5L81A

Crystal structure of the ph domain of murine kindlin-3
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
133
structure length
133
Chain Sequence
SLTTIPELKDHLRIFRPRKLTLKGYRQYWVVFKDTTLSYYKSQDEAPGDPTQQLNLKGCEVVPDVNVSGQKFCIKLLVPSPEGMSEIYLRCQDEQQYAQWMAACRLASKGRTMADSSYASEVQAILAFLSLQR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Fermitin family homolog 3
publication title Structure and lipid-binding properties of the kindlin-3 pleckstrin homology domain.
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
total genus 31
structure length 133
sequence length 133
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 5l81A00
4MK0A 2D9YA 1OQNA 2AEHA 4DXAB 1MK7B 2COCA 3KSYA 5HE2A 1NTVA 1PMSA 1XODA 2YT0A 4Z2NA 4KAXB 2EMTA 4A5KA 1U5FA 3AJ4A 2DHIA 4A6FB 3M1IB 5JLJB 1KZ7A 4HDOA 2RLOA 2CY4A 3O96A 2J0MA 4GZUA 3V5WA 2Z0OA 2XQNM 1U5EA 4DX8A 4L6EA 1H10A 2G35A 3KZ1A 1ZSQA 1DDVA 4KVGB 1BAKA 4K81A 1EF1A 4HAUB 3BJIA 2GJYA 3T06A 3TCAA 1NU2A 4MT7A 2QKMA 1FAOA 3PEGA 5D27A 4K17A 3AU4A 4A6HA 2RUKB 1X05A 2IFSA 4EKUA 1J19A 2D4QA 4TYZA 1WJMA 2MFQA 2GCLA 2W2WA 1W1HA 5LOPB 5CLQB 2CAYA 4IAPA 2RVBB 3D8DA 2BCJA 1M7EA 4TKNA 2IYBA 5J3YA 2MKRA 2PZ1A 4GPTB 1QQGA 2VRWB 2YVCA 1EAZA 2E2XA 1Z87A 3UZTA 4K2OA 2D9ZA 5JP4A 1K5DB 1UNRA 1RJ2A 4CHJA 3A8PA 3AU5A 2K2UA 1BTNA 1X1GA 3IVFA 1KZGA 4HB3B 4EMOA 1WVHA 1PLSA 2KUPA 2R09A 4GXBA 2DKPA 1QC6A 1MKEA 1WGQA 2D11A 1W1GA 2Z0QA 2ELAA 2H7EA 2RNRB 3PVUA 1W1DA 1DROA 3TFMA 3GYPA 4KHBB 3TW1A 4NY0A 1U27A 1UNQA 1V5PA 2Y7BA 1BTKA 2DHJA 3P7ZA 4HAWB 3P6AA 5D3XA 2I1JA 4C0AA 1FB8A 3F0WA 3FSSA 3LJUX 3FEHA 4XWXA 5JHHA 2GCJA 1LB1A 2ADZA 2GS0A 1X86A 1ZC3B 5JHGA 1P5TA 1WGUA 5FI0A 2J59M 2KGXB 1I7AA 5DH9B 3ZDTA 1ISNA 2DX5A 1XX0A 3SNHA 3PSCA 3ODWA 5KQ4A 4Y94A 1FHXA 1AWEA 2L2IA 2N0YA 2R0DA 2M38A 4IOYX 4ZRJA 2LG1A 2D9WA 4BBKA 2V76A 2EJ8A 1RRPB 1Q67A 2ROZB 3KY9A 2YF0A 3SUZA 2K2JA 3MPXA 4MY6A 2CRFA 1X1FA 2NZ8B 1BWNA 2DHKA 2W2XD 4GMXB 3OANA 1WI1A 4ZRIA 1EGXA 3KRXA 2DX1A 3PZDA 2Q13A 1NI2A 4HAXB 3DXEA 5KCVA 1UNPA 2P0DA 4HB0B 3G9WA 4PNKA 1J0WA 1V89A 1TQZA 2RGNB 2D2QA 2N23A 4B6HA 3QIJA 1M7RA 4HDQA 2W2XC 1MAIA 1KI1B 5DHAB 2D9XA 3DXCA 1DBHA 2I5CA 1I2HA 5D3WA 1TXDA 1UEFA 4HAYB 1GC6A 3KRWA 3GYOA 4A6FA 2CODA 3PVLA 1MIZB 2P0HA 3NSUA 1N3HA 1UPRA 2RSGA 4K2PA 5HE1A 1U29A 4D0NB 2DYNA 3HQCA 2MDXA 3VIAA 4F7GA 5C6RA 3ULCA 3HW2B 3CIKA 3A98B 3U7DA 3D8FA 3PP2A 1ZM0A 5KQ1A 1DYNA 1E5WA 1FHWA 1U5GA 2L1CA 2DYQA 2UVMA 3D8EA 5EFXA 3ML4A 1WG7A 1GC7A 1X11A 2LOZA 2NMBA 2COAA 2JP2A 3A8QA 3MDBC 2ELBA 1V5MA 2OTXA 4HAZB 4WSFA 2Z0PA 3HK0A 2HE7A 2DA0A 5D3YA 5L81A 1ZC4B 2I5FA 3QBVB 2EC1A 1OY2A 2OQBA 1U5DA 1FGZA 4ZRKA 1NTYA 1P6SA 2DKQA 2UZSA 1V61A 4GMVA 4HB4B 4DX90 4HATB 4F7HA 5C79A 2YT1A 2MWNB 1FGYA 3FM8C 2Y8GA 2DN6A 3N7CA 3ZVRA 4F7UP 1Y19B 4Z2MB 4CHMA 3WA0A 1FHOA 1XR0B 5GOWB 4HAVB 1K5GB 2YS3A 3ODXA 3SO6A 2ZPYA 4KHOA 5C16A 4WJ7A 4H8SA 1SHCA 5C5BA 5HE3A 1DDMA 2I1KA 1EVHA 2K00A 2LOXA 1MPHA 3TVVA 