4MT7A

Crystal structure of collybistin i
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
337
structure length
337
Chain Sequence
QNRDQMRANVINEIMSTERHYIKHLKDICEGYLKQCRKRRDMFSDEQLKVIFGNIEDIYRFQMGFVRDLEKQYNNDDPHLSEIGPCFLEHQDGFWIYSEYCNNHLDACMELSKLMKDSRYQHFFEACRLLQQMIDIAIDGFLLTPVQKICKYPLQLAELLKYTAQDHSDYRYVAAALAVMRNVTQQINERKRRLENIDKIAQWQASVLDWEGDDILDRSSELIYTGEMAWIYQPYGRNQQRVFFLFDHQMVLCKKDLIRRDILYYKGRIDMDKYEVIDIEDGRDDDFNVSMKNAFKLHNKETEEVHLFFAKKLEEKIRWLRAFREERKMVQEDEKIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A conformational switch in collybistin determines the differentiation of inhibitory postsynapses.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Protein binding
molecule keywords Rho guanine nucleotide exchange factor 9
total genus 115
structure length 337
sequence length 337
ec nomenclature
pdb deposition date 2013-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
A PF00169 PH PH domain
A PF00621 RhoGEF RhoGEF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.900.10 Mainly Alpha Up-down Bundle Dbl Homology Domain; Chain A Dbl homology (DH) domain 4mt7A01
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4mt7A02
2Y8GA 5KQ4A 5C79A 4WVFB 2ROVA 1LB1A 2DX1A 4GYVA 1M7EA 1H10A 3FM8C 2Z0QA 2H7EA 2P0DA 2J0JA 3GF9A 4KVGB 2D9YA 2DYQA 2LYDA 3NSUA 2J0MA 2QKMA 4EMOA 1AWEA 1V88A 2G35A 1PFJA 1XD4A 2ELAA 3D8EA 3DXCA 4HHVA 5LONB 1B55A 2FJLA 2QKLA 1UPQA 3GYOA 2V76A 1J19A 4Z2NA 1E5WA 4L6EA 2I1KA 2RLOA 2DKQA 1W1DA 2AEHA 3DXDA 5LOPB 2M38A 2DX5A 2NMBA 1UNQA 2PZ1A 2DHJA 3D8DA 2OQBA 1LW3A 1U5DA 3KZ1A 1U2BA 1U5GA 1XX0A 1OY2A 2R09A 3ML4A 1NTVA 4KHAA 2LULA 2VKIA 1BWNA 2Y8FA 2GJYA 2D9XA 3QIJA 1FB8A 2KCJA 4HB0B 2D9VA 4WSFA 5JLJB 2DA0A 3F5RA 3KRWA 4GXBA 1N3HA 4C0AA 4HAWB 1J0WA 1Q67A 2L2IA 1XKEA 4KAXB 2UZRA 2YS1A 1P5TA 3F0WA 1X1FA 2CRFA 2YSZA 1MAIA 5D3XA 3VOQA 2D9WA 2Y7BA 1TXDA 3PVUA 2Q13A 2N0YA 5D3YA 4NSWA 2COCA 4DX90 1XR0B 4KHBB 1MPHA 4HAXB 1KI1B 4B6HA 2DYNA 2P0HA 3PZDA 5KQ1A 1FHWA 2YVCA 2DN6A 2E2XA 5JHHA 2YT0A 2BCJA 1DROA 4F7GA 1EVHA 2D9ZA 4Y94A 1WG7A 3DXEA 5HE2A 4GZUA 4D0NB 2COFA 3SV1A 5L81A 5J3QA 2RSGA 4CHJA 4NY0A 3AU5A 2YS5A 3ODWA 1U27A 5D3VA 1UNPA 1WJMA 4HAYB 4K81A 3SYXA 4ZRIA 5HE1A 3TO1A 4HB4B 2CY4A 2XQNM 4IAPA 2MDXA 2X18A 1DDWA 5HE3A 2EJ8A 3TCAA 1DDMA 5C6RA 1X05A 3PP2A 2K2UA 2LOXA 2J59M 4DXAB 1Y19B 3M1IB 1KZ7A 3IVFA 4IOYX 1I2HA 2YS3A 3TFMA 3A98B 2K2JA 5D3WA 1ZC4B 2ZPYA 2I1JA 2LOZA 1DDVA 5JP4A 3AU4A 3KSYA 2JP2A 2LKOA 3X23A 4A6FA 2GS0A 4TYZA 1WVHA 2P8VA 3PVLA 3BJIA 1EGXA 3HW2B 1TQZA 4ZRKA 4GMXB 2CY5A 1ZC3B 3ODXA 4ZRJA 3T06A 1RRPB 3JV3A 5HE0A 2EMTA 1P3RA 1H4RA 3PG7A 2W2WA 2W2XC 4MY6A 5DIFB 4CYEA 5DHFB 2HTHB 4K17A 4HB2B 5DH9B 4MT7A 1BTKA 3WYFB 2K00A 2VSZA 3EO2A 1GC6A 1DBHA 1MIXA 3UZTA 3P7ZA 2D2QA 3A8PA 1Z87A 4CHMA 5FI0A 1FHXA 3U7DA 4HB3B 5CLQB 1RJ2A 2W2XD 4D0OA 1U5FA 1MK9B 1W1GA 4PNKA 4TKNA 5JHGA 2RGNB 2UZSA 3TVVA 1SGHA 4GN1A 1FGYA 4EKUA 3HK0A 4HATB 1IRSA 2P0FA 2DHIA 3LJUX 3ZDTA 4WJ7A 1X11A 1UEFA 4HAZB 4HDQA 3P6AA 2KR9A 1U29A 4A6HA 2CODA 4PQ0A 5C5BB 1EF1A 