4MT7A

Crystal structure of collybistin i
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
337
structure length
337
Chain Sequence
QNRDQMRANVINEIMSTERHYIKHLKDICEGYLKQCRKRRDMFSDEQLKVIFGNIEDIYRFQMGFVRDLEKQYNNDDPHLSEIGPCFLEHQDGFWIYSEYCNNHLDACMELSKLMKDSRYQHFFEACRLLQQMIDIAIDGFLLTPVQKICKYPLQLAELLKYTAQDHSDYRYVAAALAVMRNVTQQINERKRRLENIDKIAQWQASVLDWEGDDILDRSSELIYTGEMAWIYQPYGRNQQRVFFLFDHQMVLCKKDLIRRDILYYKGRIDMDKYEVIDIEDGRDDDFNVSMKNAFKLHNKETEEVHLFFAKKLEEKIRWLRAFREERKMVQEDEKIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Rho guanine nucleotide exchange factor 9
publication title A conformational switch in collybistin determines the differentiation of inhibitory postsynapses.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Protein binding
total genus 115
structure length 337
sequence length 337
ec nomenclature
pdb deposition date 2013-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
A PF00169 PH PH domain
A PF00621 RhoGEF RhoGEF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.900.10 Mainly Alpha Up-down Bundle Dbl Homology Domain; Chain A Dbl homology (DH) domain 4mt7A01
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4mt7A02
4HB2B 1UNPA 1J0WA 1X86A 4KAXB 3WYFB 4YONA 2DHIA 3KSYA 3HQCA 4PQ0A 1X1GA 1NTYA 2I1JA 3FEHA 1M7RA 1BTNA 3N7CA 2W2XC 4DX8A 2LOXA 1W1DA 4D0OA 4KHBB 1J19A 3EO2A 1WI1A 2P0FA 1DYNA 1I2HA 5D3VA 2EC1A 2Y7BA 1ZM0A 4C0AA 3FSSA 4HAUB 3F5RA 2HTHB 4MY6A 1BTKA 5JHGA 4L6EA 1V5MA 2CY5A 3PP2A 1WGUA 4A6HA 2D4QA 5KQ1A 4WVFB 1GG3A 3PVWA 2Y8FA 5DHFB 4CYEA 2YSZA 3PVLA 1P5TA 3ODXA 4DBBA 2NMBA 1GC7A 4HATB 2LG1A 3QIJA 2XQNM 3TO1A 3ULBA 5HE0A 3DXCA 5KQ4A 4BBKA 3D8DA 1FGYA 4F7UP 1Q67A 3ODOA 1U27A 1FHXA 1X11A 1ZC4B 2ADZA 4ZRKA 1MIXA 2K2JA 2Q13A 3MDBC 1FGZA 2Z0QA 2Z0PA 4D0NB 2YS5A 4GOUA 2LULA 4IFSA 1V89A 4HDOA 3F0WA 2CY4A 1DDWA 2D10A 2D11A 1UPRA 2CODA 2MFQA 2MWNB 4KHOA 1BY1A 3BJIA 2X18A 1OY2A 2YF0A 1XODA 5JLJB 4K81A 1TXDA 2DX1A 3U8ZA 1WJ1A 1M7EA 4P7IA 1P3RA 2JP2A 4MK0A 5CLQB 2IYBA 1V61A 3DXEA 2P0DA 1FB8A 1Y5OA 1NU2A 5D3WA 4CHMA 3P7ZA 4ZRJA 5J3TA 2I5FA 3KRWA 1MK9B 3D8FA 5LOPB 4GZUA 5CLLB 4GMXB 3MPXA 3VIAA 3ZVRA 4K17A 1Z87A 2UVMA 1XR0B 4Z2NA 4GYVA 2RUKB 3AJ4A 2EMTA 1ISNA 5D3YA 4MT7A 4F7HA 1KZGA 2D9VA 2YRYA 3SUZA 5J3QA 4YL8A 5GOWB 1DROA 2RVBB 2L2IA 5C79A 1MKEA 3AU4A 1W1GA 4KVGB 3HK0A 3IVFA 2ROVA 1KZ7A 1PLSA 4Z2MB 1MAIA 3SO6A 2RGNB 1Y19B 2VRWB 2AEHA 2P8VA 2H7DA 2I5CA 2DYNA 2DX5A 1K5DB 2YT1A 3CIKA 1ZSQA 3RCPA 3A98B 1FAOA 2RNRB 1PFJA 1WVHA 2LKOA 2YT0A 4TYZA 1TQZA 2V76A 2R0DA 1MIZB 3SNHA 3KZ1A 1SHCA 3PEGA 1ZC3B 2K2UA 1BWNA 2OTXA 3A8QA 3WA0A 2DKPA 1V5UA 1XD4A 3LJUX 2CRFA 3NSUA 2G35A 3ML4A 1BAKA 1N3HA 2ELBA 4B6HA 1H4RA 1XCGA 5HE1A 2D9XA 3GYOA 1V88A 1TJ6A 2DLWA 1EF1A 1KI1B 4A5KA 1X1FA 3TVVA 2DHJA 1XX0A 4H8SA 2J0KA 2MKRA 5L81A 2FJLA 1DDMA 1QC6A 2Z0OA 4F7GA 1GC6A 2RSGA 5D27A 1NTVA 1RJ2A 5FI0A 1I7AA 4HB3B 2M38A 2GCLA 2J0JA 2EJ8A 1U5FA 4HAWB 2PZ1A 3PZDA 2KUPA 2BCJA 3D8EA 4K2OA 2QKLA 2DN6A 1AQCA 4A6FA 1LW3A 1PMSA 4KHAA 2OQBA 2W2XD 1UPQA 1OMWA 1DDVA 4CHJA 3ODWA 3QWMA 