1GG3A 4A6KA 2VKIA 2QKLA 3CXBB 2YSZA 5HE0A 4NSWA 4GN1A 2VSZA 5DIFB 3X23A 2D9VA 2J0JA 2J0KA 5CLLB 4WVFB 1PFJA 2X18A 4KHAA 5LONB 3BINA 2FJLA 1UPQA 2ROVA 4EJNA 4P7IA 2LULA 2YRYA 1XCGA 3WYFB 1V5UA 4HB2B 4CYEA 2AL6A 2DTCA 3RCPA 5DI9B 3DXDA 2LKOA 2P0FA 4IFSA 2D10A 5J3QA 1Y5OA 2HTHB 2COFA 1V88A 2EMSA 2YS5A 1B55A 4YONA 1MIXA 3PG7A 5DHFB 5J3TA 3ULBA 2M14A 1FOEA 2DLWA 2CY5A 2P8VA 4HHVA 1XD4A 3SYXA 1P3RA 1DDWA 5FI1A 1U2BA 1IRSA 1MK9B 1WJ1A 1XKEA 5D3VA 3QWMA 2LYDA 1LW3A 1ZVRA 1H4RA 2Y8FA 4DBBA 3TO1A 1AQCA 2DFKA 5C5BB 3ODOA 4YL8A 1TJ6A 2H7DA 1SGHA 3VOQA 2YS1A 4PQ0A 3U8ZA 3PVWA 2KCJA 3SV1A 1OMWA 2UZRA 3F5RA
chains in the Genus database with same CATH superfamily
4MK0A 2D9YA 1OQNA 2AEHA 4DXAB 5LG4B 1MK7B 2COCA 3KSYA 5HE2A 1NTVA 1PMSA 1XODA 2YT0A 4Z2NA 3NWDA 4KAXB 2EMTA 4A5KA 1U5FA 3AJ4A 2DHIA 4A6FB 3M1IB 5JLJB 1KZ7A 4HDOA 2RLOA 2CY4A 4KHBA 3O96A 2J0MA 4GZUA 3V5WA 2Z0OA 2XQNM 1U5EA 4DX8A 4L6EA 1H10A 2G35A 3KZ1A 1ZSQA 2GUMA 1DDVA 4KVGB 1BAKA 4K81A 1EF1A 4HAUB 3BJIA 2GJYA 3T06A 3TCAA 1NU2A 4MT7A 2QKMA 2KR0A 1FAOA 3PEGA 5D27A 4K17A 4QXAB 3AU4A 4A6HA 2RUKB 1X05A 2IFSA 4EKUA 1J19A 2D4QA 4TYZA 1WJMA 3FVCA 4OSNA 2MFQA 2GCLA 2W2WA 1W1HA 5LOPB 5CLQB 2CAYA 4IAPA 2RVBB 3D8DA 4CSQA 2BCJA 1M7EA 3NWAA 5I2SA 4TKNA 2IYBA 5J3YA 2MKRA 2PZ1A 4GPTB 1QQGA 2VRWB 2YVCA 1EAZA 2E2XA 1Z87A 3UZTA 4K2OA 2D9ZA 5JP4A 1K5DB 4QJ3B 1UNRA 1RJ2A 4CHJA 3A8PA 3AU5A 2K2UA 1BTNA 1X1GA 3IVFA 1KZGA 4HB3B 4EMOA 1WVHA 1PLSA 2KUPA 2R09A 4GXBA 3U12A 4GOUA 2DKPA 1QC6A 1MKEA 1WGQA 2D11A 1W1GA 2Z0QA 3OHMB 2ELAA 2H7EA 2Z14A 2RNRB 3PVUA 1W1DA 1DROA 3TFMA 3GYPA 4KHBB 3TW1A 4NY0A 2KIEA 1U27A 4OT1A 1UNQA 1V5PA 2Y7BA 1BTKA 2DHJA 3P7ZA 4HAWB 3P6AA 5D3XA 2I1JA 3NWFA 4C0AA 2Z4DA 1FB8A 3F0WA 3FSSA 3LJUX 3FEHA 4XWXA 5JHHA 2GCJA 1LB1A 2ADZA 2GS0A 1X86A 1ZC3B 5JHGA 1P5TA 1WGUA 4D6WA 5FI0A 2J59M 2KGXB 1I7AA 5DH9B 3ZDTA 1ISNA 2DX5A 1XX0A 3B77A 3SNHA 3PSCA 2R2YA 3ODWA 5KQ4A 4Y94A 1FHXA 1AWEA 2L2IA 2N0YA 2R0DA 2M38A 4IOYX 4ZRJA 2LG1A 2D9WA 4BBKA 4HSIA 2V76A 2EJ8A 1RRPB 1Q67A 2ROZB 3KY9A 2YF0A 3SUZA 2K2JA 3MPXA 1ZYIA 4MY6A 2CRFA 1X1FA 1MI1A 2NZ8B 1BWNA 2DHKA 2W2XD 4GMXB 3OANA 1WI1A 4ZRIA 1EGXA 3KRXA 2DX1A 3PZDA 2Q13A 1NI2A 4HAXB 3DXEA 5KCVA 1UNPA 2P0DA 4HB0B 3G9WA 4PNKA 1J0WA 1V89A 1TQZA 2RGNB 2D2QA 2N23A 4B6HA 3QIJA 1M7RA 4HDQA 2W2XC 1MAIA 2KIGA 1KI1B 5DHAB 2D9XA 3DXCA 1DBHA 2I5CA 1I2HA 5D3WA 1TXDA 1UEFA 4HAYB 1GC6A 3KRWA 3GYOA 4A6FA 2CODA 3PVLA 5I2MA 1MIZB 2P0HA 3NSUA 1N3HA 1UPRA 2RSGA 4K2PA 5HE1A 1U29A 4D0NB 2DYNA 3HQCA 2MDXA 3VIAA 4F7GA 5C6RA 3ULCA 3HW2B 3CIKA 3A98B 3U7DA 3D8FA 3DCXA 1ZM0A 3PP2A 5KQ1A 1DYNA 1E5WA 1FHWA 1U5GA 2L1CA 2Z13A 2DYQA 2UVMA 3D8EA 5EFXA 3ML4A 1WG7A 1GC7A 1X11A 3HIEA 2LOZA 2NBVA 2NMBA 2COAA 2JP2A 3A8QA 3MDBC 2ELBA 1V5MA 2OTXA 4HAZB 4WSFA 2Z0PA 3HK0A 2HE7A 2DA0A 5D3YA 5L81A 1ZC4B 2I5FA 3QBVB 3NW8A 2EC1A 1OY2A 2OQBA 1U5DA 1FGZA 4ZRKA 1NTYA 1P6SA 2DKQA 2UZSA 1V61A 4GMVA 4HB4B 2KUQA 4DX90 4HATB 5IRSA 4F7HA 