1X1G A;  5DH9 B;  4Y94 A;  1FHW A;  4K2O A;  2NMB A;  4WJ7 A;  2ADZ A;  4C0A A;  2UZR A;  2RSG A;  3P7Z A;  4CYE A;  5JLJ B;  2KR9 A;  2OQB A;  1XOD A;  5HE1 A;  1N3H A;  2D2Q A;  2LKO A;  1J0W A;  2D9X A;  2MDX A;  4EMO A;  2EMT A;  1WJM A;  1BY1 A;  1PMS A;  4MT7 A;  5CLQ B;  3F5R A;  1PFJ A;  4HAY B;  2KGX B;  1SHC A;  3AU4 A;  5KQ4 A;  2LUL A;  5J3Q A;  1GC6 A;  2ROV A;  2DKQ A;  1OY2 A;  4GOU A;  1ZM0 A;  2COC A;  1ZC3 B;  4H8S A;  3ZVR A;  2FJL A;  1MK9 B;  3RCP A;  1DYN A;  2H7D A;  1FOE A;  2DTC A;  3HQC A;  1U5F A;  2AL6 A;  2DFK A;  3SV1 A;  1ISN A;  2N23 A;  1W1D A;  4GMV A;  2D10 A;  3EO2 A;  2P0H A;  4A6H A;  4HB4 B;  3WYF B;  4WVF B;  1RRP B;  1XCG A;  4D0N B;  3AU5 A;  2MKR A;  2COF A;  2I5C A;  3SNH A;  1WGQ A;  4K17 A;  1NTV A;  1ZVR A;  5D3Y A;  1X05 A;  2Z0Q A;  4YON A;  3HK0 A;  3KZ1 A;  4HAV B;  2D9V A;  2BCJ A;  2YT1 A;  2DX5 A;  5FI1 A;  2W2X C;  5LON B;  4KVG B;  1P3R A;  1AWE A;  5C79 A;  2DX1 A;  1V61 A;  1P5T A;  3ULC A;  3DXC A;  3FEH A;  2LOZ A;  2YS1 A;  1DDW A;  1RJ2 A;  2D9Z A;  3AJ4 A;  4DXA B;  2RGN B;  2CAY A;  3QWM A;  2DHK A;  3A8P A;  3HW2 B;  3ODX A;  2GJY A;  3CIK A;  1SGH A;  1EF1 A;  2CRF A;  2GCJ A;  3KRX A;  2P0F A;  3QIJ A;  2K2J A;  5HE0 A;  2EJ8 A;  3KSY A;  3FM8 C;  1FHX A;  3A8Q A;  2HE7 A;  3BJI A;  4F7U P;  2J0M A;  2W2X D;  1IRS A;  1V5P A;  1U29 A;  3DXE A;  4TYZ A;  3GF9 A;  2R09 A;  1Z87 A;  4A6F B;  4K81 A;  4HHV A;  3OAN A;  2PZ1 A;  2JP2 A;  5JP4 A;  3PVU A;  1LB1 A;  2ZPY A;  1EGX A;  2DYN A;  4IOY X;  2DLW A;  4Z2N A;  1BWN A;  1OMW A;  3M1I B;  2Q13 A;  1I7A A;  4ZRK A;  2CY4 A;  1OQN A;  1FGZ A;  4DX9 0;  4GPT B;  2DN6 A;  1FB8 A;  3F0W A;  2VSZ A;  3FSS A;  4A5K A;  1U2B A;  2QKL A;  2Z0O A;  1V5U A;  5L81 A;  2H7E A;  3PP2 A;  1WI1 A;  5D3X A;  2M38 A;  4MY6 A;  2MFQ A;  1FHO A;  2R0D A;  4GZU A;  4CHM A;  2EMS A;  2OTX A;  4XWX A;  5KQ1 A;  2J0J A;  1XKE A;  1GG3 A;  3PVW A;  3X23 A;  1MPH A;  4A6F A;  1TQZ A;  5JHG A;  3TCA A;  3ZDT A;  1U5E A;  3PSC A;  3N7C A;  2NZ8 B;  1WGU A;  1K5G B;  4B6H A;  1FAO A;  2J0K A;  2UZS A;  2GCL A;  1W1G A;  2RNR B;  1EAZ A;  3PZD A;  4TKN A;  