3CXBB 2VRWB 5DHAB 1U5EA 5DI9B 2KGXB 3SNHA 2MFQA 3PSCA 2I5CA 4GPTB 1NTYA 3O96A 2IFSA 4Z2MB 3ODOA 1QQGA 3U8ZA 2ROZB 4XWXA 4A6KA 1NI2A 5C5BA 1OMWA 1WI1A 2EC1A 2YF0A 1XODA 4YONA 1K5GB 2GCLA 1TJ6A 2KUPA 2DHKA 3KRXA 2RNRB 5CLLB 4H8SA 1BTNA 2UVMA 4P7IA 4YL8A 4DX8A 3OANA 4IFSA 4HDOA 5GOWB 1DYNA 1Y5OA 2Z0OA 3CIKA 2DLWA 1W1HA 4K2OA 2MWNB 1WGUA 1P6SA 1BY1A 2OTXA 2ELBA 4DBBA 5J3TA 2AL6A 5FI1A 1V5UA 2D4QA 4EJNA 1XCGA 3MDBC 2CAYA 4KHOA 2YRYA 4K2PA 4F7HA 2R0DA 3FSSA 1ZM0A 3SUZA 4HAUB 1WJ1A 2H7DA 2D10A 1V61A 4GOUA 1ZSQA 4GMVA 3ZVRA 2GCJA 3BINA 3G9WA 5EFXA 1PMSA 1NU2A 1X1GA 3V5WA 1F5XA 2Z0PA 4A5KA 2IYBA 2NZ8B 3N7CA 3ULCA 1I7AA 3HQCA 1MKEA 3SO6A 3MPXA 2M14A 3TW1A 2RUKB 3QWMA 3PEGA 3PVWA 2RVBB 3AJ4A 1GG3A 1FAOA 2COAA 1GC7A 2J0KA 1UNRA 1EAZA 3A8QA 1ZVRA 3WA0A 1K5DB 5D27A 1M7RA 1FOEA 4MK0A 3KY9A 1MK7B 2LG1A 3QBVB 2I5FA 1SHCA 3ULBA 4HAVB 1UPRA 1ISNA 4F7UP 1X86A 2ADZA 1FGZA 3GYPA 3VIAA 3FEHA 5J3YA 2YT1A 2D11A 5KCVA 1PLSA 2HE7A 4BBKA 3RCPA 1OQNA 2DTCA 1AQCA 2EMSA 1WGQA 5C16A 1MIZB 1KZGA 1BAKA 1V5MA 1V89A 2DFKA 1QC6A 1V5PA 1FHOA 2DKPA 4A6FB 3D8FA 2N23A 2L1CA 2MKRA
chains in the Genus database with same CATH superfamily
2Y8GA 5KQ4A 5C79A 4OSNA 4WVFB 3A58A 2ROVA 1LB1A 2DX1A 4GYVA 1M7EA 1H10A 3FM8C 2Z0QA 2H7EA 2P0DA 2J0JA 3GF9A 4KVGB 2D9YA 2DYQA 2LYDA 3NSUA 2J0MA 2QKMA 3NWDA 4EMOA 1AWEA 1V88A 2G35A 1PFJA 1XD4A 2ELAA 3D8EA 3DXCA 4HHVA 5LONB 1B55A 2FJLA 2QKLA 3NWAA 3U12A 1UPQA 2KUQA 5IRSA 3GYOA 2V76A 1J19A 4Z2NA 1E5WA 4L6EA 2I1KA 2RLOA 2DKQA 4D6WA 1W1DA 2AEHA 3DXDA 5LOPB 2M38A 2DX5A 2NMBA 1UNQA 2PZ1A 3DCXA 2DHJA 3D8DA 2OQBA 1LW3A 1U5DA 3KZ1A 1U2BA 1U5GA 1XX0A 1OY2A 2R09A 3ML4A 1NTVA 4KHAA 2LULA 2VKIA 1BWNA 2Y8FA 2GJYA 2D9XA 3QIJA 1FB8A 2KCJA 4HB0B 2D9VA 4WSFA 5JLJB 2DA0A 3F5RA 3KRWA 4GXBA 1N3HA 4C0AA 4HAWB 1J0WA 1Q67A 2L2IA 1XKEA 4KAXB 2UZRA 2YS1A 1P5TA 3F0WA 1X1FA 2CRFA 2YSZA 1MAIA 5D3XA 3VOQA 2D9WA 2Y7BA 1TXDA 3PVUA 2Q13A 2N0YA 5D3YA 4NSWA 2COCA 4DX90 1XR0B 4KHBB 1MPHA 4HAXB 1KI1B 4B6HA 2DYNA 2P0HA 3PZDA 5KQ1A 1FHWA 4QJ4B 2YVCA 2DN6A 2E2XA 5JHHA 2YT0A 2BCJA 1DROA 4F7GA 1EVHA 2D9ZA 2Z13A 4Y94A 1WG7A 3DXEA 5HE2A 4CSQA 2GUMA 4GZUA 4D0NB 2COFA 3SV1A 5L81A 5J3QA 2RSGA 4CHJA 4NY0A 3AU5A 2YS5A 3ODWA 1U27A 5D3VA 1UNPA 1WJMA 4HAYB 4K81A 3SYXA 4ZRIA 5HE1A 3TO1A 4HB4B 2CY4A 2XQNM 4IAPA 2MDXA 2X18A 1DDWA 5HE3A 2EJ8A 2KR0A 3TCAA 1DDMA 5C6RA 1X05A 3PP2A 2K2UA 2LOXA 2J59M 4DXAB 1Y19B 3M1IB 1KZ7A 3IVFA 4IOYX 1I2HA 2K49A 2YS3A 2ZKMX 2K2JA 3A98B 3TFMA 5D3WA 1ZC4B 2ZPYA 2I1JA 2LOZA 3FVCA 1DDVA 5JP4A 3AU4A 3KSYA 2KIGA 2JP2A 2LKOA 3X23A 4A6FA 2GS0A 4TYZA 1WVHA 2P8VA 3PVLA 3BJIA 1EGXA 3HW2B 1TQZA 4ZRKA 4GMXB 2CY5A 1ZC3B 3ODXA 5LG4B 4ZRJA 3T06A 1RRPB 3JV3A 2FJUB 5HE0A 2EMTA 1P3RA 1H4RA 3PG7A 2W2WA 2W2XC 4MY6A 5DIFB 4CYEA 5DHFB 2HTHB 4K17A 4HB2B 5DH9B 4MT7A 1BTKA 3WYFB 2K00A 2VSZA 3EO2A 1GC6A 1DBHA 2R2YA 3NWFA 4KHBA 1MIXA 4QJ5B 3UZTA 3P7ZA 2D2QA 3A8PA 1Z87A 4CHMA 5FI0A 1FHXA 3U7DA 4HB3B 5CLQB 1RJ2A 2W2XD 4D0OA 5M4YB 1U5FA 1MK9B 1W1GA 4PNKA 4TKNA 5JHGA 2RGNB 2UZSA 3TVVA 1SGHA 4GN1A 1FGYA 4EKUA 3HK0A 4HATB 1IRSA 