5C79A 2YT1A 2MWNB 1FGYA 3FM8C 2Y8GA 2DN6A 3N7CA 4L1RA 3ZVRA 4F7UP 1Y19B 4DIXA 4Z2MB 4CHMA 3WA0A 1FHOA 5M4YB 1XR0B 5GOWB 4HAVB 1K5GB 2YS3A 3HSAA 3ODXA 3SO6A 2ZPYA 4KHOA 5C16A 4WJ7A 4H8SA 1SHCA 5C5BA 2Z59A 5HE3A 1DDMA 2I1KA 1EVHA 2K00A 2LOXA 1MPHA 3TVVA 1GG3A 4A6KA 2VKIA 2QKLA 3CXBB 2YSZA 5HE0A 4NSWA 4GN1A 2VSZA 4QJ4B 5DIFB 3X23A 2D9VA 2YT2A 2J0JA 2J0KA 5CLLB 4WVFB 1PFJA 2X18A 4KHAA 5LONB 3BINA 2FJLA 1UPQA 2ROVA 4EJNA 4P7IA 2LULA 2YRYA 1XCGA 3WYFB 1V5UA 4HB2B 4CYEA 2AL6A 2DTCA 3RCPA 5DI9B 3DXDA 3A58A 2FJUB 2LKOA 4GNKB 2P0FA 4IFSA 2D10A 5J3QA 1Y5OA 2HTHB 4QJ5B 2COFA 1V88A 2EMSA 2YS5A 1B55A 4YONA 1MIXA 3PG7A 5DHFB 5J3TA 3ULBA 2M14A 1FOEA 2DLWA 2CY5A 2K49A 2P8VA 4HHVA 1XD4A 3SYXA 2RRFA 1P3RA 1DDWA 5FI1A 1U2BA 1IRSA 1MK9B 1WJ1A 1XKEA 5D3VA 3QWMA 2LYDA 1LW3A 1ZVRA 1H4RA 2Y8FA 2ZKMX 4DBBA 3TO1A 1T77A 1AQCA 2DFKA 5C5BB 3ODOA 4YL8A 1TJ6A 2H7DA 1SGHA 2K8EA 3VOQA 2YS1A 4PQ0A 3U8ZA 3PVWA 2KCJA 3SV1A 1OMWA 2UZRA 3F5RA
chains in the Genus database with same CATH topology
4MK0A 2D9YA 1OQNA 2AEHA 4DXAB 1MK7B 2COCA 3KSYA 5HE2A 1NTVA 1PMSA 1XODA 2YT0A 4Z2NA 4KAXB 2EMTA 4A5KA 1U5FA 3AJ4A 2DHIA 4A6FB 3M1IB 5JLJB 1KZ7A 4HDOA 2RLOA 2CY4A 3O96A 2J0MA 4GZUA 3V5WA 2Z0OA 2XQNM 1U5EA 4DX8A 4L6EA 1H10A 2G35A 3KZ1A 1ZSQA 1DDVA 4KVGB 1BAKA 4K81A 1EF1A 4HAUB 3BJIA 2GJYA 3T06A 3TCAA 1NU2A 4MT7A 2QKMA 1FAOA 3PEGA 5D27A 4K17A 3AU4A 4A6HA 2RUKB 1X05A 2IFSA 4EKUA 1J19A 2D4QA 4TYZA 1WJMA 2MFQA 2GCLA 2W2WA 1W1HA 5LOPB 5CLQB 2CAYA 4IAPA 2RVBB 3D8DA 2BCJA 1M7EA 4TKNA 2IYBA 5J3YA 2MKRA 2PZ1A 4GPTB 1QQGA 2VRWB 2YVCA 1EAZA 2E2XA 1Z87A 3UZTA 4K2OA 2D9ZA 5JP4A 1K5DB 1UNRA 1RJ2A 4CHJA 3A8PA 3AU5A 2K2UA 1BTNA 1X1GA 3IVFA 1KZGA 4HB3B 4EMOA 1WVHA 1PLSA 2KUPA 2R09A 4GXBA 2DKPA 1QC6A 1MKEA 1WGQA 2D11A 1W1GA 2Z0QA 2ELAA 2H7EA 2RNRB 3PVUA 1W1DA 1DROA 3TFMA 3GYPA 4KHBB 3TW1A 4NY0A 1U27A 1UNQA 1V5PA 2Y7BA 1BTKA 2DHJA 3P7ZA 4HAWB 3P6AA 5D3XA 2I1JA 4C0AA 1FB8A 3F0WA 3FSSA 3LJUX 3FEHA 4XWXA 5JHHA 2GCJA 1LB1A 2ADZA 2GS0A 1X86A 1ZC3B 5JHGA 1P5TA 1WGUA 5FI0A 2J59M 2KGXB 1I7AA 5DH9B 3ZDTA 1ISNA 2DX5A 1XX0A 3SNHA 3PSCA 3ODWA 5KQ4A 4Y94A 1FHXA 1AWEA 2L2IA 2N0YA 2R0DA 2M38A 4IOYX 4ZRJA 2LG1A 2D9WA 4BBKA 2V76A 2EJ8A 1RRPB 1Q67A 2ROZB 3KY9A 2YF0A 3SUZA 2K2JA 3MPXA 4MY6A 2CRFA 1X1FA 2NZ8B 1BWNA 2DHKA 2W2XD 4GMXB 3OANA 1WI1A 4ZRIA 1EGXA 3KRXA 2DX1A 3PZDA 2Q13A 1NI2A 4HAXB 3DXEA 5KCVA 1UNPA 2P0DA 4HB0B 3G9WA 4PNKA 1J0WA 1V89A 1TQZA 2RGNB 2D2QA 2N23A 4B6HA 3QIJA 1M7RA 4HDQA 2W2XC 1MAIA 1KI1B 5DHAB 2D9XA 3DXCA 1DBHA 2I5CA 1I2HA 5D3WA 1TXDA 1UEFA 4HAYB 1GC6A 3KRWA 3GYOA 4A6FA 2CODA 3PVLA 1MIZB 2P0HA 3NSUA 1N3HA 1UPRA 2RSGA 4K2PA 5HE1A 1U29A 4D0NB 2DYNA 3HQCA 2MDXA 3VIAA 4F7GA 5C6RA 3ULCA 3HW2B 3CIKA 3A98B 3U7DA 3D8FA 3PP2A 1ZM0A 5KQ1A 1DYNA 1E5WA 1FHWA 1U5GA 2L1CA 2DYQA 2UVMA 3D8EA 5EFXA 3ML4A 1WG7A 1GC7A 1X11A 2LOZA 2NMBA 2COAA 2JP2A 3A8QA 3MDBC 2ELBA 1V5MA 2OTXA 4HAZB 4WSFA 2Z0PA 3HK0A 2HE7A 2DA0A 5D3YA 5L81A 1ZC4B 2I5FA 