2LYDA 3KY9A 2Y8GA 2D2QA 2DA0A 1IRSA 4HAYB 4PNKA 1E5WA 4GPTB 5HE2A 1NI2A 3GYPA 3SYXA 2COAA 5LONB 1W1HA 2IFSA 4DX90 2N0YA 4NY0A 4DXAB 1MPHA 1LB1A 3BINA 4GMVA 4GXBA 4EKUA 1DBHA 2DTCA 3TW1A 1U5GA 3GF9A 3X23A 1ZVRA 2COCA 2CAYA 2YVCA 2DYQA 1QQGA 5C6RA 3T06A 2D9YA 2UZRA 1WG7A 4HAZB 3DXDA 5D3XA 2DKQA 4TKNA 1EAZA 2EMSA 4GN1A 3FM8C 2COFA 2J0MA 4EJNA 4ZRIA 1V5PA 2ELAA 1FHOA 5J3YA 2KGXB 4A6FB 2MDXA 4HHVA 3PVUA 1H10A 4IAPA 3VOQA 1B55A 3PG7A 3U7DA 2KCJA 5DHAB 3P6AA 4WSFA 1U5DA 2ZPYA 2I1KA 5C5BA 3ZDTA 4HAXB 1EGXA 1XKEA 2KR9A 1WJMA 2NZ8B 2K00A 2R09A 4EMOA 2YS1A 2J59M 3QBVB 5DI9B 2VSZA 1UNQA 3SV1A 1RRPB 3JV3A 4K2PA 1U5EA 2L1CA 3CXBB 4XWXA 1AWEA 2ROZB 2DFKA 1U2BA 5DIFB 3HW2B 2GJYA 1UEFA 2E2XA 1F5XA 2LOZA 1P6SA 2D9WA 3V5WA 5JP4A 4A6KA 5KCVA 2M14A 3UZTA 1FHWA 2W2WA 3O96A 2QKMA 5FI1A 5C16A 1EVHA 3OANA 4HDQA 1WGQA 4HB0B 5EFXA 2GS0A 5HE3A 2GCJA 2DHKA 3TCAA 2UZSA 1X05A 3PSCA 3M1IB 2RLOA 1UNRA 3G9WA 4WJ7A 1OQNA 2H7EA 4HAVB 4HB4B 3ULCA 1U29A 5JHHA 2VKIA 2HE7A 3KRXA 2P0HA 4Y94A 1MK7B 1K5GB 3TFMA 2N23A 3AU5A 1SGHA 2YS3A 1FOEA 2D9ZA 2AL6A 5DH9B 4NSWA 3A8PA 5C5BB 4IOYX
chains in the Genus database with same CATH superfamily
4HB2B 1UNPA 1J0WA 1X86A 4KAXB 3WYFB 4YONA 2DHIA 3KSYA 3HQCA 4PQ0A 1X1GA 1NTYA 2I1JA 3FEHA 1M7RA 1BTNA 3N7CA 2W2XC 4DX8A 3OHMB 2LOXA 1W1DA 4D0OA 4KHBB 1J19A 3EO2A 1WI1A 2P0FA 1DYNA 1I2HA 5D3VA 2EC1A 4DIXA 2Y7BA 1ZM0A 4C0AA 3FSSA 4HAUB 2GUMA 4L1RA 3F5RA 2HTHB 4MY6A 1BTKA 5JHGA 4L6EA 1V5MA 2CY5A 3NWAA 3PP2A 1WGUA 4A6HA 2D4QA 5KQ1A 4WVFB 1GG3A 3PVWA 2Y8FA 4QXAB 5DHFB 4CYEA 2YSZA 3PVLA 1P5TA 3ODXA 4DBBA 2NMBA 1GC7A 4HATB 2FJUB 2LG1A 3NW8A 3QIJA 2XQNM 3TO1A 2K8EA 3ULBA 5HE0A 3DXCA 5KQ4A 4BBKA 3D8DA 1FGYA 4F7UP 1Q67A 3ODOA 1U27A 1FHXA 1X11A 1ZC4B 2ADZA 4ZRKA 4D6WA 1MIXA 2K2JA 2Q13A 3MDBC 1FGZA 2Z0QA 2Z0PA 4D0NB 2YS5A 4GOUA 2LULA 4IFSA 1V89A 4HDOA 3F0WA 2CY4A 1DDWA 2D10A 2D11A 1UPRA 2CODA 2MFQA 2MWNB 4KHOA 1BY1A 3BJIA 2X18A 1OY2A 2YF0A 1XODA 5JLJB 4K81A 1TXDA 2K49A 2DX1A 3U8ZA 1WJ1A 1M7EA 4P7IA 1P3RA 2JP2A 4MK0A 4OSNA 5CLQB 2IYBA 3NWDA 1V61A 3DXEA 2P0DA 1FB8A 1Y5OA 1NU2A 5D3WA 3A58A 4CHMA 5I2SA 3P7ZA 3HSAA 4ZRJA 5J3TA 2I5FA 3KRWA 1MK9B 3D8FA 5LOPB 4GZUA 5CLLB 5IRSA 4GMXB 3MPXA 3VIAA 3ZVRA 4K17A 1Z87A 2UVMA 1XR0B 4Z2NA 4GYVA 2RUKB 3AJ4A 2EMTA 1ISNA 5D3YA 4MT7A 4F7HA 1KZGA 2D9VA 2YRYA 3SUZA 5J3QA 4YL8A 5GOWB 1DROA 2RVBB 2L2IA 5C79A 1MKEA 3AU4A 1W1GA 4KVGB 5LG4B 3HK0A 3IVFA 2ROVA 1KZ7A 1PLSA 4Z2MB 1MAIA 3SO6A 2RGNB 1Y19B 2VRWB 2AEHA 2P8VA 2H7DA 2I5CA 3HIEA 2DYNA 2DX5A 1K5DB 2YT1A 3CIKA 2Z4DA 1ZSQA 3RCPA 3A98B 1FAOA 2RNRB 1PFJA 1WVHA 2LKOA 2YT0A 4TYZA 1TQZA 2YT2A 2V76A 2R0DA 1MIZB 3SNHA 3KZ1A 1SHCA 3PEGA 1ZC3B 2K2UA 1BWNA 2OTXA 3A8QA 3WA0A 2DKPA 1V5UA 1XD4A 3LJUX 2CRFA 3NSUA 2G35A 4CSQA 3ML4A 1BAKA 1N3HA 2R2YA 2ELBA 4B6HA 1H4RA 1XCGA 5HE1A 2D9XA 3GYOA 1V88A 1TJ6A 2DLWA 1EF1A 1KI1B 4A5KA 1X1FA 3TVVA 2DHJA 1XX0A 4H8SA 2J0KA 2MKRA 4QJ3B 5L81A 2ZKMX 2FJLA 1DDMA 1QC6A 2Z0OA 4F7GA 1GC6A 2RSGA 5D27A 1NTVA 1RJ2A 5FI0A 1I7AA 4HB3B 2M38A 4OT1A 2RRFA 2GCLA 2J0JA 2EJ8A 1U5FA 4HAWB 2PZ1A 3PZDA 