5L81A

Crystal structure of the ph domain of murine kindlin-3
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
133
structure length
133
Chain Sequence
SLTTIPELKDHLRIFRPRKLTLKGYRQYWVVFKDTTLSYYKSQDEAPGDPTQQLNLKGCEVVPDVNVSGQKFCIKLLVPSPEGMSEIYLRCQDEQQYAQWMAACRLASKGRTMADSSYASEVQAILAFLSLQR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure and lipid-binding properties of the kindlin-3 pleckstrin homology domain.
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
molecule keywords Fermitin family homolog 3
total genus 31
structure length 133
sequence length 133
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 5l81A00
5D3VA 3PVWA 2GCJA 3BJIA 2UZRA 1U29A 4EJNA 5LOPB 3P7ZA 1E5WA 4IFSA 5DHFB 4EMOA 1ZC3B 5FI1A 4F7HA 2IFSA 5KQ1A 1MK9B 4HHVA 2CY4A 1KZGA 5C6RA 2MKRA 1WI1A 1V5UA 2COAA 5JP4A 1BTNA 3TO1A 2DFKA 2D9WA 5C5BA 1Y5OA 2CAYA 3V5WA 2Z0OA 2I1JA 4P7IA 1XX0A 4KHAA 4HAXB 5GOWB 5D3YA 2DKPA 3VIAA 4YL8A 1SGHA 2DLWA 3PG7A 1IRSA 2DN6A 2PZ1A 1XCGA 3HK0A 1FAOA 1XKEA 2RNRB 1U5DA 2OQBA 5C16A 4WVFB 1K5DB 1PMSA 4IAPA 3ODXA 3UZTA 4A6FA 1U27A 1BTKA 3OANA 4H8SA 4WJ7A 2VSZA 2DHJA 3AJ4A 3DXCA 5D3XA 3M1IB 4HB0B 1UPQA 3HQCA 2ELAA 3X23A 3ZVRA 1GC7A 2RLOA 1I7AA 4TYZA 4F7GA 5CLLB 3DXDA 1UNPA 1MKEA 2RGNB 4IOYX 5J3QA 2H7EA 1NTYA 4GPTB 2NZ8B 2W2XC 1H4RA 4MT7A 1P5TA 2LYDA 5HE1A 2HE7A 2Y7BA 2D11A 3NSUA 3WA0A 1WGQA 3T06A 1MAIA 1WG7A 4Z2MB 1NTVA 1W1DA 1N3HA 2D9YA 1UPRA 2J0MA 4CYEA 4KVGB 4PQ0A 4HB4B 1MK7B 1OMWA 4ZRKA 2J59M 4GZUA 4WSFA 4DBBA 3U7DA 3CXBB 3KZ1A 3TW1A 5LONB 2D9ZA 3IVFA 2K00A 1W1HA 4EKUA 4YONA 4HAUB 3VOQA 2R09A 4DX8A 1X86A 2DYQA 1UNQA 3PSCA 1QC6A 4HAZB 2M14A 1NI2A 2LULA 4GN1A 2ADZA 5HE3A 4ZRIA 4TKNA 1FHWA 3SYXA 1FGYA 1ISNA 1XODA 3HW2B 3TCAA 1U5EA 4ZRJA 1X11A 3D8DA 4HDOA 4KHBB 3TFMA 1TXDA 4K17A 2HTHB 3TVVA 2I5CA 2OTXA 1DYNA 3KRXA 1EF1A 3FEHA 2V76A 2W2XD 3F0WA 1KZ7A 1Y19B 3CIKA 3AU4A 1RRPB 4NSWA 1XD4A 1EAZA 2D9VA 2UVMA 3FSSA 1QQGA 2AEHA 1MIZB 2P0DA 5DIFB 2H7DA 1LB1A 2Q13A 5KQ4A 2I5FA 