2P0FA 2DHIA 3LJUX 3ZDTA 4WJ7A 1X11A 1UEFA 4HAZB 4HDQA 3P6AA 2KR9A 1U29A 4A6HA 2CODA 4PQ0A 5C5BB 1EF1A 3CXBB 4L1RA 2VRWB 2Z14A 5DHAB 1U5EA 2Z4DA 5DI9B 2KGXB 3SNHA 2MFQA 3PSCA 2I5CA 4GPTB 1NTYA 3O96A 3OHMB 2IFSA 4Z2MB 3ODOA 1QQGA 3U8ZA 4HSIA 2ROZB 4XWXA 4A6KA 1NI2A 5C5BA 1OMWA 1WI1A 2EC1A 2YF0A 1T77A 1XODA 4YONA 1K5GB 2GCLA 1TJ6A 2KUPA 2DHKA 3KRXA 2RNRB 5CLLB 4H8SA 1BTNA 2UVMA 4P7IA 4YL8A 4DX8A 3OANA 4IFSA 3HSAA 4HDOA 5GOWB 1DYNA 1Y5OA 2Z0OA 3CIKA 2DLWA 1W1HA 3HIEA 4K2OA 2MWNB 1WGUA 1P6SA 2K8EA 1MI1A 1BY1A 2OTXA 2ELBA 4DBBA 5J3TA 2KIEA 2AL6A 5FI1A 1V5UA 3B77A 2D4QA 4EJNA 1XCGA 3MDBC 2CAYA 4KHOA 2RRFA 2YRYA 4K2PA 4F7HA 2R0DA 3FSSA 1ZM0A 3SUZA 4HAUB 1WJ1A 2H7DA 2D10A 1V61A 4GOUA 1ZSQA 4GMVA 3ZVRA 4OT1A 2GCJA 3BINA 3G9WA 5EFXA 1PMSA 1NU2A 1X1GA 3V5WA 1F5XA 2Z0PA 4A5KA 2IYBA 2NZ8B 3N7CA 3ULCA 1I7AA 3HQCA 1MKEA 4GNKB 3MPXA 3SO6A 2M14A 3TW1A 2RUKB 2Z59A 1ZYIA 3QWMA 2YT2A 3PEGA 2NBVA 3PVWA 5I2MA 2RVBB 3AJ4A 1GG3A 1FAOA 2COAA 1GC7A 2J0KA 1UNRA 1EAZA 4DIXA 3A8QA 1ZVRA 3NW8A 3WA0A 1K5DB 5D27A 1M7RA 1FOEA 4MK0A 3KY9A 5I2SA 1MK7B 2LG1A 3QBVB 2I5FA 1SHCA 3ULBA 4HAVB 1UPRA 1ISNA 4F7UP 1X86A 2ADZA 1FGZA 3GYPA 4QJ3B 3VIAA 3FEHA 5J3YA 2YT1A 2D11A 4QXAB 5KCVA 1PLSA 2HE7A 4BBKA 3RCPA 1OQNA 2DTCA 1AQCA 2EMSA 1WGQA 5C16A 1MIZB 1KZGA 1BAKA 1V5MA 1V89A 2DFKA 1QC6A 1V5PA 1FHOA 2DKPA 4A6FB 3D8FA 2N23A 2L1CA 2MKRA
chains in the Genus database with same CATH topology
2Y8GA 5KQ4A 5C79A 4WVFB 2ROVA 1LB1A 2DX1A 4GYVA 1M7EA 1H10A 3FM8C 2Z0QA 2H7EA 2P0DA 2J0JA 3GF9A 4KVGB 2D9YA 2DYQA 2LYDA 3NSUA 2J0MA 2QKMA 4EMOA 1AWEA 1V88A 2G35A 1PFJA 1XD4A 2ELAA 3D8EA 3DXCA 4HHVA 5LONB 1B55A 2FJLA 2QKLA 1UPQA 3GYOA 2V76A 1J19A 4Z2NA 1E5WA 4L6EA 2I1KA 2RLOA 2DKQA 1W1DA 2AEHA 3DXDA 5LOPB 2M38A 2DX5A 2NMBA 1UNQA 2PZ1A 2DHJA 3D8DA 2OQBA 1LW3A 1U5DA 3KZ1A 1U2BA 1U5GA 1XX0A 1OY2A 2R09A 3ML4A 1NTVA 4KHAA 2LULA 2VKIA 1BWNA 2Y8FA 2GJYA 2D9XA 3QIJA 1FB8A 2KCJA 4HB0B 2D9VA 4WSFA 5JLJB 2DA0A 3F5RA 3KRWA 4GXBA 1N3HA 4C0AA 4HAWB 1J0WA 1Q67A 2L2IA 1XKEA 4KAXB 2UZRA 2YS1A 1P5TA 3F0WA 1X1FA 2CRFA 2YSZA 1MAIA 5D3XA 3VOQA 2D9WA 2Y7BA 1TXDA 3PVUA 2Q13A 2N0YA 5D3YA 4NSWA 2COCA 4DX90 1XR0B 4KHBB 1MPHA 4HAXB 1KI1B 4B6HA 2DYNA 2P0HA 3PZDA 5KQ1A 1FHWA 2YVCA 2DN6A 2E2XA 5JHHA 2YT0A 2BCJA 1DROA 4F7GA 1EVHA 2D9ZA 4Y94A 1WG7A 3DXEA 5HE2A 4GZUA 4D0NB 2COFA 3SV1A 5L81A 5J3QA 2RSGA 4CHJA 4NY0A 3AU5A 2YS5A 3ODWA 1U27A 5D3VA 1UNPA 1WJMA 4HAYB 4K81A 3SYXA 4ZRIA 5HE1A 3TO1A 4HB4B 2CY4A 2XQNM 4IAPA 2MDXA 2X18A 1DDWA 5HE3A 2EJ8A 3TCAA 1DDMA 5C6RA 1X05A 3PP2A 2K2UA 2LOXA 2J59M 4DXAB 1Y19B 3M1IB 1KZ7A 3IVFA 4IOYX 1I2HA 2YS3A 3TFMA 3A98B 2K2JA 5D3WA 1ZC4B 2ZPYA 2I1JA 2LOZA 1DDVA 5JP4A 3AU4A 3KSYA 2JP2A 2LKOA 3X23A 4A6FA 2GS0A 4TYZA 1WVHA 2P8VA 3PVLA 3BJIA 1EGXA 3HW2B 1TQZA 4ZRKA 4GMXB 2CY5A 1ZC3B 3ODXA 4ZRJA 3T06A 1RRPB 3JV3A 5HE0A 2EMTA 1P3RA 1H4RA 3PG7A 2W2WA 2W2XC 4MY6A 5DIFB 4CYEA 5DHFB 2HTHB 4K17A 4HB2B 5DH9B 4MT7A 1BTKA 3WYFB 2K00A 2VSZA 3EO2A 1GC6A 1DBHA 1MIXA 3UZTA 3P7ZA 2D2QA 3A8PA 1Z87A 4CHMA 5FI0A 1FHXA 3U7DA 4HB3B 5CLQB 1RJ2A 2W2XD 