3QBVB 2EC1A 1OY2A 2OQBA 1U5DA 1FGZA 4ZRKA 1NTYA 1P6SA 2DKQA 2UZSA 1V61A 4GMVA 4HB4B 4DX90 4HATB 4F7HA 5C79A 2YT1A 2MWNB 1FGYA 3FM8C 2Y8GA 2DN6A 3N7CA 3ZVRA 4F7UP 1Y19B 4Z2MB 4CHMA 3WA0A 1FHOA 1XR0B 5GOWB 4HAVB 1K5GB 2YS3A 3ODXA 3SO6A 2ZPYA 4KHOA 5C16A 4WJ7A 4H8SA 1SHCA 5C5BA 5HE3A 1DDMA 2I1KA 1EVHA 2K00A 2LOXA 1MPHA 3TVVA 1GG3A 4A6KA 2VKIA 2QKLA 3CXBB 2YSZA 5HE0A 4NSWA 4GN1A 2VSZA 5DIFB 3X23A 2D9VA 2J0JA 2J0KA 5CLLB 4WVFB 1PFJA 2X18A 4KHAA 5LONB 3BINA 2FJLA 1UPQA 2ROVA 4EJNA 4P7IA 2LULA 2YRYA 1XCGA 3WYFB 1V5UA 4HB2B 4CYEA 2AL6A 2DTCA 3RCPA 5DI9B 3DXDA 2LKOA 2P0FA 4IFSA 2D10A 5J3QA 1Y5OA 2HTHB 2COFA 1V88A 2EMSA 2YS5A 1B55A 4YONA 1MIXA 3PG7A 5DHFB 5J3TA 3ULBA 2M14A 1FOEA 2DLWA 2CY5A 2P8VA 4HHVA 1XD4A 3SYXA 1P3RA 1DDWA 5FI1A 1U2BA 1IRSA 1MK9B 1WJ1A 1XKEA 5D3VA 3QWMA 2LYDA 1LW3A 1ZVRA 1H4RA 2Y8FA 4DBBA 3TO1A 1AQCA 2DFKA 5C5BB 3ODOA 4YL8A 1TJ6A 2H7DA 1SGHA 3VOQA 2YS1A 4PQ0A 3U8ZA 3PVWA 2KCJA 3SV1A 1OMWA 2UZRA 3F5RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MK0 A;  2D9Y A;  1OQN A;  2AEH A;  4DXA B;  1MK7 B;  2COC A;  3KSY A;  5HE2 A;  1NTV A;  1PMS A;  1XOD A;  2YT0 A;  4Z2N A;  4KAX B;  2EMT A;  4A5K A;  1U5F A;  3AJ4 A;  2DHI A;  4A6F B;  3M1I B;  5JLJ B;  1KZ7 A;  4HDO A;  2RLO A;  2CY4 A;  3O96 A;  2J0M A;  4GZU A;  3V5W A;  2Z0O A;  2XQN M;  1U5E A;  4DX8 A;  4L6E A;  1H10 A;  2G35 A;  3KZ1 A;  1ZSQ A;  1DDV A;  4KVG B;  1BAK A;  4K81 A;  1EF1 A;  4HAU B;  3BJI A;  2GJY A;  3T06 A;  3TCA A;  1NU2 A;  4MT7 A;  2QKM A;  1FAO A;  3PEG A;  5D27 A;  4K17 A;  3AU4 A;  4A6H A;  2RUK B;  1X05 A;  2IFS A;  4EKU A;  1J19 A;  2D4Q A;  4TYZ A;  1WJM A;  2MFQ A;  2GCL A;  2W2W A;  1W1H A;  5LOP B;  5CLQ B;  2CAY A;  4IAP A;  2RVB B;  3D8D A;  2BCJ A;  1M7E A;  4TKN A;  2IYB A;  5J3Y A;  2MKR A;  2PZ1 A;  4GPT B;  1QQG A;  2VRW B;  2YVC A;  1EAZ A;  2E2X A;  1Z87 A;  3UZT A;  4K2O A;  2D9Z A;  5JP4 A;  1K5D B;  1UNR A;  1RJ2 A;  4CHJ A;  3A8P A;  3AU5 A;  2K2U A;  1BTN A;  1X1G A;  3IVF A;  1KZG A;  4HB3 B;  4EMO A;  1WVH A;  1PLS A;  2KUP A;  2R09 A;  4GXB A;  2DKP A;  1QC6 A;  1MKE A;  1WGQ A;  2D11 A;  1W1G A;  2Z0Q A;  2ELA A;  2H7E A;  2RNR B;  3PVU A;  1W1D A;  1DRO A;  3TFM A;  3GYP A;  4KHB B;  3TW1 A;  4NY0 A;  1U27 A;  1UNQ A;  1V5P A;  2Y7B A;  1BTK A;  2DHJ A;  3P7Z A;  4HAW B;  3P6A A;  5D3X A;  2I1J A;  4C0A A;  1FB8 A;  3F0W A;  3FSS A;  3LJU X;  3FEH A;  4XWX A;  5JHH A;  2GCJ A;  1LB1 A;  2ADZ A;  2GS0 A;  1X86 A;  1ZC3 B;  5JHG A;  1P5T A;  1WGU A;  5FI0 A;  2J59 M;  2KGX B;  1I7A A;  5DH9 B;  3ZDT A;  1ISN A;  2DX5 A;  1XX0 A;  3SNH A;  3PSC A;  3ODW A;  5KQ4 A;  4Y94 A;  1FHX A;  1AWE A;  2L2I A;  2N0Y A;  2R0D A;  2M38 A;  4IOY X;  4ZRJ A;  2LG1 A;  2D9W A;  4BBK A;  2V76 A;  2EJ8 A;  1RRP B;  1Q67 A;  2ROZ B;  3KY9 A;  2YF0 A;  3SUZ A;  2K2J A;  3MPX A;  4MY6 A;  2CRF A;  1X1F A;  2NZ8 B;  1BWN A;  2DHK A;  2W2X D;  4GMX B;  3OAN