2Z0QA 2QKLA 2VKIA 3SO6A 1X1FA 2E2XA 2YVCA 3KSYA 1PFJA 2N23A 1U5FA 3A98B 2IYBA 2UZSA 1WJMA 5DHAB 2EC1A 1DROA 1V61A 3LJUX 3PEGA 2EMSA 5C79A 4DXAB 1V89A 1K5GB 2DKQA 4A5KA 2YRYA 1DBHA 4Z2NA 2L2IA 1GG3A 2ROVA 4K2OA 3ZDTA 2M38A 1Q67A 4PNKA 4BBKA 2YS1A 3PP2A 4C0AA 1M7EA 3QBVB 1LW3A 1UEFA 2W2WA 4HB3B 1PLSA 5JHHA 1V5PA 2P0HA 2K2JA 3DXEA 3PVLA 1DDVA 1J19A 5J3TA 2YS3A 2MDXA 2YSZA 4A6HA 2JP2A 2P8VA 3ODWA 4GMVA 2VRWB 3D8EA 2D2QA 2ELBA 1H10A 2MWNB 2COFA 5JLJB 2YS5A 2ROZB 1DDMA 2GCLA 2NMBA 3U8ZA 2DTCA 1V88A 3G9WA 2CY5A 4KHOA 2QKMA 1WGUA 2G35A 3MDBC 4HATB 3MPXA 2J0KA 4NY0A 5D3WA 3RCPA 1AQCA 1MPHA 1UNRA 1X1GA 2DX1A 2YF0A 2FJLA 1B55A 4A6KA 2DHIA 4XWXA 2J0JA 3GYOA 2MFQA 3F5RA 3ULCA 1WVHA 2CRFA 4CHJA 1MIXA 1BAKA 3ULBA 1U2BA 1FGZA 4KAXB 1GC6A 3A8QA 5KCVA 5L81A 4F7UP 1AWEA 3SNHA 5J3YA 1FOEA 1OY2A 1J0WA 2EMTA 2BCJA 4HAVB 3PZDA 2P0FA 2RVBB 2GJYA 1X05A 1ZC4B 1WJ1A 4B6HA 2LOXA 3AU5A 5CLQB 4L6EA 4MY6A 2N0YA 1U5GA 1FHOA 3N7CA 3KY9A 2ZPYA 1XR0B 2KGXB 3FM8C 3P6AA 2Z0PA 3PVUA 2XQNM 5DH9B 2KCJA 2EJ8A 2DX5A 1NU2A 4A6FB 3QWMA 2Y8GA 3KRWA 5DI9B 3D8FA 4GXBA 2LKOA 2I1KA 3BINA 1OQNA 1TQZA 2CODA 5FI0A 4GMXB 1KI1B 4HAYB 5JHGA 1RJ2A 2GS0A 5C5BB 4Y94A 3ML4A 3SV1A 5HE0A 1ZVRA 2COCA 3QIJA 3SUZA 3GYPA 4DX90 2X18A 2RUKB 2L1CA 2YT1A 2DHKA 3ODOA 2AL6A 1Z87A 1M7RA 1DDWA 1BWNA 4K2PA 2RSGA 3O96A 4HDQA 2D4QA 2KUPA 4D0NB 3WYFB 2D9XA 5EFXA 2DA0A 2D10A 4HAWB 1P6SA 1I2HA 2LOZA 2DYNA 4K81A 1FB8A 5HE2A 4HB2B 1FHXA 1W1GA 1P3RA 2R0DA 3A8PA 1V5MA 1ZM0A 1ZSQA 2Y8FA 2YT0A 5D27A 1SHCA 2K2UA 1EGXA 2LG1A 4CHMA 1EVHA 1TJ6A 4MK0A
chains in the Genus database with same CATH superfamily
5D3VA 3B77A 3PVWA 2GCJA 2KIEA 3BJIA 2UZRA 1U29A 4EJNA 5LOPB 3P7ZA 1E5WA 4IFSA 5DHFB 4EMOA 1ZC3B 5FI1A 4F7HA 2IFSA 5KQ1A 1MK9B 4HHVA 2CY4A 1KZGA 5C6RA 2MKRA 1WI1A 1V5UA 3A58A 2COAA 5JP4A 1BTNA 3TO1A 2DFKA 2D9WA 5C5BA 1Y5OA 2CAYA 3V5WA 2Z0OA 2I1JA 3HSAA 4P7IA 1XX0A 4KHAA 4HAXB 5GOWB 5D3YA 2DKPA 3VIAA 4YL8A 1SGHA 2DLWA 3PG7A 1IRSA 2DN6A 2PZ1A 1XCGA 2Z59A 3HK0A 