2KUPA 2BCJA 3D8EA 4K2OA 2QKLA 2DN6A 1AQCA 4A6FA 1LW3A 1PMSA 4KHAA 2OQBA 2W2XD 1UPQA 1OMWA 4HSIA 1DDVA 4CHJA 3ODWA 3QWMA 2LYDA 3KY9A 2Y8GA 2D2QA 2DA0A 1IRSA 4HAYB 3FVCA 4PNKA 1E5WA 4GPTB 5HE2A 1NI2A 3GYPA 4GNKB 2KR0A 3SYXA 2COAA 5LONB 1W1HA 2IFSA 4DX90 2N0YA 4NY0A 4DXAB 1MPHA 1LB1A 4QJ4B 3BINA 4GMVA 4GXBA 4EKUA 1DBHA 2DTCA 3TW1A 1U5GA 3GF9A 3X23A 1ZVRA 2COCA 2CAYA 2YVCA 2DYQA 1QQGA 5C6RA 3U12A 3T06A 5I2MA 2D9YA 2UZRA 1WG7A 4HAZB 3DXDA 5D3XA 2DKQA 4TKNA 1EAZA 2EMSA 4GN1A 3FM8C 2COFA 2J0MA 4EJNA 4ZRIA 1V5PA 2ELAA 1FHOA 2KUQA 2Z14A 5J3YA 2KGXB 4A6FB 2MDXA 2KIEA 4HHVA 3PVUA 1H10A 4IAPA 3VOQA 4QJ5B 1B55A 2KIGA 3PG7A 3U7DA 2KCJA 5DHAB 3P6AA 4WSFA 1U5DA 2ZPYA 3DCXA 2I1KA 5C5BA 3ZDTA 4HAXB 1EGXA 1XKEA 2KR9A 1MI1A 1WJMA 1ZYIA 2NZ8B 2K00A 2R09A 3B77A 2YS1A 2J59M 4EMOA 3QBVB 5DI9B 2VSZA 1UNQA 2Z59A 3SV1A 1RRPB 3JV3A 4K2PA 1U5EA 2L1CA 3CXBB 4XWXA 1AWEA 2ROZB 4KHBA 2Z13A 2DFKA 1U2BA 5DIFB 3HW2B 2GJYA 1UEFA 2E2XA 1F5XA 2LOZA 1P6SA 2D9WA 3V5WA 5JP4A 4A6KA 5KCVA 2M14A 3UZTA 1FHWA 2W2WA 3O96A 2QKMA 5FI1A 5C16A 1EVHA 3OANA 4HDQA 1WGQA 4HB0B 5EFXA 2GS0A 5HE3A 2GCJA 2DHKA 3TCAA 2UZSA 1X05A 3PSCA 3M1IB 2RLOA 1UNRA 3G9WA 4WJ7A 1OQNA 2H7EA 4HAVB 4HB4B 3ULCA 1U29A 5JHHA 2VKIA 2HE7A 5M4YB 3KRXA 2P0HA 4Y94A 1MK7B 1K5GB 3TFMA 3NWFA 2N23A 3AU5A 1SGHA 2YS3A 1FOEA 1T77A 2D9ZA 2AL6A 2NBVA 5DH9B 4NSWA 3A8PA 5C5BB 4IOYX
chains in the Genus database with same CATH topology
4HB2B 1UNPA 1J0WA 1X86A 4KAXB 3WYFB 4YONA 2DHIA 3KSYA 3HQCA 4PQ0A 1X1GA 1NTYA 2I1JA 3FEHA 1M7RA 1BTNA 3N7CA 2W2XC 4DX8A 2LOXA 1W1DA 4D0OA 4KHBB 1J19A 3EO2A 1WI1A 2P0FA 1DYNA 1I2HA 5D3VA 2EC1A 2Y7BA 1ZM0A 4C0AA 3FSSA 4HAUB 3F5RA 2HTHB 4MY6A 1BTKA 5JHGA 4L6EA 1V5MA 2CY5A 3PP2A 1WGUA 4A6HA 2D4QA 5KQ1A 4WVFB 1GG3A 3PVWA 2Y8FA 5DHFB 4CYEA 2YSZA 3PVLA 1P5TA 3ODXA 4DBBA 2NMBA 1GC7A 4HATB 2LG1A 3QIJA 2XQNM 3TO1A 3ULBA 5HE0A 3DXCA 5KQ4A 4BBKA 3D8DA 1FGYA 4F7UP 1Q67A 3ODOA 1U27A 1FHXA 1X11A 1ZC4B 2ADZA 4ZRKA 1MIXA 2K2JA 2Q13A 3MDBC 1FGZA 2Z0QA 2Z0PA 4D0NB 2YS5A 4GOUA 2LULA 4IFSA 1V89A 4HDOA 3F0WA 2CY4A 1DDWA 2D10A 2D11A 1UPRA 2CODA 2MFQA 2MWNB 4KHOA 1BY1A 3BJIA 2X18A 1OY2A 2YF0A 1XODA 5JLJB 4K81A 1TXDA 2DX1A 3U8ZA 1WJ1A 1M7EA 4P7IA 1P3RA 2JP2A 4MK0A 5CLQB 2IYBA 1V61A 3DXEA 2P0DA 1FB8A 1Y5OA 1NU2A 5D3WA 4CHMA 3P7ZA 4ZRJA 5J3TA 2I5FA 3KRWA 1MK9B 3D8FA 5LOPB 4GZUA 5CLLB 4GMXB 3MPXA 3VIAA 3ZVRA 4K17A 1Z87A 2UVMA 1XR0B 4Z2NA 4GYVA 2RUKB 3AJ4A 2EMTA 1ISNA 5D3YA 4MT7A 4F7HA 1KZGA 2D9VA 2YRYA 3SUZA 5J3QA 4YL8A 5GOWB 1DROA 2RVBB 2L2IA 5C79A 1MKEA 3AU4A 1W1GA 4KVGB 3HK0A 3IVFA 2ROVA 1KZ7A 1PLSA 4Z2MB 1MAIA 3SO6A 2RGNB 1Y19B 2VRWB 2AEHA 2P8VA 2H7DA 2I5CA 2DYNA 2DX5A 1K5DB 2YT1A 3CIKA 1ZSQA 3RCPA 3A98B 1FAOA 2RNRB 1PFJA 1WVHA 2LKOA 2YT0A 4TYZA 1TQZA 2V76A 2R0DA 1MIZB 3SNHA 3KZ1A 1SHCA 3PEGA 1ZC3B 2K2UA 1BWNA 2OTXA 3A8QA 3WA0A 2DKPA 1V5UA 1XD4A 3LJUX 2CRFA 3NSUA 2G35A 3ML4A 1BAKA 1N3HA 2ELBA 4B6HA 1H4RA 1XCGA 5HE1A 2D9XA 3GYOA 1V88A 1TJ6A 2DLWA 1EF1A 1KI1B 4A5KA 1X1FA 3TVVA 2DHJA 1XX0A 4H8SA 2J0KA 2MKRA 5L81A 2FJLA 1DDMA 1QC6A 2Z0OA 4F7GA 1GC6A 