A;  1WI1 A;  4ZRI A;  1EGX A;  3KRX A;  2DX1 A;  3PZD A;  2Q13 A;  1NI2 A;  4HAX B;  3DXE A;  5KCV A;  1UNP A;  2P0D A;  4HB0 B;  3G9W A;  4PNK A;  1J0W A;  1V89 A;  1TQZ A;  2RGN B;  2D2Q A;  2N23 A;  4B6H A;  3QIJ A;  1M7R A;  4HDQ A;  2W2X C;  1MAI A;  1KI1 B;  5DHA B;  2D9X A;  3DXC A;  1DBH A;  2I5C A;  1I2H A;  5D3W A;  1TXD A;  1UEF A;  4HAY B;  1GC6 A;  3KRW A;  3GYO A;  4A6F A;  2COD A;  3PVL A;  1MIZ B;  2P0H A;  3NSU A;  1N3H A;  1UPR A;  2RSG A;  4K2P A;  5HE1 A;  1U29 A;  4D0N B;  2DYN A;  3HQC A;  2MDX A;  3VIA A;  4F7G A;  5C6R A;  3ULC A;  3HW2 B;  3CIK A;  3A98 B;  3U7D A;  3D8F A;  3PP2 A;  1ZM0 A;  5KQ1 A;  1DYN A;  1E5W A;  1FHW A;  1U5G A;  2L1C A;  2DYQ A;  2UVM A;  3D8E A;  5EFX A;  3ML4 A;  1WG7 A;  1GC7 A;  1X11 A;  2LOZ A;  2NMB A;  2COA A;  2JP2 A;  3A8Q A;  3MDB C;  2ELB A;  1V5M A;  2OTX A;  4HAZ B;  4WSF A;  2Z0P A;  3HK0 A;  2HE7 A;  2DA0 A;  5D3Y A;  5L81 A;  1ZC4 B;  2I5F A;  3QBV B;  2EC1 A;  1OY2 A;  2OQB A;  1U5D A;  1FGZ A;  4ZRK A;  1NTY A;  1P6S A;  2DKQ A;  2UZS A;  1V61 A;  4GMV A;  4HB4 B;  4DX9 0;  4HAT B;  4F7H A;  5C79 A;  2YT1 A;  2MWN B;  1FGY A;  3FM8 C;  2Y8G A;  2DN6 A;  3N7C A;  3ZVR A;  4F7U P;  1Y19 B;  4Z2M B;  4CHM A;  3WA0 A;  1FHO A;  1XR0 B;  5GOW B;  4HAV B;  1K5G B;  2YS3 A;  3ODX A;  3SO6 A;  2ZPY A;  4KHO A;  5C16 A;  4WJ7 A;  4H8S A;  1SHC A;  5C5B A;  5HE3 A;  1DDM A;  2I1K A;  1EVH A;  2K00 A;  2LOX A;  1MPH A;  3TVV A;  1GG3 A;  4A6K A;  2VKI A;  2QKL A;  3CXB B;  2YSZ A;  5HE0 A;  4NSW A;  4GN1 A;  2VSZ A;  5DIF B;  3X23 A;  2D9V A;  2J0J A;  2J0K A;  5CLL B;  4WVF B;  1PFJ A;  2X18 A;  4KHA A;  5LON B;  3BIN A;  2FJL A;  1UPQ A;  2ROV A;  4EJN A;  4P7I A;  2LUL A;  2YRY A;  1XCG A;  3WYF B;  1V5U A;  4HB2 B;  4CYE A;  2AL6 A;  2DTC A;  3RCP A;  5DI9 B;  3DXD A;  2LKO A;  2P0F A;  4IFS A;  2D10 A;  5J3Q A;  1Y5O A;  2HTH B;  2COF A;  1V88 A;  2EMS A;  2YS5 A;  1B55 A;  4YON A;  1MIX A;  3PG7 A;  5DHF B;  5J3T A;  3ULB A;  2M14 A;  1FOE A;  2DLW A;  2CY5 A;  2P8V A;  4HHV A;  1XD4 A;  3SYX A;  1P3R A;  1DDW A;  5FI1 A;  1U2B A;  1IRS A;  1MK9 B;  1WJ1 A;  1XKE A;  5D3V A;  3QWM A;  2LYD A;  1LW3 A;  1ZVR A;  1H4R A;  2Y8F A;  4DBB A;  3TO1 A;  1AQC A;  2DFK A;  5C5B B;  3ODO A;  4YL8 A;  1TJ6 A;  2H7D A;  1SGH A;  3VOQ A;  2YS1 A;  4PQ0 A;  3U8Z A;  3PVW A;  2KCJ A;  3SV1 A;  1OMW A;  2UZR A;  3F5R A; 
#chains in the Genus database with same CATH topology
 4MK0 A;  2D9Y A;  1OQN A;  2AEH A;  4DXA B;  5LG4 B;  1MK7 B;  2COC A;  3KSY A;  5HE2 A;  1NTV A;  1PMS A;  1XOD A;  2YT0 A;  4Z2N A;  3NWD A;  4KAX B;  2EMT A;  4A5K A;  1U5F A;  3AJ4 A;  2DHI A;  4A6F B;  3M1I B;  5JLJ B;  1KZ7 A;  4HDO A;  2RLO A;  2CY4 A;  4KHB A;  3O96 A;  2J0M A;  4GZU A;  3V5W A;  2Z0O A;  2XQN M;  1U5E A;  4DX8 A;  4L6E A;  1H10 A;  2G35 A;  3KZ1 A;  1ZSQ A;  2GUM A;  1DDV A;  4KVG B;  1BAK A;  4K81 A;  