4D0OA 1U5FA 1MK9B 1W1GA 4PNKA 4TKNA 5JHGA 2RGNB 2UZSA 3TVVA 1SGHA 4GN1A 1FGYA 4EKUA 3HK0A 4HATB 1IRSA 2P0FA 2DHIA 3LJUX 3ZDTA 4WJ7A 1X11A 1UEFA 4HAZB 4HDQA 3P6AA 2KR9A 1U29A 4A6HA 2CODA 4PQ0A 5C5BB 1EF1A 3CXBB 2VRWB 5DHAB 1U5EA 5DI9B 2KGXB 3SNHA 2MFQA 3PSCA 2I5CA 4GPTB 1NTYA 3O96A 2IFSA 4Z2MB 3ODOA 1QQGA 3U8ZA 2ROZB 4XWXA 4A6KA 1NI2A 5C5BA 1OMWA 1WI1A 2EC1A 2YF0A 1XODA 4YONA 1K5GB 2GCLA 1TJ6A 2KUPA 2DHKA 3KRXA 2RNRB 5CLLB 4H8SA 1BTNA 2UVMA 4P7IA 4YL8A 4DX8A 3OANA 4IFSA 4HDOA 5GOWB 1DYNA 1Y5OA 2Z0OA 3CIKA 2DLWA 1W1HA 4K2OA 2MWNB 1WGUA 1P6SA 1BY1A 2OTXA 2ELBA 4DBBA 5J3TA 2AL6A 5FI1A 1V5UA 2D4QA 4EJNA 1XCGA 3MDBC 2CAYA 4KHOA 2YRYA 4K2PA 4F7HA 2R0DA 3FSSA 1ZM0A 3SUZA 4HAUB 1WJ1A 2H7DA 2D10A 1V61A 4GOUA 1ZSQA 4GMVA 3ZVRA 2GCJA 3BINA 3G9WA 5EFXA 1PMSA 1NU2A 1X1GA 3V5WA 1F5XA 2Z0PA 4A5KA 2IYBA 2NZ8B 3N7CA 3ULCA 1I7AA 3HQCA 1MKEA 3SO6A 3MPXA 2M14A 3TW1A 2RUKB 3QWMA 3PEGA 3PVWA 2RVBB 3AJ4A 1GG3A 1FAOA 2COAA 1GC7A 2J0KA 1UNRA 1EAZA 3A8QA 1ZVRA 3WA0A 1K5DB 5D27A 1M7RA 1FOEA 4MK0A 3KY9A 1MK7B 2LG1A 3QBVB 2I5FA 1SHCA 3ULBA 4HAVB 1UPRA 1ISNA 4F7UP 1X86A 2ADZA 1FGZA 3GYPA 3VIAA 3FEHA 5J3YA 2YT1A 2D11A 5KCVA 1PLSA 2HE7A 4BBKA 3RCPA 1OQNA 2DTCA 1AQCA 2EMSA 1WGQA 5C16A 1MIZB 1KZGA 1BAKA 1V5MA 1V89A 2DFKA 1QC6A 1V5PA 1FHOA 2DKPA 4A6FB 3D8FA 2N23A 2L1CA 2MKRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y8G A;  5KQ4 A;  5C79 A;  4WVF B;  2ROV A;  1LB1 A;  2DX1 A;  4GYV A;  1M7E A;  1H10 A;  3FM8 C;  2Z0Q A;  2H7E A;  2P0D A;  2J0J A;  3GF9 A;  4KVG B;  2D9Y A;  2DYQ A;  2LYD A;  3NSU A;  2J0M A;  2QKM A;  4EMO A;  1AWE A;  1V88 A;  2G35 A;  1PFJ A;  1XD4 A;  2ELA A;  3D8E A;  3DXC A;  4HHV A;  5LON B;  1B55 A;  2FJL A;  2QKL A;  1UPQ A;  3GYO A;  2V76 A;  1J19 A;  4Z2N A;  1E5W A;  4L6E A;  2I1K A;  2RLO A;  2DKQ A;  1W1D A;  2AEH A;  3DXD A;  5LOP B;  2M38 A;  2DX5 A;  2NMB A;  1UNQ A;  2PZ1 A;  2DHJ A;  3D8D A;  2OQB A;  1LW3 A;  1U5D A;  3KZ1 A;  1U2B A;  1U5G A;  1XX0 A;  1OY2 A;  2R09 A;  3ML4 A;  1NTV A;  4KHA A;  2LUL A;  2VKI A;  1BWN A;  2Y8F A;  2GJY A;  2D9X A;  3QIJ A;  1FB8 A;  2KCJ A;  4HB0 B;  2D9V A;  4WSF A;  5JLJ B;  2DA0 A;  3F5R A;  3KRW A;  4GXB A;  1N3H A;  4C0A A;  4HAW B;  1J0W A;  1Q67 A;  2L2I A;  1XKE A;  4KAX B;  2UZR A;  2YS1 A;  1P5T A;  3F0W A;  1X1F A;  2CRF A;  2YSZ A;  1MAI A;  5D3X A;  3VOQ A;  2D9W A;  2Y7B A;  1TXD A;  3PVU A;  2Q13 A;  2N0Y A;  5D3Y A;  4NSW A;  2COC A;  4DX9 0;  1XR0 B;  4KHB B;  1MPH A;  4HAX B;  1KI1 B;  4B6H A;  2DYN A;  2P0H A;  3PZD A;  5KQ1 A;  1FHW A;  2YVC A;  2DN6 A;  2E2X A;  5JHH A;  2YT0 A;  2BCJ A;  1DRO A;  4F7G A;  1EVH A;  2D9Z A;  4Y94 A;  1WG7 A;  3DXE A;  5HE2 A;  4GZU A;  4D0N B;  2COF A;  3SV1 A;  5L81 A;  5J3Q A;  2RSG A;  4CHJ A;  4NY0 A;  3AU5 A;  2YS5 A;  3ODW A;  1U27 A;  5D3V A;  1UNP A;  1WJM A;  4HAY B;  4K81 A;  3SYX A;  4ZRI A;  5HE1 A;  3TO1 A;  4HB4 B;  2CY4 A;  2XQN M;  4IAP A;  2MDX A;  2X18 A;  1DDW A;  5HE3 A;  2EJ8 A;  3TCA A;  1DDM A;  5C6R A;  1X05 A;  3PP2 A;  2K2U A;  2LOX A;  