2RSGA 5D27A 1NTVA 1RJ2A 5FI0A 1I7AA 4HB3B 2M38A 2GCLA 2J0JA 2EJ8A 1U5FA 4HAWB 2PZ1A 3PZDA 2KUPA 2BCJA 3D8EA 4K2OA 2QKLA 2DN6A 1AQCA 4A6FA 1LW3A 1PMSA 4KHAA 2OQBA 2W2XD 1UPQA 1OMWA 1DDVA 4CHJA 3ODWA 3QWMA 2LYDA 3KY9A 2Y8GA 2D2QA 2DA0A 1IRSA 4HAYB 4PNKA 1E5WA 4GPTB 5HE2A 1NI2A 3GYPA 3SYXA 2COAA 5LONB 1W1HA 2IFSA 4DX90 2N0YA 4NY0A 4DXAB 1MPHA 1LB1A 3BINA 4GMVA 4GXBA 4EKUA 1DBHA 2DTCA 3TW1A 1U5GA 3GF9A 3X23A 1ZVRA 2COCA 2CAYA 2YVCA 2DYQA 1QQGA 5C6RA 3T06A 2D9YA 2UZRA 1WG7A 4HAZB 3DXDA 5D3XA 2DKQA 4TKNA 1EAZA 2EMSA 4GN1A 3FM8C 2COFA 2J0MA 4EJNA 4ZRIA 1V5PA 2ELAA 1FHOA 5J3YA 2KGXB 4A6FB 2MDXA 4HHVA 3PVUA 1H10A 4IAPA 3VOQA 1B55A 3PG7A 3U7DA 2KCJA 5DHAB 3P6AA 4WSFA 1U5DA 2ZPYA 2I1KA 5C5BA 3ZDTA 4HAXB 1EGXA 1XKEA 2KR9A 1WJMA 2NZ8B 2K00A 2R09A 4EMOA 2YS1A 2J59M 3QBVB 5DI9B 2VSZA 1UNQA 3SV1A 1RRPB 3JV3A 4K2PA 1U5EA 2L1CA 3CXBB 4XWXA 1AWEA 2ROZB 2DFKA 1U2BA 5DIFB 3HW2B 2GJYA 1UEFA 2E2XA 1F5XA 2LOZA 1P6SA 2D9WA 3V5WA 5JP4A 4A6KA 5KCVA 2M14A 3UZTA 1FHWA 2W2WA 3O96A 2QKMA 5FI1A 5C16A 1EVHA 3OANA 4HDQA 1WGQA 4HB0B 5EFXA 2GS0A 5HE3A 2GCJA 2DHKA 3TCAA 2UZSA 1X05A 3PSCA 3M1IB 2RLOA 1UNRA 3G9WA 4WJ7A 1OQNA 2H7EA 4HAVB 4HB4B 3ULCA 1U29A 5JHHA 2VKIA 2HE7A 3KRXA 2P0HA 4Y94A 1MK7B 1K5GB 3TFMA 2N23A 3AU5A 1SGHA 2YS3A 1FOEA 2D9ZA 2AL6A 5DH9B 4NSWA 3A8PA 5C5BB 4IOYX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HB2 B;  1UNP A;  1J0W A;  1X86 A;  4KAX B;  3WYF B;  4YON A;  2DHI A;  3KSY A;  3HQC A;  4PQ0 A;  1X1G A;  1NTY A;  2I1J A;  3FEH A;  1M7R A;  1BTN A;  3N7C A;  2W2X C;  4DX8 A;  2LOX A;  1W1D A;  4D0O A;  4KHB B;  1J19 A;  3EO2 A;  1WI1 A;  2P0F A;  1DYN A;  1I2H A;  5D3V A;  2EC1 A;  2Y7B A;  1ZM0 A;  4C0A A;  3FSS A;  4HAU B;  3F5R A;  2HTH B;  4MY6 A;  1BTK A;  5JHG A;  4L6E A;  1V5M A;  2CY5 A;  3PP2 A;  1WGU A;  4A6H A;  2D4Q A;  5KQ1 A;  4WVF B;  1GG3 A;  3PVW A;  2Y8F A;  5DHF B;  4CYE A;  2YSZ A;  3PVL A;  1P5T A;  3ODX A;  4DBB A;  2NMB A;  1GC7 A;  4HAT B;  2LG1 A;  3QIJ A;  2XQN M;  3TO1 A;  3ULB A;  5HE0 A;  3DXC A;  5KQ4 A;  4BBK A;  3D8D A;  1FGY A;  4F7U P;  1Q67 A;  3ODO A;  1U27 A;  1FHX A;  1X11 A;  1ZC4 B;  2ADZ A;  4ZRK A;  1MIX A;  2K2J A;  2Q13 A;  3MDB C;  1FGZ A;  2Z0Q A;  2Z0P A;  4D0N B;  2YS5 A;  4GOU A;  2LUL A;  4IFS A;  1V89 A;  4HDO A;  3F0W A;  2CY4 A;  1DDW A;  2D10 A;  2D11 A;  1UPR A;  2COD A;  2MFQ A;  2MWN B;  4KHO A;  1BY1 A;  3BJI A;  2X18 A;  1OY2 A;  2YF0 A;  1XOD A;  5JLJ B;  4K81 A;  1TXD A;  2DX1 A;  3U8Z A;  1WJ1 A;  1M7E A;  4P7I A;  1P3R A;  2JP2 A;  4MK0 A;  5CLQ B;  2IYB A;  1V61 A;  3DXE A;  2P0D A;  1FB8 A;  1Y5O A;  1NU2 A;  5D3W A;  4CHM A;  3P7Z A;  4ZRJ A;  5J3T A;  2I5F A;  3KRW A;  1MK9 B;  3D8F A;  5LOP B;  4GZU A;  5CLL B;  4GMX B;  3MPX A;  3VIA A;  3ZVR A;  4K17 A;  1Z87 A;  2UVM A;  1XR0 B;  4Z2N A;  4GYV A;  2RUK B;  3AJ4 A;  2EMT A;  1ISN A;  5D3Y A;  4MT7 A;  4F7H A;  1KZG A;  2D9V A;  2YRY A;  3SUZ A;  5J3Q A;  4YL8 A;  5GOW B;  1DRO A;  2RVB B;  2L2I A;  5C79 A;  1MKE A;  3AU4 A;  1W1G A;  4KVG B;  3HK0 A;  