1EF1 A;  4HAU B;  3BJI A;  2GJY A;  3T06 A;  3TCA A;  1NU2 A;  4MT7 A;  2QKM A;  2KR0 A;  1FAO A;  3PEG A;  5D27 A;  4K17 A;  4QXA B;  3AU4 A;  4A6H A;  2RUK B;  1X05 A;  2IFS A;  4EKU A;  1J19 A;  2D4Q A;  4TYZ A;  1WJM A;  3FVC A;  4OSN A;  2MFQ A;  2GCL A;  2W2W A;  1W1H A;  5LOP B;  5CLQ B;  2CAY A;  4IAP A;  2RVB B;  3D8D A;  4CSQ A;  2BCJ A;  1M7E A;  3NWA A;  5I2S A;  4TKN A;  2IYB A;  5J3Y A;  2MKR A;  2PZ1 A;  4GPT B;  1QQG A;  2VRW B;  2YVC A;  1EAZ A;  2E2X A;  1Z87 A;  3UZT A;  4K2O A;  2D9Z A;  5JP4 A;  1K5D B;  4QJ3 B;  1UNR A;  1RJ2 A;  4CHJ A;  3A8P A;  3AU5 A;  2K2U A;  1BTN A;  1X1G A;  3IVF A;  1KZG A;  4HB3 B;  4EMO A;  1WVH A;  1PLS A;  2KUP A;  2R09 A;  4GXB A;  3U12 A;  4GOU A;  2DKP A;  1QC6 A;  1MKE A;  1WGQ A;  2D11 A;  1W1G A;  2Z0Q A;  3OHM B;  2ELA A;  2H7E A;  2Z14 A;  2RNR B;  3PVU A;  1W1D A;  1DRO A;  3TFM A;  3GYP A;  4KHB B;  3TW1 A;  4NY0 A;  2KIE A;  1U27 A;  4OT1 A;  1UNQ A;  1V5P A;  2Y7B A;  1BTK A;  2DHJ A;  3P7Z A;  4HAW B;  3P6A A;  5D3X A;  2I1J A;  3NWF A;  4C0A A;  2Z4D A;  1FB8 A;  3F0W A;  3FSS A;  3LJU X;  3FEH A;  4XWX A;  5JHH A;  2GCJ A;  1LB1 A;  2ADZ A;  2GS0 A;  1X86 A;  1ZC3 B;  5JHG A;  1P5T A;  1WGU A;  4D6W A;  5FI0 A;  2J59 M;  2KGX B;  1I7A A;  5DH9 B;  3ZDT A;  1ISN A;  2DX5 A;  1XX0 A;  3B77 A;  3SNH A;  3PSC A;  2R2Y A;  3ODW A;  5KQ4 A;  4Y94 A;  1FHX A;  1AWE A;  2L2I A;  2N0Y A;  2R0D A;  2M38 A;  4IOY X;  4ZRJ A;  2LG1 A;  2D9W A;  4BBK A;  4HSI A;  2V76 A;  2EJ8 A;  1RRP B;  1Q67 A;  2ROZ B;  3KY9 A;  2YF0 A;  3SUZ A;  2K2J A;  3MPX A;  1ZYI A;  4MY6 A;  2CRF A;  1X1F A;  1MI1 A;  2NZ8 B;  1BWN A;  2DHK A;  2W2X D;  4GMX B;  3OAN A;  1WI1 A;  4ZRI A;  1EGX A;  3KRX A;  2DX1 A;  3PZD A;  2Q13 A;  1NI2 A;  4HAX B;  3DXE A;  5KCV A;  1UNP A;  2P0D A;  4HB0 B;  3G9W A;  4PNK A;  1J0W A;  1V89 A;  1TQZ A;  2RGN B;  2D2Q A;  2N23 A;  4B6H A;  3QIJ A;  1M7R A;  4HDQ A;  2W2X C;  1MAI A;  2KIG A;  1KI1 B;  5DHA B;  2D9X A;  3DXC A;  1DBH A;  2I5C A;  1I2H A;  5D3W A;  1TXD A;  1UEF A;  4HAY B;  1GC6 A;  3KRW A;  3GYO A;  4A6F A;  2COD A;  3PVL A;  5I2M A;  1MIZ B;  2P0H A;  3NSU A;  1N3H A;  1UPR A;  2RSG A;  4K2P A;  5HE1 A;  1U29 A;  4D0N B;  2DYN A;  3HQC A;  2MDX A;  3VIA A;  4F7G A;  5C6R A;  3ULC A;  3HW2 B;  3CIK A;  3A98 B;  3U7D A;  3D8F A;  3DCX A;  1ZM0 A;  3PP2 A;  5KQ1 A;  1DYN A;  1E5W A;  1FHW A;  1U5G A;  2L1C A;  2Z13 A;  2DYQ A;  2UVM A;  3D8E A;  5EFX A;  3ML4 A;  1WG7 A;  1GC7 A;  1X11 A;  3HIE A;  2LOZ A;  2NBV A;  2NMB A;  2COA A;  2JP2 A;  3A8Q A;  3MDB C;  2ELB A;  1V5M A;  2OTX A;  4HAZ B;  4WSF A;  2Z0P A;  3HK0 A;  2HE7 A;  2DA0 A;  5D3Y A;  5L81 A;  1ZC4 B;  2I5F A;  3QBV B;  3NW8 A;  2EC1 A;  1OY2 A;  2OQB A;  1U5D A;  1FGZ A;  4ZRK A;  1NTY A;  1P6S A;  2DKQ A;  2UZS A;  1V61 A;  4GMV A;  4HB4 B;  2KUQ A;  4DX9 0;  4HAT B;  5IRS A;  4F7H A;  5C79 A;  2YT1 A;  