2J59 M;  4DXA B;  1Y19 B;  3M1I B;  1KZ7 A;  3IVF A;  4IOY X;  1I2H A;  2YS3 A;  3TFM A;  3A98 B;  2K2J A;  5D3W A;  1ZC4 B;  2ZPY A;  2I1J A;  2LOZ A;  1DDV A;  5JP4 A;  3AU4 A;  3KSY A;  2JP2 A;  2LKO A;  3X23 A;  4A6F A;  2GS0 A;  4TYZ A;  1WVH A;  2P8V A;  3PVL A;  3BJI A;  1EGX A;  3HW2 B;  1TQZ A;  4ZRK A;  4GMX B;  2CY5 A;  1ZC3 B;  3ODX A;  4ZRJ A;  3T06 A;  1RRP B;  3JV3 A;  5HE0 A;  2EMT A;  1P3R A;  1H4R A;  3PG7 A;  2W2W A;  2W2X C;  4MY6 A;  5DIF B;  4CYE A;  5DHF B;  2HTH B;  4K17 A;  4HB2 B;  5DH9 B;  4MT7 A;  1BTK A;  3WYF B;  2K00 A;  2VSZ A;  3EO2 A;  1GC6 A;  1DBH A;  1MIX A;  3UZT A;  3P7Z A;  2D2Q A;  3A8P A;  1Z87 A;  4CHM A;  5FI0 A;  1FHX A;  3U7D A;  4HB3 B;  5CLQ B;  1RJ2 A;  2W2X D;  4D0O A;  1U5F A;  1MK9 B;  1W1G A;  4PNK A;  4TKN A;  5JHG A;  2RGN B;  2UZS A;  3TVV A;  1SGH A;  4GN1 A;  1FGY A;  4EKU A;  3HK0 A;  4HAT B;  1IRS A;  2P0F A;  2DHI A;  3LJU X;  3ZDT A;  4WJ7 A;  1X11 A;  1UEF A;  4HAZ B;  4HDQ A;  3P6A A;  2KR9 A;  1U29 A;  4A6H A;  2COD A;  4PQ0 A;  5C5B B;  1EF1 A;  3CXB B;  2VRW B;  5DHA B;  1U5E A;  5DI9 B;  2KGX B;  3SNH A;  2MFQ A;  3PSC A;  2I5C A;  4GPT B;  1NTY A;  3O96 A;  2IFS A;  4Z2M B;  3ODO A;  1QQG A;  3U8Z A;  2ROZ B;  4XWX A;  4A6K A;  1NI2 A;  5C5B A;  1OMW A;  1WI1 A;  2EC1 A;  2YF0 A;  1XOD A;  4YON A;  1K5G B;  2GCL A;  1TJ6 A;  2KUP A;  2DHK A;  3KRX A;  2RNR B;  5CLL B;  4H8S A;  1BTN A;  2UVM A;  4P7I A;  4YL8 A;  4DX8 A;  3OAN A;  4IFS A;  4HDO A;  5GOW B;  1DYN A;  1Y5O A;  2Z0O A;  3CIK A;  2DLW A;  1W1H A;  4K2O A;  2MWN B;  1WGU A;  1P6S A;  1BY1 A;  2OTX A;  2ELB A;  4DBB A;  5J3T A;  2AL6 A;  5FI1 A;  1V5U A;  2D4Q A;  4EJN A;  1XCG A;  3MDB C;  2CAY A;  4KHO A;  2YRY A;  4K2P A;  4F7H A;  2R0D A;  3FSS A;  1ZM0 A;  3SUZ A;  4HAU B;  1WJ1 A;  2H7D A;  2D10 A;  1V61 A;  4GOU A;  1ZSQ A;  4GMV A;  3ZVR A;  2GCJ A;  3BIN A;  3G9W A;  5EFX A;  1PMS A;  1NU2 A;  1X1G A;  3V5W A;  1F5X A;  2Z0P A;  4A5K A;  2IYB A;  2NZ8 B;  3N7C A;  3ULC A;  1I7A A;  3HQC A;  1MKE A;  3SO6 A;  3MPX A;  2M14 A;  3TW1 A;  2RUK B;  3QWM A;  3PEG A;  3PVW A;  2RVB B;  3AJ4 A;  1GG3 A;  1FAO A;  2COA A;  1GC7 A;  2J0K A;  1UNR A;  1EAZ A;  3A8Q A;  1ZVR A;  3WA0 A;  1K5D B;  5D27 A;  1M7R A;  1FOE A;  4MK0 A;  3KY9 A;  1MK7 B;  2LG1 A;  3QBV B;  2I5F A;  1SHC A;  3ULB A;  4HAV B;  1UPR A;  1ISN A;  4F7U P;  1X86 A;  2ADZ A;  1FGZ A;  3GYP A;  3VIA A;  3FEH A;  5J3Y A;  2YT1 A;  2D11 A;  5KCV A;  1PLS A;  2HE7 A;  4BBK A;  3RCP A;  1OQN A;  2DTC A;  1AQC A;  2EMS A;  1WGQ A;  5C16 A;  1MIZ B;  1KZG A;  1BAK A;  1V5M A;  1V89 A;  2DFK A;  1QC6 A;  1V5P A;  1FHO A;  2DKP A;  4A6F B;  3D8F A;  2N23 A;  2L1C A;  2MKR A; 
#chains in the Genus database with same CATH topology