3IVF A;  2ROV A;  1KZ7 A;  1PLS A;  4Z2M B;  1MAI A;  3SO6 A;  2RGN B;  1Y19 B;  2VRW B;  2AEH A;  2P8V A;  2H7D A;  2I5C A;  2DYN A;  2DX5 A;  1K5D B;  2YT1 A;  3CIK A;  1ZSQ A;  3RCP A;  3A98 B;  1FAO A;  2RNR B;  1PFJ A;  1WVH A;  2LKO A;  2YT0 A;  4TYZ A;  1TQZ A;  2V76 A;  2R0D A;  1MIZ B;  3SNH A;  3KZ1 A;  1SHC A;  3PEG A;  1ZC3 B;  2K2U A;  1BWN A;  2OTX A;  3A8Q A;  3WA0 A;  2DKP A;  1V5U A;  1XD4 A;  3LJU X;  2CRF A;  3NSU A;  2G35 A;  3ML4 A;  1BAK A;  1N3H A;  2ELB A;  4B6H A;  1H4R A;  1XCG A;  5HE1 A;  2D9X A;  3GYO A;  1V88 A;  1TJ6 A;  2DLW A;  1EF1 A;  1KI1 B;  4A5K A;  1X1F A;  3TVV A;  2DHJ A;  1XX0 A;  4H8S A;  2J0K A;  2MKR A;  5L81 A;  2FJL A;  1DDM A;  1QC6 A;  2Z0O A;  4F7G A;  1GC6 A;  2RSG A;  5D27 A;  1NTV A;  1RJ2 A;  5FI0 A;  1I7A A;  4HB3 B;  2M38 A;  2GCL A;  2J0J A;  2EJ8 A;  1U5F A;  4HAW B;  2PZ1 A;  3PZD A;  2KUP A;  2BCJ A;  3D8E A;  4K2O A;  2QKL A;  2DN6 A;  1AQC A;  4A6F A;  1LW3 A;  1PMS A;  4KHA A;  2OQB A;  2W2X D;  1UPQ A;  1OMW A;  1DDV A;  4CHJ A;  3ODW A;  3QWM A;  2LYD A;  3KY9 A;  2Y8G A;  2D2Q A;  2DA0 A;  1IRS A;  4HAY B;  4PNK A;  1E5W A;  4GPT B;  5HE2 A;  1NI2 A;  3GYP A;  3SYX A;  2COA A;  5LON B;  1W1H A;  2IFS A;  4DX9 0;  2N0Y A;  4NY0 A;  4DXA B;  1MPH A;  1LB1 A;  3BIN A;  4GMV A;  4GXB A;  4EKU A;  1DBH A;  2DTC A;  3TW1 A;  1U5G A;  3GF9 A;  3X23 A;  1ZVR A;  2COC A;  2CAY A;  2YVC A;  2DYQ A;  1QQG A;  5C6R A;  3T06 A;  2D9Y A;  2UZR A;  1WG7 A;  4HAZ B;  3DXD A;  5D3X A;  2DKQ A;  4TKN A;  1EAZ A;  2EMS A;  4GN1 A;  3FM8 C;  2COF A;  2J0M A;  4EJN A;  4ZRI A;  1V5P A;  2ELA A;  1FHO A;  5J3Y A;  2KGX B;  4A6F B;  2MDX A;  4HHV A;  3PVU A;  1H10 A;  4IAP A;  3VOQ A;  1B55 A;  3PG7 A;  3U7D A;  2KCJ A;  5DHA B;  3P6A A;  4WSF A;  1U5D A;  2ZPY A;  2I1K A;  5C5B A;  3ZDT A;  4HAX B;  1EGX A;  1XKE A;  2KR9 A;  1WJM A;  2NZ8 B;  2K00 A;  2R09 A;  4EMO A;  2YS1 A;  2J59 M;  3QBV B;  5DI9 B;  2VSZ A;  1UNQ A;  3SV1 A;  1RRP B;  3JV3 A;  4K2P A;  1U5E A;  2L1C A;  3CXB B;  4XWX A;  1AWE A;  2ROZ B;  2DFK A;  1U2B A;  5DIF B;  3HW2 B;  2GJY A;  1UEF A;  2E2X A;  1F5X A;  2LOZ A;  1P6S A;  2D9W A;  3V5W A;  5JP4 A;  4A6K A;  5KCV A;  2M14 A;  3UZT A;  1FHW A;  2W2W A;  3O96 A;  2QKM A;  5FI1 A;  5C16 A;  1EVH A;  3OAN A;  4HDQ A;  1WGQ A;  4HB0 B;  5EFX A;  2GS0 A;  5HE3 A;  2GCJ A;  2DHK A;  3TCA A;  2UZS A;  1X05 A;  3PSC A;  3M1I B;  2RLO A;  1UNR A;  3G9W A;  4WJ7 A;  1OQN A;  2H7E A;  4HAV B;  4HB4 B;  3ULC A;  1U29 A;  5JHH A;  2VKI A;  2HE7 A;  3KRX A;  2P0H A;  4Y94 A;  1MK7 B;  1K5G B;  3TFM A;  2N23 A;  3AU5 A;  1SGH A;  2YS3 A;  1FOE A;  2D9Z A;  2AL6 A;  5DH9 B;  4NSW A;  3A8P A;  5C5B B;  4IOY X; 
#chains in the Genus database with same CATH topology