1MKE A;  3WA0 A;  1DRO A;  5JHH A;  3V5W A;  2DA0 A;  2LOX A;  4HAU B;  4IFS A;  4HAW B;  1E5W A;  1NTY A;  2DKP A;  4ZRI A;  1UPQ A;  1ZC4 B;  4NSW A;  4K2P A;  1W1H A;  5C5B A;  4D0O A;  5CLL B;  4P7I A;  1MIZ B;  2ROZ B;  4HAZ B;  4HAT B;  5DIF B;  1X1F A;  1V89 A;  4MK0 A;  5DHA B;  4CHJ A;  4NY0 A;  1Q67 A;  4ZRJ A;  1Y19 B;  1V88 A;  4GMX B;  2HTH B;  3ODO A;  1XR0 B;  5C6R A;  4EJN A;  3DXD A;  1U5G A;  2EC1 A;  4GYV A;  4WSF A;  2COA A;  2DHJ A;  2XQN M;  1XX0 A;  5KCV A;  5J3T A;  2LG1 A;  2VRW B;  5D3W A;  3VIA A;  2G35 A;  2DYQ A;  3TO1 A;  2KUP A;  3CXB B;  2VKI A;  1B55 A;  1J19 A;  2D4Q A;  2YF0 A;  2CY5 A;  2YS3 A;  3U8Z A;  3A98 B;  2I1K A;  4HB2 B;  1EVH A;  3BIN A;  1NU2 A;  4HAX B;  1NI2 A;  2RLO A;  3PG7 A;  5FI0 A;  1WG7 A;  1MAI A;  1KZ7 A;  2Y8G A;  1UNP A;  2MWN B;  3GYO A;  4PQ0 A;  3MPX A;  1X86 A;  5EFX A;  4PNK A;  5C5B B;  3KY9 A;  2E2X A;  2COD A;  1DBH A;  2ELB A;  4DBB A;  1H10 A;  4A6K A;  2L1C A;  3ODW A;  2Y8F A;  2N0Y A;  4IAP A;  3KRW A;  1KI1 B;  3ULB A;  1LW3 A;  1U5D A;  2ELA A;  1M7E A;  1K5D B;  5HE3 A;  5DHF B;  1QQG A;  1UNQ A;  4KHO A;  2V76 A;  2IYB A;  2P8V A;  2D9Y A;  1Y5O A;  1I2H A;  4BBK A;  3T06 A;  3D8E A;  2DHI A;  2I1J A;  1H4R A;  3PEG A;  3NSU A;  3P6A A;  2K00 A;  2L2I A;  2YSZ A;  4GXB A;  1UEF A;  1TXD A;  4F7H A;  3LJU X;  3ML4 A;  1GC7 A;  2UVM A;  4EKU A;  2GS0 A;  1WVH A;  2YRY A;  2YT0 A;  5J3Y A;  2AEH A;  2D9W A;  3SYX A;  1DDV A;  1BTK A;  5LOP B;  2J59 M;  4DX8 A;  4HB3 B;  4KHA A;  1ZSQ A;  2QKM A;  5C16 A;  1BTN A;  1FGY A;  1UPR A;  3D8F A;  1QC6 A;  2W2W A;  5D3V A;  1BAK A;  3PVL A;  4HDO A;  2YS5 A;  1MK7 B;  3TFM A;  1MIX A;  1F5X A;  1TJ6 A;  1PLS A;  2I5F A;  4HB0 B;  5GOW B;  2IFS A;  4GN1 A;  2P0D A;  5HE2 A;  1M7R A;  1P6S A;  3UZT A;  3JV3 A;  1XD4 A;  1U27 A;  4HDQ A;  3D8D A;  1DDM A;  1X11 A;  2X18 A;  5DI9 B;  4KAX B;  1UNR A;  4L6E A;  3QBV B;  3O96 A;  1WJ1 A;  3G9W A;  3U7D A;  3GYP A;  2RVB B;  1KZG A;  3SO6 A;  2LYD A;  4Z2M B;  2M14 A;  2K2U A;  2KCJ A;  5D27 A;  4F7G A;  2Y7B A;  4KHB B;  3MDB C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...