 2Y8G A;  5KQ4 A;  5C79 A;  4OSN A;  4WVF B;  3A58 A;  2ROV A;  1LB1 A;  2DX1 A;  4GYV A;  1M7E A;  1H10 A;  3FM8 C;  2Z0Q A;  2H7E A;  2P0D A;  2J0J A;  3GF9 A;  4KVG B;  2D9Y A;  2DYQ A;  2LYD A;  3NSU A;  2J0M A;  2QKM A;  3NWD A;  4EMO A;  1AWE A;  1V88 A;  2G35 A;  1PFJ A;  1XD4 A;  2ELA A;  3D8E A;  3DXC A;  4HHV A;  5LON B;  1B55 A;  2FJL A;  2QKL A;  3NWA A;  3U12 A;  1UPQ A;  2KUQ A;  5IRS A;  3GYO A;  2V76 A;  1J19 A;  4Z2N A;  1E5W A;  4L6E A;  2I1K A;  2RLO A;  2DKQ A;  4D6W A;  1W1D A;  2AEH A;  3DXD A;  5LOP B;  2M38 A;  2DX5 A;  2NMB A;  1UNQ A;  2PZ1 A;  3DCX A;  2DHJ A;  3D8D A;  2OQB A;  1LW3 A;  1U5D A;  3KZ1 A;  1U2B A;  1U5G A;  1XX0 A;  1OY2 A;  2R09 A;  3ML4 A;  1NTV A;  4KHA A;  2LUL A;  2VKI A;  1BWN A;  2Y8F A;  2GJY A;  2D9X A;  3QIJ A;  1FB8 A;  2KCJ A;  4HB0 B;  2D9V A;  4WSF A;  5JLJ B;  2DA0 A;  3F5R A;  3KRW A;  4GXB A;  1N3H A;  4C0A A;  4HAW B;  1J0W A;  1Q67 A;  2L2I A;  1XKE A;  4KAX B;  2UZR A;  2YS1 A;  1P5T A;  3F0W A;  1X1F A;  2CRF A;  2YSZ A;  1MAI A;  5D3X A;  3VOQ A;  2D9W A;  2Y7B A;  1TXD A;  3PVU A;  2Q13 A;  2N0Y A;  5D3Y A;  4NSW A;  2COC A;  4DX9 0;  1XR0 B;  4KHB B;  1MPH A;  4HAX B;  1KI1 B;  4B6H A;  2DYN A;  2P0H A;  3PZD A;  5KQ1 A;  1FHW A;  4QJ4 B;  2YVC A;  2DN6 A;  2E2X A;  5JHH A;  2YT0 A;  2BCJ A;  1DRO A;  4F7G A;  1EVH A;  2D9Z A;  2Z13 A;  4Y94 A;  1WG7 A;  3DXE A;  5HE2 A;  4CSQ A;  2GUM A;  4GZU A;  4D0N B;  2COF A;  3SV1 A;  5L81 A;  5J3Q A;  2RSG A;  4CHJ A;  4NY0 A;  3AU5 A;  2YS5 A;  3ODW A;  1U27 A;  5D3V A;  1UNP A;  1WJM A;  4HAY B;  4K81 A;  3SYX A;  4ZRI A;  5HE1 A;  3TO1 A;  4HB4 B;  2CY4 A;  2XQN M;  4IAP A;  2MDX A;  2X18 A;  1DDW A;  5HE3 A;  2EJ8 A;  2KR0 A;  3TCA A;  1DDM A;  5C6R A;  1X05 A;  3PP2 A;  2K2U A;  2LOX A;  2J59 M;  4DXA B;  1Y19 B;  3M1I B;  1KZ7 A;  3IVF A;  4IOY X;  1I2H A;  2K49 A;  2YS3 A;  2ZKM X;  2K2J A;  3A98 B;  3TFM A;  5D3W A;  1ZC4 B;  2ZPY A;  2I1J A;  2LOZ A;  3FVC A;  1DDV A;  5JP4 A;  3AU4 A;  3KSY A;  2KIG A;  2JP2 A;  2LKO A;  3X23 A;  4A6F A;  2GS0 A;  4TYZ A;  1WVH A;  2P8V A;  3PVL A;  3BJI A;  1EGX A;  3HW2 B;  1TQZ A;  4ZRK A;  4GMX B;  2CY5 A;  1ZC3 B;  3ODX A;  5LG4 B;  4ZRJ A;  3T06 A;  1RRP B;  3JV3 A;  2FJU B;  5HE0 A;  2EMT A;  1P3R A;  1H4R A;  3PG7 A;  2W2W A;  2W2X C;  4MY6 A;  5DIF B;  4CYE A;  5DHF B;  2HTH B;  4K17 A;  4HB2 B;  5DH9 B;  4MT7 A;  1BTK A;  3WYF B;  2K00 A;  2VSZ A;  3EO2 A;  1GC6 A;  1DBH A;  2R2Y A;  3NWF A;  4KHB A;  1MIX A;  4QJ5 B;  3UZT A;  3P7Z A;  2D2Q A;  3A8P A;  1Z87 A;  4CHM A;  5FI0 A;  1FHX A;  3U7D A;  4HB3 B;  5CLQ B;  1RJ2 A;  2W2X D;  4D0O A;  5M4Y B;  1U5F A;  1MK9 B;  1W1G A;  4PNK A;  4TKN A;  5JHG A;  2RGN B;  2UZS A;  3TVV A;  1SGH A;  4GN1 A;  1FGY A;  4EKU A;  3HK0 A;  4HAT B;  1IRS A;  2P0F A;  2DHI A;  3LJU X;  3ZDT A;  4WJ7 A;  1X11 A;  1UEF A;  4HAZ B;  4HDQ A;  3P6A A;  2KR9 A;  1U29 A;  4A6H A;  2COD A;  4PQ0 A;  5C5B B;  1EF1 A;  3CXB B;  4L1R A;  2VRW B;  2Z14 A;  5DHA B;  1U5E A;  2Z4D A;  5DI9 B;  2KGX B;  3SNH A;  2MFQ A;  3PSC A;  2I5C A;  4GPT B;  1NTY A;  3O96 A;  3OHM B;  2IFS A;  4Z2M B;  3ODO A;  1QQG A;  3U8Z A;  4HSI A;  2ROZ B;  4XWX A;  4A6K A;  1NI2 A;  5C5B A;  1OMW A;  1WI1 A;  2EC1 A;  2YF0 A;  1T77 A;  1XOD A;  