 4HB2 B;  1UNP A;  1J0W A;  1X86 A;  4KAX B;  3WYF B;  4YON A;  2DHI A;  3KSY A;  3HQC A;  4PQ0 A;  1X1G A;  1NTY A;  2I1J A;  3FEH A;  1M7R A;  1BTN A;  3N7C A;  2W2X C;  4DX8 A;  3OHM B;  2LOX A;  1W1D A;  4D0O A;  4KHB B;  1J19 A;  3EO2 A;  1WI1 A;  2P0F A;  1DYN A;  1I2H A;  5D3V A;  2EC1 A;  4DIX A;  2Y7B A;  1ZM0 A;  4C0A A;  3FSS A;  4HAU B;  2GUM A;  4L1R A;  3F5R A;  2HTH B;  4MY6 A;  1BTK A;  5JHG A;  4L6E A;  1V5M A;  2CY5 A;  3NWA A;  3PP2 A;  1WGU A;  4A6H A;  2D4Q A;  5KQ1 A;  4WVF B;  1GG3 A;  3PVW A;  2Y8F A;  4QXA B;  5DHF B;  4CYE A;  2YSZ A;  3PVL A;  1P5T A;  3ODX A;  4DBB A;  2NMB A;  1GC7 A;  4HAT B;  2FJU B;  2LG1 A;  3NW8 A;  3QIJ A;  2XQN M;  3TO1 A;  2K8E A;  3ULB A;  5HE0 A;  3DXC A;  5KQ4 A;  4BBK A;  3D8D A;  1FGY A;  4F7U P;  1Q67 A;  3ODO A;  1U27 A;  1FHX A;  1X11 A;  1ZC4 B;  2ADZ A;  4ZRK A;  4D6W A;  1MIX A;  2K2J A;  2Q13 A;  3MDB C;  1FGZ A;  2Z0Q A;  2Z0P A;  4D0N B;  2YS5 A;  4GOU A;  2LUL A;  4IFS A;  1V89 A;  4HDO A;  3F0W A;  2CY4 A;  1DDW A;  2D10 A;  2D11 A;  1UPR A;  2COD A;  2MFQ A;  2MWN B;  4KHO A;  1BY1 A;  3BJI A;  2X18 A;  1OY2 A;  2YF0 A;  1XOD A;  5JLJ B;  4K81 A;  1TXD A;  2K49 A;  2DX1 A;  3U8Z A;  1WJ1 A;  1M7E A;  4P7I A;  1P3R A;  2JP2 A;  4MK0 A;  4OSN A;  5CLQ B;  2IYB A;  3NWD A;  1V61 A;  3DXE A;  2P0D A;  1FB8 A;  1Y5O A;  1NU2 A;  5D3W A;  3A58 A;  4CHM A;  5I2S A;  3P7Z A;  3HSA A;  4ZRJ A;  5J3T A;  2I5F A;  3KRW A;  1MK9 B;  3D8F A;  5LOP B;  4GZU A;  5CLL B;  5IRS A;  4GMX B;  3MPX A;  3VIA A;  3ZVR A;  4K17 A;  1Z87 A;  2UVM A;  1XR0 B;  4Z2N A;  4GYV A;  2RUK B;  3AJ4 A;  2EMT A;  1ISN A;  5D3Y A;  4MT7 A;  4F7H A;  1KZG A;  2D9V A;  2YRY A;  3SUZ A;  5J3Q A;  4YL8 A;  5GOW B;  1DRO A;  2RVB B;  2L2I A;  5C79 A;  1MKE A;  3AU4 A;  1W1G A;  4KVG B;  5LG4 B;  3HK0 A;  3IVF A;  2ROV A;  1KZ7 A;  1PLS A;  4Z2M B;  1MAI A;  3SO6 A;  2RGN B;  1Y19 B;  2VRW B;  2AEH A;  2P8V A;  2H7D A;  2I5C A;  3HIE A;  2DYN A;  2DX5 A;  1K5D B;  2YT1 A;  3CIK A;  2Z4D A;  1ZSQ A;  3RCP A;  3A98 B;  1FAO A;  2RNR B;  1PFJ A;  1WVH A;  2LKO A;  2YT0 A;  4TYZ A;  1TQZ A;  2YT2 A;  2V76 A;  2R0D A;  1MIZ B;  3SNH A;  3KZ1 A;  1SHC A;  3PEG A;  1ZC3 B;  2K2U A;  1BWN A;  2OTX A;  3A8Q A;  3WA0 A;  2DKP A;  1V5U A;  1XD4 A;  3LJU X;  2CRF A;  3NSU A;  2G35 A;  4CSQ A;  3ML4 A;  1BAK A;  1N3H A;  2R2Y A;  2ELB A;  4B6H A;  1H4R A;  1XCG A;  5HE1 A;  2D9X A;  3GYO A;  1V88 A;  1TJ6 A;  2DLW A;  1EF1 A;  1KI1 B;  4A5K A;  1X1F A;  3TVV A;  2DHJ A;  1XX0 A;  4H8S A;  2J0K A;  2MKR A;  4QJ3 B;  5L81 A;  2ZKM X;  2FJL A;  1DDM A;  1QC6 A;  2Z0O A;  4F7G A;  1GC6 A;  2RSG A;  5D27 A;  1NTV A;  1RJ2 A;  5FI0 A;  1I7A A;  4HB3 B;  2M38 A;  4OT1 A;  2RRF A;  2GCL A;  2J0J A;  2EJ8 A;  1U5F A;  4HAW B;  2PZ1 A;  3PZD A;  2KUP A;  2BCJ A;  3D8E A;  4K2O A;  2QKL A;  2DN6 A;  1AQC A;  4A6F A;  1LW3 A;  1PMS A;  4KHA A;  2OQB A;  2W2X D;  1UPQ A;  1OMW A;  4HSI A;  1DDV A;  4CHJ A;  3ODW A;  3QWM A;  2LYD A;  3KY9 A;  2Y8G A;  2D2Q A;  2DA0 A;  1IRS A;  4HAY B;  3FVC A;  4PNK A;  1E5W A;  4GPT B;  5HE2 A;  1NI2 A;  3GYP A;  4GNK B;  2KR0 A;  3SYX A;  2COA A;  5LON B;  1W1H A;  2IFS A;  4DX9 0;  2N0Y A;  4NY0 A;  4DXA B;  1MPH A;  1LB1 A;  4QJ4 B;  3BIN A;  4GMV A;  4GXB A;  