1FAOA 1XKEA 2RNRB 1U5DA 2OQBA 5C16A 4WVFB 1K5DB 2Z4DA 1PMSA 2K49A 4IAPA 3ODXA 3UZTA 4A6FA 1U27A 1BTKA 3OANA 4H8SA 4WJ7A 2VSZA 2DHJA 3AJ4A 3DXCA 4GOUA 5D3XA 4L1RA 3M1IB 4HB0B 1UPQA 3HQCA 2ELAA 3X23A 3ZVRA 1GC7A 2RLOA 1I7AA 4TYZA 4F7GA 5CLLB 3DXDA 1UNPA 1MKEA 2Z14A 2RGNB 4IOYX 5J3QA 2H7EA 1NTYA 4GPTB 2NZ8B 2W2XC 1H4RA 4MT7A 1P5TA 2LYDA 5HE1A 2HE7A 2Y7BA 2D11A 3NSUA 3WA0A 1WGQA 3T06A 3DCXA 3HIEA 1MAIA 1WG7A 4Z2MB 3NWDA 1NTVA 1W1DA 1N3HA 2D9YA 1UPRA 2J0MA 4CYEA 4KVGB 4PQ0A 4HB4B 2FJUB 1MK7B 1OMWA 4ZRKA 2J59M 4GZUA 4WSFA 4DBBA 3U7DA 3CXBB 3KZ1A 3TW1A 5LONB 4QJ4B 2D9ZA 3IVFA 2ZKMX 4OSNA 2R2YA 2K00A 2RRFA 1W1HA 4EKUA 4YONA 4HAUB 3VOQA 2R09A 4DX8A 1X86A 2DYQA 1UNQA 3PSCA 1QC6A 4HAZB 2M14A 4HSIA 1NI2A 2LULA 4GN1A 2ADZA 5HE3A 4QJ5B 4ZRIA 4TKNA 1FHWA 3SYXA 1FGYA 1ISNA 1XODA 3HW2B 3TCAA 1U5EA 3OHMB 4ZRJA 1X11A 3D8DA 4GNKB 4HDOA 4KHBB 3TFMA 1TXDA 4K17A 2HTHB 3TVVA 4DIXA 2I5CA 2OTXA 1DYNA 3KRXA 1EF1A 3FEHA 2V76A 2W2XD 3F0WA 1KZ7A 1Y19B 3CIKA 3AU4A 1RRPB 4NSWA 1XD4A 1EAZA 2D9VA 2UVMA 3FSSA 1QQGA 2AEHA 1MIZB 2P0DA 5DIFB 2H7DA 1LB1A 2GUMA 2Q13A 5KQ4A 2I5FA 2Z0QA 2QKLA 2VKIA 3SO6A 1X1FA 2E2XA 2YVCA 3KSYA 1PFJA 2N23A 1U5FA 3A98B 2IYBA 2UZSA 1WJMA 5DHAB 2EC1A 5I2MA 1DROA 1V61A 4QXAB 3LJUX 3PEGA 2EMSA 5C79A 4DXAB 1V89A 1K5GB 2DKQA 4A5KA 2YRYA 1DBHA 4Z2NA 2YT2A 2L2IA 4D6WA 1GG3A 2ROVA 4K2OA 3ZDTA 2M38A 1Q67A 4PNKA 4BBKA 2YS1A 3PP2A 3NWAA 4C0AA 1M7EA 2Z13A 5IRSA 3QBVB 1LW3A 1UEFA 2W2WA 2KIGA 4HB3B 1PLSA 5JHHA 1V5PA 2P0HA 4KHBA 2K2JA 3DXEA 3PVLA 1DDVA 1J19A 5J3TA 5M4YB 2YS3A 2MDXA 2YSZA 4A6HA 2JP2A 2P8VA 3ODWA 4GMVA 2VRWB 3D8EA 2D2QA 2ELBA 1H10A 2MWNB 2COFA 5JLJB 2YS5A 2ROZB 1DDMA 2GCLA 2NMBA 3U8ZA 2DTCA 1ZYIA 1V88A 3G9WA 2CY5A 4KHOA 2QKMA 3FVCA 1WGUA 2G35A 3MDBC 2KUQA 3MPXA 2J0KA 4HATB 4NY0A 5D3WA 3RCPA 1AQCA 1MPHA 1UNRA 1X1GA 2DX1A 2YF0A 2FJLA 5I2SA 1B55A 4A6KA 2DHIA 4XWXA 2J0JA 3GYOA 2MFQA 3F5RA 3ULCA 1WVHA 2CRFA 4CHJA 1MIXA 1BAKA 3ULBA 1U2BA 1FGZA 4KAXB 1GC6A 3A8QA 5KCVA 5L81A 4F7UP 1AWEA 1T77A 