2MWN B;  1FGY A;  3FM8 C;  2Y8G A;  2DN6 A;  3N7C A;  4L1R A;  3ZVR A;  4F7U P;  1Y19 B;  4DIX A;  4Z2M B;  4CHM A;  3WA0 A;  1FHO A;  5M4Y B;  1XR0 B;  5GOW B;  4HAV B;  1K5G B;  2YS3 A;  3HSA A;  3ODX A;  3SO6 A;  2ZPY A;  4KHO A;  5C16 A;  4WJ7 A;  4H8S A;  1SHC A;  5C5B A;  2Z59 A;  5HE3 A;  1DDM A;  2I1K A;  1EVH A;  2K00 A;  2LOX A;  1MPH A;  3TVV A;  1GG3 A;  4A6K A;  2VKI A;  2QKL A;  3CXB B;  2YSZ A;  5HE0 A;  4NSW A;  4GN1 A;  2VSZ A;  4QJ4 B;  5DIF B;  3X23 A;  2D9V A;  2YT2 A;  2J0J A;  2J0K A;  5CLL B;  4WVF B;  1PFJ A;  2X18 A;  4KHA A;  5LON B;  3BIN A;  2FJL A;  1UPQ A;  2ROV A;  4EJN A;  4P7I A;  2LUL A;  2YRY A;  1XCG A;  3WYF B;  1V5U A;  4HB2 B;  4CYE A;  2AL6 A;  2DTC A;  3RCP A;  5DI9 B;  3DXD A;  3A58 A;  2FJU B;  2LKO A;  4GNK B;  2P0F A;  4IFS A;  2D10 A;  5J3Q A;  1Y5O A;  2HTH B;  4QJ5 B;  2COF A;  1V88 A;  2EMS A;  2YS5 A;  1B55 A;  4YON A;  1MIX A;  3PG7 A;  5DHF B;  5J3T A;  3ULB A;  2M14 A;  1FOE A;  2DLW A;  2CY5 A;  2K49 A;  2P8V A;  4HHV A;  1XD4 A;  3SYX A;  2RRF A;  1P3R A;  1DDW A;  5FI1 A;  1U2B A;  1IRS A;  1MK9 B;  1WJ1 A;  1XKE A;  5D3V A;  3QWM A;  2LYD A;  1LW3 A;  1ZVR A;  1H4R A;  2Y8F A;  2ZKM X;  4DBB A;  3TO1 A;  1T77 A;  1AQC A;  2DFK A;  5C5B B;  3ODO A;  4YL8 A;  1TJ6 A;  2H7D A;  1SGH A;  2K8E A;  3VOQ A;  2YS1 A;  4PQ0 A;  3U8Z A;  3PVW A;  2KCJ A;  3SV1 A;  1OMW A;  2UZR A;  3F5R A; 
#chains in the Genus database with same CATH homology
 4MK0 A;  2D9Y A;  1OQN A;  2AEH A;  4DXA B;  1MK7 B;  2COC A;  3KSY A;  5HE2 A;  1NTV A;  1PMS A;  1XOD A;  2YT0 A;  4Z2N A;  4KAX B;  2EMT A;  4A5K A;  1U5F A;  3AJ4 A;  2DHI A;  4A6F B;  3M1I B;  5JLJ B;  1KZ7 A;  4HDO A;  2RLO A;  2CY4 A;  3O96 A;  2J0M A;  4GZU A;  3V5W A;  2Z0O A;  2XQN M;  1U5E A;  4DX8 A;  4L6E A;  1H10 A;  2G35 A;  3KZ1 A;  1ZSQ A;  1DDV A;  4KVG B;  1BAK A;  4K81 A;  1EF1 A;  4HAU B;  3BJI A;  2GJY A;  3T06 A;  3TCA A;  1NU2 A;  4MT7 A;  2QKM A;  1FAO A;  3PEG A;  5D27 A;  4K17 A;  3AU4 A;  4A6H A;  2RUK B;  1X05 A;  2IFS A;  4EKU A;  1J19 A;  2D4Q A;  4TYZ A;  1WJM A;  2MFQ A;  2GCL A;  2W2W A;  1W1H A;  5LOP B;  5CLQ B;  2CAY A;  4IAP A;  2RVB B;  3D8D A;  2BCJ A;  1M7E A;  4TKN A;  2IYB A;  5J3Y A;  2MKR A;  2PZ1 A;  4GPT B;  1QQG A;  2VRW B;  2YVC A;  1EAZ A;  2E2X A;  1Z87 A;  3UZT A;  4K2O A;  2D9Z A;  5JP4 A;  1K5D B;  1UNR A;  1RJ2 A;  4CHJ A;  3A8P A;  3AU5 A;  2K2U A;  1BTN A;  1X1G A;  3IVF A;  1KZG A;  4HB3 B;  4EMO A;  1WVH A;  1PLS A;  2KUP A;  2R09 A;  4GXB A;  2DKP A;  1QC6 A;  1MKE A;  1WGQ A;  2D11 A;  1W1G A;  2Z0Q A;  2ELA A;  2H7E A;  2RNR B;  3PVU A;  1W1D A;  1DRO A;  3TFM A;  3GYP A;  4KHB B;  3TW1 A;  4NY0 A;  1U27 A;  1UNQ A;  1V5P A;  2Y7B A;  1BTK A;  2DHJ A;  3P7Z A;  4HAW B;  3P6A A;  5D3X A;  2I1J A;  4C0A A;  1FB8 A;  3F0W A;  3FSS A;  3LJU X;  3FEH A;  4XWX A;  5JHH A;  2GCJ A;  1LB1 A;  2ADZ A;  2GS0 A;  