4EKU A;  1DBH A;  2DTC A;  3TW1 A;  1U5G A;  3GF9 A;  3X23 A;  1ZVR A;  2COC A;  2CAY A;  2YVC A;  2DYQ A;  1QQG A;  5C6R A;  3U12 A;  3T06 A;  5I2M A;  2D9Y A;  2UZR A;  1WG7 A;  4HAZ B;  3DXD A;  5D3X A;  2DKQ A;  4TKN A;  1EAZ A;  2EMS A;  4GN1 A;  3FM8 C;  2COF A;  2J0M A;  4EJN A;  4ZRI A;  1V5P A;  2ELA A;  1FHO A;  2KUQ A;  2Z14 A;  5J3Y A;  2KGX B;  4A6F B;  2MDX A;  2KIE A;  4HHV A;  3PVU A;  1H10 A;  4IAP A;  3VOQ A;  4QJ5 B;  1B55 A;  2KIG A;  3PG7 A;  3U7D A;  2KCJ A;  5DHA B;  3P6A A;  4WSF A;  1U5D A;  2ZPY A;  3DCX A;  2I1K A;  5C5B A;  3ZDT A;  4HAX B;  1EGX A;  1XKE A;  2KR9 A;  1MI1 A;  1WJM A;  1ZYI A;  2NZ8 B;  2K00 A;  2R09 A;  3B77 A;  2YS1 A;  2J59 M;  4EMO A;  3QBV B;  5DI9 B;  2VSZ A;  1UNQ A;  2Z59 A;  3SV1 A;  1RRP B;  3JV3 A;  4K2P A;  1U5E A;  2L1C A;  3CXB B;  4XWX A;  1AWE A;  2ROZ B;  4KHB A;  2Z13 A;  2DFK A;  1U2B A;  5DIF B;  3HW2 B;  2GJY A;  1UEF A;  2E2X A;  1F5X A;  2LOZ A;  1P6S A;  2D9W A;  3V5W A;  5JP4 A;  4A6K A;  5KCV A;  2M14 A;  3UZT A;  1FHW A;  2W2W A;  3O96 A;  2QKM A;  5FI1 A;  5C16 A;  1EVH A;  3OAN A;  4HDQ A;  1WGQ A;  4HB0 B;  5EFX A;  2GS0 A;  5HE3 A;  2GCJ A;  2DHK A;  3TCA A;  2UZS A;  1X05 A;  3PSC A;  3M1I B;  2RLO A;  1UNR A;  3G9W A;  4WJ7 A;  1OQN A;  2H7E A;  4HAV B;  4HB4 B;  3ULC A;  1U29 A;  5JHH A;  2VKI A;  2HE7 A;  5M4Y B;  3KRX A;  2P0H A;  4Y94 A;  1MK7 B;  1K5G B;  3TFM A;  3NWF A;  2N23 A;  3AU5 A;  1SGH A;  2YS3 A;  1FOE A;  1T77 A;  2D9Z A;  2AL6 A;  2NBV A;  5DH9 B;  4NSW A;  3A8P A;  5C5B B;  4IOY X; 
#chains in the Genus database with same CATH homology
 4HB2 B;  1UNP A;  1J0W A;  1X86 A;  4KAX B;  3WYF B;  4YON A;  2DHI A;  3KSY A;  3HQC A;  4PQ0 A;  1X1G A;  1NTY A;  2I1J A;  3FEH A;  1M7R A;  1BTN A;  3N7C A;  2W2X C;  4DX8 A;  2LOX A;  1W1D A;  4D0O A;  4KHB B;  1J19 A;  3EO2 A;  1WI1 A;  2P0F A;  1DYN A;  1I2H A;  5D3V A;  2EC1 A;  2Y7B A;  1ZM0 A;  4C0A A;  3FSS A;  4HAU B;  3F5R A;  2HTH B;  4MY6 A;  1BTK A;  5JHG A;  4L6E A;  1V5M A;  2CY5 A;  3PP2 A;  1WGU A;  4A6H A;  2D4Q A;  5KQ1 A;  4WVF B;  1GG3 A;  3PVW A;  2Y8F A;  5DHF B;  4CYE A;  2YSZ A;  3PVL A;  1P5T A;  3ODX A;  4DBB A;  2NMB A;  1GC7 A;  4HAT B;  2LG1 A;  3QIJ A;  2XQN M;  3TO1 A;  3ULB A;  5HE0 A;  3DXC A;  5KQ4 A;  4BBK A;  3D8D A;  1FGY A;  4F7U P;  1Q67 A;  3ODO A;  1U27 A;  1FHX A;  1X11 A;  1ZC4 B;  2ADZ A;  4ZRK A;  1MIX A;  2K2J A;  2Q13 A;  3MDB C;  1FGZ A;  2Z0Q A;  2Z0P A;  4D0N B;  2YS5 A;  4GOU A;  2LUL A;  4IFS A;  1V89 A;  4HDO A;  3F0W A;  2CY4 A;  1DDW A;  2D10 A;  2D11 A;  1UPR A;  2COD A;  2MFQ A;  2MWN B;  4KHO A;  1BY1 A;  3BJI A;  2X18 A;  1OY2 A;  2YF0 A;  1XOD A;  5JLJ B;  4K81 A;  1TXD A;  2DX1 A;  3U8Z A;  1WJ1 A;  1M7E A;  4P7I A;  1P3R A;  2JP2 A;  4MK0 A;  5CLQ B;  2IYB A;  1V61 A;  3DXE A;  2P0D A;  1FB8 A;  1Y5O A;  1NU2 A;  5D3W A;  4CHM A;  3P7Z A;  4ZRJ A;  5J3T A;  2I5F A;  3KRW A;  1MK9 B;  3D8F A;  5LOP B;  4GZU A;  5CLL B;  4GMX B;  3MPX A;  3VIA A;  3ZVR A;  4K17 A;  1Z87 