4YON A;  1K5G B;  2GCL A;  1TJ6 A;  2KUP A;  2DHK A;  3KRX A;  2RNR B;  5CLL B;  4H8S A;  1BTN A;  2UVM A;  4P7I A;  4YL8 A;  4DX8 A;  3OAN A;  4IFS A;  3HSA A;  4HDO A;  5GOW B;  1DYN A;  1Y5O A;  2Z0O A;  3CIK A;  2DLW A;  1W1H A;  3HIE A;  4K2O A;  2MWN B;  1WGU A;  1P6S A;  2K8E A;  1MI1 A;  1BY1 A;  2OTX A;  2ELB A;  4DBB A;  5J3T A;  2KIE A;  2AL6 A;  5FI1 A;  1V5U A;  3B77 A;  2D4Q A;  4EJN A;  1XCG A;  3MDB C;  2CAY A;  4KHO A;  2RRF A;  2YRY A;  4K2P A;  4F7H A;  2R0D A;  3FSS A;  1ZM0 A;  3SUZ A;  4HAU B;  1WJ1 A;  2H7D A;  2D10 A;  1V61 A;  4GOU A;  1ZSQ A;  4GMV A;  3ZVR A;  4OT1 A;  2GCJ A;  3BIN A;  3G9W A;  5EFX A;  1PMS A;  1NU2 A;  1X1G A;  3V5W A;  1F5X A;  2Z0P A;  4A5K A;  2IYB A;  2NZ8 B;  3N7C A;  3ULC A;  1I7A A;  3HQC A;  1MKE A;  4GNK B;  3MPX A;  3SO6 A;  2M14 A;  3TW1 A;  2RUK B;  2Z59 A;  1ZYI A;  3QWM A;  2YT2 A;  3PEG A;  2NBV A;  3PVW A;  5I2M A;  2RVB B;  3AJ4 A;  1GG3 A;  1FAO A;  2COA A;  1GC7 A;  2J0K A;  1UNR A;  1EAZ A;  4DIX A;  3A8Q A;  1ZVR A;  3NW8 A;  3WA0 A;  1K5D B;  5D27 A;  1M7R A;  1FOE A;  4MK0 A;  3KY9 A;  5I2S A;  1MK7 B;  2LG1 A;  3QBV B;  2I5F A;  1SHC A;  3ULB A;  4HAV B;  1UPR A;  1ISN A;  4F7U P;  1X86 A;  2ADZ A;  1FGZ A;  3GYP A;  4QJ3 B;  3VIA A;  3FEH A;  5J3Y A;  2YT1 A;  2D11 A;  4QXA B;  5KCV A;  1PLS A;  2HE7 A;  4BBK A;  3RCP A;  1OQN A;  2DTC A;  1AQC A;  2EMS A;  1WGQ A;  5C16 A;  1MIZ B;  1KZG A;  1BAK A;  1V5M A;  1V89 A;  2DFK A;  1QC6 A;  1V5P A;  1FHO A;  2DKP A;  4A6F B;  3D8F A;  2N23 A;  2L1C A;  2MKR A; 
#chains in the Genus database with same CATH homology
 2Y8G A;  5KQ4 A;  5C79 A;  4WVF B;  2ROV A;  1LB1 A;  2DX1 A;  4GYV A;  1M7E A;  1H10 A;  3FM8 C;  2Z0Q A;  2H7E A;  2P0D A;  2J0J A;  3GF9 A;  4KVG B;  2D9Y A;  2DYQ A;  2LYD A;  3NSU A;  2J0M A;  2QKM A;  4EMO A;  1AWE A;  1V88 A;  2G35 A;  1PFJ A;  1XD4 A;  2ELA A;  3D8E A;  3DXC A;  4HHV A;  5LON B;  1B55 A;  2FJL A;  2QKL A;  1UPQ A;  3GYO A;  2V76 A;  1J19 A;  4Z2N A;  1E5W A;  4L6E A;  2I1K A;  2RLO A;  2DKQ A;  1W1D A;  2AEH A;  3DXD A;  5LOP B;  2M38 A;  2DX5 A;  2NMB A;  1UNQ A;  2PZ1 A;  2DHJ A;  3D8D A;  2OQB A;  1LW3 A;  1U5D A;  3KZ1 A;  1U2B A;  1U5G A;  1XX0 A;  1OY2 A;  2R09 A;  3ML4 A;  1NTV A;  4KHA A;  2LUL A;  2VKI A;  1BWN A;  2Y8F A;  2GJY A;  2D9X A;  3QIJ A;  1FB8 A;  2KCJ A;  4HB0 B;  2D9V A;  4WSF A;  5JLJ B;  2DA0 A;  3F5R A;  3KRW A;  4GXB A;  1N3H A;  4C0A A;  4HAW B;  1J0W A;  1Q67 A;  2L2I A;  1XKE A;  4KAX B;  2UZR A;  2YS1 A;  1P5T A;  3F0W A;  1X1F A;  2CRF A;  2YSZ A;  1MAI A;  5D3X A;  3VOQ A;  2D9W A;  2Y7B A;  1TXD A;  3PVU A;  2Q13 A;  2N0Y A;  5D3Y A;  4NSW A;  2COC A;  4DX9 0;  1XR0 B;  4KHB B;  1MPH A;  4HAX B;  1KI1 B;  4B6H A;  2DYN A;  2P0H A;  3PZD A;  5KQ1 A;  1FHW A;  2YVC A;  2DN6 A;  2E2X A;  5JHH A;  2YT0 A;  2BCJ A;  1DRO A;  4F7G A;  1EVH A;  2D9Z A;  4Y94 A;  1WG7 A;  3DXE A;  5HE2 A;  4GZU A;  4D0N B;  2COF A;  3SV1 A;  5L81 A;  5J3Q A;  2RSG A;  4CHJ A;  4NY0 A;  3AU5 A;  