1X86 A;  1ZC3 B;  5JHG A;  1P5T A;  1WGU A;  5FI0 A;  2J59 M;  2KGX B;  1I7A A;  5DH9 B;  3ZDT A;  1ISN A;  2DX5 A;  1XX0 A;  3SNH A;  3PSC A;  3ODW A;  5KQ4 A;  4Y94 A;  1FHX A;  1AWE A;  2L2I A;  2N0Y A;  2R0D A;  2M38 A;  4IOY X;  4ZRJ A;  2LG1 A;  2D9W A;  4BBK A;  2V76 A;  2EJ8 A;  1RRP B;  1Q67 A;  2ROZ B;  3KY9 A;  2YF0 A;  3SUZ A;  2K2J A;  3MPX A;  4MY6 A;  2CRF A;  1X1F A;  2NZ8 B;  1BWN A;  2DHK A;  2W2X D;  4GMX B;  3OAN A;  1WI1 A;  4ZRI A;  1EGX A;  3KRX A;  2DX1 A;  3PZD A;  2Q13 A;  1NI2 A;  4HAX B;  3DXE A;  5KCV A;  1UNP A;  2P0D A;  4HB0 B;  3G9W A;  4PNK A;  1J0W A;  1V89 A;  1TQZ A;  2RGN B;  2D2Q A;  2N23 A;  4B6H A;  3QIJ A;  1M7R A;  4HDQ A;  2W2X C;  1MAI A;  1KI1 B;  5DHA B;  2D9X A;  3DXC A;  1DBH A;  2I5C A;  1I2H A;  5D3W A;  1TXD A;  1UEF A;  4HAY B;  1GC6 A;  3KRW A;  3GYO A;  4A6F A;  2COD A;  3PVL A;  1MIZ B;  2P0H A;  3NSU A;  1N3H A;  1UPR A;  2RSG A;  4K2P A;  5HE1 A;  1U29 A;  4D0N B;  2DYN A;  3HQC A;  2MDX A;  3VIA A;  4F7G A;  5C6R A;  3ULC A;  3HW2 B;  3CIK A;  3A98 B;  3U7D A;  3D8F A;  3PP2 A;  1ZM0 A;  5KQ1 A;  1DYN A;  1E5W A;  1FHW A;  1U5G A;  2L1C A;  2DYQ A;  2UVM A;  3D8E A;  5EFX A;  3ML4 A;  1WG7 A;  1GC7 A;  1X11 A;  2LOZ A;  2NMB A;  2COA A;  2JP2 A;  3A8Q A;  3MDB C;  2ELB A;  1V5M A;  2OTX A;  4HAZ B;  4WSF A;  2Z0P A;  3HK0 A;  2HE7 A;  2DA0 A;  5D3Y A;  5L81 A;  1ZC4 B;  2I5F A;  3QBV B;  2EC1 A;  1OY2 A;  2OQB A;  1U5D A;  1FGZ A;  4ZRK A;  1NTY A;  1P6S A;  2DKQ A;  2UZS A;  1V61 A;  4GMV A;  4HB4 B;  4DX9 0;  4HAT B;  4F7H A;  5C79 A;  2YT1 A;  2MWN B;  1FGY A;  3FM8 C;  2Y8G A;  2DN6 A;  3N7C A;  3ZVR A;  4F7U P;  1Y19 B;  4Z2M B;  4CHM A;  3WA0 A;  1FHO A;  1XR0 B;  5GOW B;  4HAV B;  1K5G B;  2YS3 A;  3ODX A;  3SO6 A;  2ZPY A;  4KHO A;  5C16 A;  4WJ7 A;  4H8S A;  1SHC A;  5C5B A;  5HE3 A;  1DDM A;  2I1K A;  1EVH A;  2K00 A;  2LOX A;  1MPH A;  3TVV A;  1GG3 A;  4A6K A;  2VKI A;  2QKL A;  3CXB B;  2YSZ A;  5HE0 A;  4NSW A;  4GN1 A;  2VSZ A;  5DIF B;  3X23 A;  2D9V A;  2J0J A;  2J0K A;  5CLL B;  4WVF B;  1PFJ A;  2X18 A;  4KHA A;  5LON B;  3BIN A;  2FJL A;  1UPQ A;  2ROV A;  4EJN A;  4P7I A;  2LUL A;  2YRY A;  1XCG A;  3WYF B;  1V5U A;  4HB2 B;  4CYE A;  2AL6 A;  2DTC A;  3RCP A;  5DI9 B;  3DXD A;  2LKO A;  2P0F A;  4IFS A;  2D10 A;  5J3Q A;  1Y5O A;  2HTH B;  2COF A;  1V88 A;  2EMS A;  2YS5 A;  1B55 A;  4YON A;  1MIX A;  3PG7 A;  5DHF B;  5J3T A;  3ULB A;  2M14 A;  1FOE A;  2DLW A;  2CY5 A;  2P8V A;  4HHV A;  1XD4 A;  3SYX A;  1P3R A;  1DDW A;  5FI1 A;  1U2B A;  1IRS A;  1MK9 B;  1WJ1 A;  1XKE A;  5D3V A;  3QWM A;  2LYD A;  1LW3 A;  1ZVR A;  1H4R A;  2Y8F A;  4DBB A;  3TO1 A;  1AQC A;  2DFK A;  5C5B B;  3ODO A;  4YL8 A;  1TJ6 A;  2H7D A;  1SGH A;  3VOQ A;  2YS1 A;  4PQ0 A;  3U8Z A;  3PVW A;  2KCJ A;  3SV1 A;  1OMW A;  2UZR A;  3F5R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...