3SNHA 5J3YA 1FOEA 1OY2A 2KR0A 1J0WA 2EMTA 2BCJA 4HAVB 3PZDA 2P0FA 2RVBB 2GJYA 3NWFA 1X05A 1ZC4B 1WJ1A 4B6HA 2LOXA 3AU5A 5CLQB 4L6EA 4MY6A 2N0YA 1U5GA 1FHOA 3N7CA 3KY9A 2ZPYA 1XR0B 2KGXB 3FM8C 3P6AA 2Z0PA 3NW8A 3PVUA 2XQNM 5DH9B 2KCJA 2EJ8A 2DX5A 1NU2A 4A6FB 3QWMA 2Y8GA 3KRWA 5DI9B 3D8FA 4GXBA 4OT1A 2LKOA 2I1KA 3BINA 1OQNA 1TQZA 2CODA 4QJ3B 5FI0A 4GMXB 1KI1B 4HAYB 5JHGA 1RJ2A 5LG4B 2GS0A 5C5BB 4Y94A 3ML4A 3SV1A 5HE0A 1ZVRA 2COCA 3QIJA 3SUZA 1MI1A 3GYPA 4DX90 3U12A 2X18A 2RUKB 2L1CA 2YT1A 2DHKA 3ODOA 2AL6A 1Z87A 1M7RA 1DDWA 1BWNA 4K2PA 2RSGA 3O96A 4HDQA 2D4QA 2KUPA 4D0NB 3WYFB 2D9XA 5EFXA 2DA0A 2D10A 4HAWB 1P6SA 1I2HA 4CSQA 2K8EA 2DYNA 2LOZA 4K81A 2NBVA 1FB8A 5HE2A 1FHXA 4HB2B 1W1GA 1P3RA 2R0DA 3A8PA 1V5MA 1ZM0A 1ZSQA 2Y8FA 2YT0A 5D27A 1SHCA 2K2UA 1EGXA 2LG1A 4CHMA 1EVHA 1TJ6A 4MK0A
chains in the Genus database with same CATH topology
5D3VA 3PVWA 2GCJA 3BJIA 2UZRA 1U29A 4EJNA 5LOPB 3P7ZA 1E5WA 4IFSA 5DHFB 4EMOA 1ZC3B 5FI1A 4F7HA 2IFSA 5KQ1A 1MK9B 4HHVA 2CY4A 1KZGA 5C6RA 2MKRA 1WI1A 1V5UA 2COAA 5JP4A 1BTNA 3TO1A 2DFKA 2D9WA 5C5BA 1Y5OA 2CAYA 3V5WA 2Z0OA 2I1JA 4P7IA 1XX0A 4KHAA 4HAXB 5GOWB 5D3YA 2DKPA 3VIAA 4YL8A 1SGHA 2DLWA 3PG7A 1IRSA 2DN6A 2PZ1A 1XCGA 3HK0A 1FAOA 1XKEA 2RNRB 1U5DA 2OQBA 5C16A 4WVFB 1K5DB 1PMSA 4IAPA 3ODXA 3UZTA 4A6FA 1U27A 1BTKA 3OANA 4H8SA 4WJ7A 2VSZA 2DHJA 3AJ4A 3DXCA 5D3XA 3M1IB 4HB0B 1UPQA 3HQCA 2ELAA 3X23A 3ZVRA 1GC7A 2RLOA 1I7AA 4TYZA 4F7GA 5CLLB 3DXDA 1UNPA 1MKEA 2RGNB 4IOYX 5J3QA 2H7EA 1NTYA 4GPTB 2NZ8B 2W2XC 1H4RA 4MT7A 1P5TA 2LYDA 5HE1A 2HE7A 2Y7BA 2D11A 3NSUA 3WA0A 1WGQA 3T06A 1MAIA 1WG7A 4Z2MB 1NTVA 1W1DA 1N3HA 2D9YA 1UPRA 2J0MA 4CYEA 4KVGB 4PQ0A 4HB4B 1MK7B 1OMWA 4ZRKA 2J59M 4GZUA 4WSFA 4DBBA 3U7DA 3CXBB 3KZ1A 3TW1A 5LONB 2D9ZA 3IVFA 2K00A 1W1HA 4EKUA 4YONA 4HAUB 3VOQA 2R09A 4DX8A 1X86A 2DYQA 1UNQA 3PSCA 1QC6A 4HAZB 2M14A 1NI2A 2LULA 4GN1A 2ADZA 5HE3A 4ZRIA 4TKNA 1FHWA 3SYXA 1FGYA 1ISNA 1XODA 3HW2B 3TCAA 1U5EA 4ZRJA 1X11A 3D8DA 4HDOA 4KHBB 