A;  2UVM A;  1XR0 B;  4Z2N A;  4GYV A;  2RUK B;  3AJ4 A;  2EMT A;  1ISN A;  5D3Y A;  4MT7 A;  4F7H A;  1KZG A;  2D9V A;  2YRY A;  3SUZ A;  5J3Q A;  4YL8 A;  5GOW B;  1DRO A;  2RVB B;  2L2I A;  5C79 A;  1MKE A;  3AU4 A;  1W1G A;  4KVG B;  3HK0 A;  3IVF A;  2ROV A;  1KZ7 A;  1PLS A;  4Z2M B;  1MAI A;  3SO6 A;  2RGN B;  1Y19 B;  2VRW B;  2AEH A;  2P8V A;  2H7D A;  2I5C A;  2DYN A;  2DX5 A;  1K5D B;  2YT1 A;  3CIK A;  1ZSQ A;  3RCP A;  3A98 B;  1FAO A;  2RNR B;  1PFJ A;  1WVH A;  2LKO A;  2YT0 A;  4TYZ A;  1TQZ A;  2V76 A;  2R0D A;  1MIZ B;  3SNH A;  3KZ1 A;  1SHC A;  3PEG A;  1ZC3 B;  2K2U A;  1BWN A;  2OTX A;  3A8Q A;  3WA0 A;  2DKP A;  1V5U A;  1XD4 A;  3LJU X;  2CRF A;  3NSU A;  2G35 A;  3ML4 A;  1BAK A;  1N3H A;  2ELB A;  4B6H A;  1H4R A;  1XCG A;  5HE1 A;  2D9X A;  3GYO A;  1V88 A;  1TJ6 A;  2DLW A;  1EF1 A;  1KI1 B;  4A5K A;  1X1F A;  3TVV A;  2DHJ A;  1XX0 A;  4H8S A;  2J0K A;  2MKR A;  5L81 A;  2FJL A;  1DDM A;  1QC6 A;  2Z0O A;  4F7G A;  1GC6 A;  2RSG A;  5D27 A;  1NTV A;  1RJ2 A;  5FI0 A;  1I7A A;  4HB3 B;  2M38 A;  2GCL A;  2J0J A;  2EJ8 A;  1U5F A;  4HAW B;  2PZ1 A;  3PZD A;  2KUP A;  2BCJ A;  3D8E A;  4K2O A;  2QKL A;  2DN6 A;  1AQC A;  4A6F A;  1LW3 A;  1PMS A;  4KHA A;  2OQB A;  2W2X D;  1UPQ A;  1OMW A;  1DDV A;  4CHJ A;  3ODW A;  3QWM A;  2LYD A;  3KY9 A;  2Y8G A;  2D2Q A;  2DA0 A;  1IRS A;  4HAY B;  4PNK A;  1E5W A;  4GPT B;  5HE2 A;  1NI2 A;  3GYP A;  3SYX A;  2COA A;  5LON B;  1W1H A;  2IFS A;  4DX9 0;  2N0Y A;  4NY0 A;  4DXA B;  1MPH A;  1LB1 A;  3BIN A;  4GMV A;  4GXB A;  4EKU A;  1DBH A;  2DTC A;  3TW1 A;  1U5G A;  3GF9 A;  3X23 A;  1ZVR A;  2COC A;  2CAY A;  2YVC A;  2DYQ A;  1QQG A;  5C6R A;  3T06 A;  2D9Y A;  2UZR A;  1WG7 A;  4HAZ B;  3DXD A;  5D3X A;  2DKQ A;  4TKN A;  1EAZ A;  2EMS A;  4GN1 A;  3FM8 C;  2COF A;  2J0M A;  4EJN A;  4ZRI A;  1V5P A;  2ELA A;  1FHO A;  5J3Y A;  2KGX B;  4A6F B;  2MDX A;  4HHV A;  3PVU A;  1H10 A;  4IAP A;  3VOQ A;  1B55 A;  3PG7 A;  3U7D A;  2KCJ A;  5DHA B;  3P6A A;  4WSF A;  1U5D A;  2ZPY A;  2I1K A;  5C5B A;  3ZDT A;  4HAX B;  1EGX A;  1XKE A;  2KR9 A;  1WJM A;  2NZ8 B;  2K00 A;  2R09 A;  4EMO A;  2YS1 A;  2J59 M;  3QBV B;  5DI9 B;  2VSZ A;  1UNQ A;  3SV1 A;  1RRP B;  3JV3 A;  4K2P A;  1U5E A;  2L1C A;  3CXB B;  4XWX A;  1AWE A;  2ROZ B;  2DFK A;  1U2B A;  5DIF B;  3HW2 B;  2GJY A;  1UEF A;  2E2X A;  1F5X A;  2LOZ A;  1P6S A;  2D9W A;  3V5W A;  5JP4 A;  4A6K A;  5KCV A;  2M14 A;  3UZT A;  1FHW A;  2W2W A;  3O96 A;  2QKM A;  5FI1 A;  5C16 A;  1EVH A;  3OAN A;  4HDQ A;  1WGQ A;  4HB0 B;  5EFX A;  2GS0 A;  5HE3 A;  2GCJ A;  2DHK A;  3TCA A;  2UZS A;  1X05 A;  3PSC A;  3M1I B;  2RLO A;  1UNR A;  3G9W A;  4WJ7 A;  1OQN A;  2H7E A;  4HAV B;  4HB4 B;  3ULC A;  1U29 A;  5JHH A;  2VKI A;  2HE7 A;  3KRX A;  2P0H A;  4Y94 A;  1MK7 B;  1K5G B;  3TFM A;  2N23 A;  3AU5 A;  1SGH A;  2YS3 A;  1FOE A;  2D9Z A;  2AL6 A;  5DH9 B;  4NSW A;  3A8P A;  5C5B B;  4IOY X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...