2YS5 A;  3ODW A;  1U27 A;  5D3V A;  1UNP A;  1WJM A;  4HAY B;  4K81 A;  3SYX A;  4ZRI A;  5HE1 A;  3TO1 A;  4HB4 B;  2CY4 A;  2XQN M;  4IAP A;  2MDX A;  2X18 A;  1DDW A;  5HE3 A;  2EJ8 A;  3TCA A;  1DDM A;  5C6R A;  1X05 A;  3PP2 A;  2K2U A;  2LOX A;  2J59 M;  4DXA B;  1Y19 B;  3M1I B;  1KZ7 A;  3IVF A;  4IOY X;  1I2H A;  2YS3 A;  3TFM A;  3A98 B;  2K2J A;  5D3W A;  1ZC4 B;  2ZPY A;  2I1J A;  2LOZ A;  1DDV A;  5JP4 A;  3AU4 A;  3KSY A;  2JP2 A;  2LKO A;  3X23 A;  4A6F A;  2GS0 A;  4TYZ A;  1WVH A;  2P8V A;  3PVL A;  3BJI A;  1EGX A;  3HW2 B;  1TQZ A;  4ZRK A;  4GMX B;  2CY5 A;  1ZC3 B;  3ODX A;  4ZRJ A;  3T06 A;  1RRP B;  3JV3 A;  5HE0 A;  2EMT A;  1P3R A;  1H4R A;  3PG7 A;  2W2W A;  2W2X C;  4MY6 A;  5DIF B;  4CYE A;  5DHF B;  2HTH B;  4K17 A;  4HB2 B;  5DH9 B;  4MT7 A;  1BTK A;  3WYF B;  2K00 A;  2VSZ A;  3EO2 A;  1GC6 A;  1DBH A;  1MIX A;  3UZT A;  3P7Z A;  2D2Q A;  3A8P A;  1Z87 A;  4CHM A;  5FI0 A;  1FHX A;  3U7D A;  4HB3 B;  5CLQ B;  1RJ2 A;  2W2X D;  4D0O A;  1U5F A;  1MK9 B;  1W1G A;  4PNK A;  4TKN A;  5JHG A;  2RGN B;  2UZS A;  3TVV A;  1SGH A;  4GN1 A;  1FGY A;  4EKU A;  3HK0 A;  4HAT B;  1IRS A;  2P0F A;  2DHI A;  3LJU X;  3ZDT A;  4WJ7 A;  1X11 A;  1UEF A;  4HAZ B;  4HDQ A;  3P6A A;  2KR9 A;  1U29 A;  4A6H A;  2COD A;  4PQ0 A;  5C5B B;  1EF1 A;  3CXB B;  2VRW B;  5DHA B;  1U5E A;  5DI9 B;  2KGX B;  3SNH A;  2MFQ A;  3PSC A;  2I5C A;  4GPT B;  1NTY A;  3O96 A;  2IFS A;  4Z2M B;  3ODO A;  1QQG A;  3U8Z A;  2ROZ B;  4XWX A;  4A6K A;  1NI2 A;  5C5B A;  1OMW A;  1WI1 A;  2EC1 A;  2YF0 A;  1XOD A;  4YON A;  1K5G B;  2GCL A;  1TJ6 A;  2KUP A;  2DHK A;  3KRX A;  2RNR B;  5CLL B;  4H8S A;  1BTN A;  2UVM A;  4P7I A;  4YL8 A;  4DX8 A;  3OAN A;  4IFS A;  4HDO A;  5GOW B;  1DYN A;  1Y5O A;  2Z0O A;  3CIK A;  2DLW A;  1W1H A;  4K2O A;  2MWN B;  1WGU A;  1P6S A;  1BY1 A;  2OTX A;  2ELB A;  4DBB A;  5J3T A;  2AL6 A;  5FI1 A;  1V5U A;  2D4Q A;  4EJN A;  1XCG A;  3MDB C;  2CAY A;  4KHO A;  2YRY A;  4K2P A;  4F7H A;  2R0D A;  3FSS A;  1ZM0 A;  3SUZ A;  4HAU B;  1WJ1 A;  2H7D A;  2D10 A;  1V61 A;  4GOU A;  1ZSQ A;  4GMV A;  3ZVR A;  2GCJ A;  3BIN A;  3G9W A;  5EFX A;  1PMS A;  1NU2 A;  1X1G A;  3V5W A;  1F5X A;  2Z0P A;  4A5K A;  2IYB A;  2NZ8 B;  3N7C A;  3ULC A;  1I7A A;  3HQC A;  1MKE A;  3SO6 A;  3MPX A;  2M14 A;  3TW1 A;  2RUK B;  3QWM A;  3PEG A;  3PVW A;  2RVB B;  3AJ4 A;  1GG3 A;  1FAO A;  2COA A;  1GC7 A;  2J0K A;  1UNR A;  1EAZ A;  3A8Q A;  1ZVR A;  3WA0 A;  1K5D B;  5D27 A;  1M7R A;  1FOE A;  4MK0 A;  3KY9 A;  1MK7 B;  2LG1 A;  3QBV B;  2I5F A;  1SHC A;  3ULB A;  4HAV B;  1UPR A;  1ISN A;  4F7U P;  1X86 A;  2ADZ A;  1FGZ A;  3GYP A;  3VIA A;  3FEH A;  5J3Y A;  2YT1 A;  2D11 A;  5KCV A;  1PLS A;  2HE7 A;  4BBK A;  3RCP A;  1OQN A;  2DTC A;  1AQC A;  2EMS A;  1WGQ A;  5C16 A;  1MIZ B;  1KZG A;  1BAK A;  1V5M A;  1V89 A;  2DFK A;  1QC6 A;  1V5P A;  1FHO A;  2DKP A;  4A6F B;  3D8F A;  2N23 A;  2L1C A;  2MKR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...