3TFMA 1TXDA 4K17A 2HTHB 3TVVA 2I5CA 2OTXA 1DYNA 3KRXA 1EF1A 3FEHA 2V76A 2W2XD 3F0WA 1KZ7A 1Y19B 3CIKA 3AU4A 1RRPB 4NSWA 1XD4A 1EAZA 2D9VA 2UVMA 3FSSA 1QQGA 2AEHA 1MIZB 2P0DA 5DIFB 2H7DA 1LB1A 2Q13A 5KQ4A 2I5FA 2Z0QA 2QKLA 2VKIA 3SO6A 1X1FA 2E2XA 2YVCA 3KSYA 1PFJA 2N23A 1U5FA 3A98B 2IYBA 2UZSA 1WJMA 5DHAB 2EC1A 1DROA 1V61A 3LJUX 3PEGA 2EMSA 5C79A 4DXAB 1V89A 1K5GB 2DKQA 4A5KA 2YRYA 1DBHA 4Z2NA 2L2IA 1GG3A 2ROVA 4K2OA 3ZDTA 2M38A 1Q67A 4PNKA 4BBKA 2YS1A 3PP2A 4C0AA 1M7EA 3QBVB 1LW3A 1UEFA 2W2WA 4HB3B 1PLSA 5JHHA 1V5PA 2P0HA 2K2JA 3DXEA 3PVLA 1DDVA 1J19A 5J3TA 2YS3A 2MDXA 2YSZA 4A6HA 2JP2A 2P8VA 3ODWA 4GMVA 2VRWB 3D8EA 2D2QA 2ELBA 1H10A 2MWNB 2COFA 5JLJB 2YS5A 2ROZB 1DDMA 2GCLA 2NMBA 3U8ZA 2DTCA 1V88A 3G9WA 2CY5A 4KHOA 2QKMA 1WGUA 2G35A 3MDBC 4HATB 3MPXA 2J0KA 4NY0A 5D3WA 3RCPA 1AQCA 1MPHA 1UNRA 1X1GA 2DX1A 2YF0A 2FJLA 1B55A 4A6KA 2DHIA 4XWXA 2J0JA 3GYOA 2MFQA 3F5RA 3ULCA 1WVHA 2CRFA 4CHJA 1MIXA 1BAKA 3ULBA 1U2BA 1FGZA 4KAXB 1GC6A 3A8QA 5KCVA 5L81A 4F7UP 1AWEA 3SNHA 5J3YA 1FOEA 1OY2A 1J0WA 2EMTA 2BCJA 4HAVB 3PZDA 2P0FA 2RVBB 2GJYA 1X05A 1ZC4B 1WJ1A 4B6HA 2LOXA 3AU5A 5CLQB 4L6EA 4MY6A 2N0YA 1U5GA 1FHOA 3N7CA 3KY9A 2ZPYA 1XR0B 2KGXB 3FM8C 3P6AA 2Z0PA 3PVUA 2XQNM 5DH9B 2KCJA 2EJ8A 2DX5A 1NU2A 4A6FB 3QWMA 2Y8GA 3KRWA 5DI9B 3D8FA 4GXBA 2LKOA 2I1KA 3BINA 1OQNA 1TQZA 2CODA 5FI0A 4GMXB 1KI1B 4HAYB 5JHGA 1RJ2A 2GS0A 5C5BB 4Y94A 3ML4A 3SV1A 5HE0A 1ZVRA 2COCA 3QIJA 3SUZA 3GYPA 4DX90 2X18A 2RUKB 2L1CA 2YT1A 2DHKA 3ODOA 2AL6A 1Z87A 1M7RA 1DDWA 1BWNA 4K2PA 2RSGA 3O96A 4HDQA 2D4QA 2KUPA 4D0NB 3WYFB 2D9XA 5EFXA 2DA0A 2D10A 4HAWB 1P6SA 1I2HA 2LOZA 2DYNA 4K81A 1FB8A 5HE2A 4HB2B 1FHXA 1W1GA 1P3RA 2R0DA 3A8PA 1V5MA 1ZM0A 1ZSQA 2Y8FA 2YT0A 5D27A 1SHCA 2K2UA 1EGXA 2LG1A 4CHMA 1EVHA 1TJ6A 4MK0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5D3V A;  3PVW A;  2GCJ A;  3BJI A;  2UZR A;  1U29 A;  4EJN A;  5LOP B;  3P7Z A;  1E5W A;  4IFS A;  5DHF B;  4EMO A;  1ZC3 B;  5FI1 A;  4F7H A;  2IFS A;  5KQ1 A;  1MK9 B;  4HHV A;  2CY4 A;  1KZG A;  5C6R A;  2MKR A;  1WI1 A;  1V5U A;  2COA A;  5JP4 A;  1BTN A;  3TO1 A;  2DFK A;  2D9W A;  5C5B A;  1Y5O A;  2CAY A;  3V5W A;  2Z0O A;  2I1J A;  4P7I A;  1XX0 A;  4KHA A;  4HAX B;  5GOW B;  5D3Y A;  2DKP A;  3VIA A;  4YL8 A;  1SGH A;  2DLW A;  3PG7 A;  1IRS A;  2DN6 A;  2PZ1 A;  1XCG A;  3HK0 A;  1FAO A;  1XKE A;  2RNR B;  1U5D A;  2OQB A;  5C16 A;  4WVF B;  1K5D B;  1PMS A;  4IAP A;  3ODX A;  3UZT A;  4A6F A;  1U27 A;  1BTK A;  3OAN A;  4H8S A;  4WJ7 A;  2VSZ A;  2DHJ A;  3AJ4 A;  3DXC A;  5D3X A;  3M1I B;  4HB0 B;  1UPQ A;  3HQC A;  2ELA A;  3X23 A;  3ZVR A;  1GC7 A;  2RLO A;  1I7A A;  4TYZ A;  4F7G A;  5CLL B;  3DXD A;  1UNP A;  1MKE A;  2RGN B;  4IOY X;  5J3Q A;  2H7E A;  1NTY A;  4GPT B;  2NZ8 B;  2W2X C;  1H4R A;  4MT7 A;  1P5T A;  2LYD A;  5HE1 A;  2HE7 A;  2Y7B A;  2D11 A;  3NSU A;  3WA0 A;  1WGQ A;  3T06 A;  1MAI A;  1WG7 A;  4Z2M B;  1NTV A;  1W1D A;  1N3H A;  2D9Y A;  1UPR A;  2J0M A;  4CYE A;  4KVG B;  4PQ0 A;  4HB4 B;  1MK7 B;  1OMW A;  4ZRK A;  2J59 M;  4GZU A;  4WSF A;  4DBB A;  3U7D A;  3CXB B;  3KZ1 A;  3TW1 A;  5LON B;  2D9Z A;  3IVF A;  2K00 A;  1W1H A;  4EKU A;  4YON A;  4HAU B;  3VOQ A;  2R09 A;  4DX8 A;  1X86 A;  2DYQ A;  1UNQ A;  3PSC A;  1QC6 A;  4HAZ B;  2M14 A;  1NI2 A;  2LUL A;  4GN1 A;  2ADZ A;  5HE3 A;  4ZRI A;  4TKN A;  1FHW A;  3SYX A;  1FGY A;  1ISN A;  1XOD A;  3HW2 B;  3TCA A;  1U5E A;  4ZRJ A;  1X11 A;  3D8D A;  4HDO A;  4KHB B;  3TFM A;  1TXD A;  4K17 A;  2HTH B;  3TVV A;  2I5C A;  2OTX A;  1DYN A;  3KRX A;  1EF1 A;  3FEH A;  2V76 A;  2W2X D;  3F0W A;  1KZ7 A;  1Y19 B;  3CIK A;  3AU4 A;  1RRP B;  4NSW A;  1XD4 A;  1EAZ A;  2D9V A;  2UVM A;  3FSS A;  1QQG A;  2AEH A;  1MIZ B;  2P0D A;  5DIF B;  2H7D A;  1LB1 A;  2Q13 A;  5KQ4 A;  2I5F A;  2Z0Q A;  2QKL A;  2VKI A;  3SO6 A;  1X1F A;  2E2X A;  2YVC A;  3KSY A;  1PFJ A;  2N23 A;  1U5F A;  3A98 B;  2IYB A;  2UZS A;  1WJM A;  5DHA B;  2EC1 A;  1DRO A;  1V61 A;  3LJU X;  3PEG A;  2EMS A;  5C79 A;  4DXA B;  1V89 A;  1K5G B;  2DKQ A;  4A5K A;  2YRY A;  1DBH A;  4Z2N A;  2L2I A;  1GG3 A;  2ROV A;  4K2O A;  3ZDT A;  2M38 A;  1Q67 A;  4PNK A;  4BBK A;  2YS1 A;  3PP2 A;  4C0A A;  1M7E A;  3QBV B;  1LW3 A;  1UEF A;  2W2W A;  4HB3 B;  1PLS A;  5JHH A;  1V5P A;  2P0H A;  2K2J A;  3DXE A;  3PVL A;  1DDV A;  1J19 A;  5J3T A;  2YS3 A;  2MDX A;  2YSZ A;  4A6H A;  2JP2 A;  2P8V A;  3ODW A;  4GMV A;  2VRW B;  3D8E A;  2D2Q A;  2ELB A;  1H10 A;  2MWN B;  2COF A;  5JLJ B;  2YS5 A;  2ROZ B;  1DDM A;  2GCL A;  2NMB A;  3U8Z A;  2DTC A;  1V88 A;  3G9W A;  2CY5 A;  4KHO A;  2QKM A;  1WGU A;  2G35 A;  3MDB C;  4HAT B;  3MPX A;  2J0K A;  4NY0 A;  5D3W A;  3RCP A;  1AQC A;  1MPH A;  1UNR A;  1X1G A;  2DX1 A;  2YF0 A;  2FJL A;  1B55 A;  4A6K A;  2DHI A;  4XWX A;  2J0J A;  3GYO A;  2MFQ A;  3F5R A;  3ULC A;  1WVH A;  2CRF A;  4CHJ A;  1MIX A;  1BAK A;  3ULB A;  1U2B A;  1FGZ A;  4KAX B;  1GC6 A;  3A8Q A;  5KCV A;  5L81 A;  4F7U P;  1AWE A;  3SNH A;  5J3Y A;  1FOE A;  1OY2 A;  1J0W A;  2EMT A;  2BCJ A;  4HAV B;  3PZD A;  2P0F A;  2RVB B;  2GJY A;  1X05 A;  1ZC4 B;  1WJ1 A;  4B6H A;  2LOX A;  3AU5 A;  5CLQ B;  4L6E A;  4MY6 A;  2N0Y A;  1U5G A;  1FHO A;  3N7C A;  3KY9 A;  2ZPY A;  1XR0 B;  2KGX B;  3FM8 C;  3P6A A;  2Z0P A;  3PVU A;  2XQN M;  5DH9 B;  2KCJ A;  2EJ8 A;  2DX5 A;  1NU2 A;  4A6F B;  3QWM A;  2Y8G A;  3KRW A;  5DI9 B;  3D8F A;  4GXB A;  2LKO A;  2I1K A;  3BIN A;  1OQN A;  1TQZ A;  2COD A;  5FI0 A;  4GMX B;  1KI1 B;  4HAY B;  5JHG A;  1RJ2 A;  2GS0 A;  5C5B B;  4Y94 A;  3ML4 A;  3SV1 A;  5HE0 A;  1ZVR A;  2COC A;  3QIJ A;  3SUZ A;  3GYP A;  4DX9 0;  2X18 A;  2RUK B;  2L1C A;  2YT1 A;  2DHK A;  3ODO A;  2AL6 A;  1Z87 A;  1M7R A;  1DDW A;  1BWN A;  4K2P A;  2RSG A;  3O96 A;  4HDQ A;  2D4Q A;  2KUP A;  4D0N B;  3WYF B;  2D9X A;  5EFX A;  2DA0 A;  2D10 A;  4HAW B;  1P6S A;  1I2H A;  2LOZ A;  2DYN A;  4K81 A;  1FB8 A;  5HE2 A;  4HB2 B;  1FHX A;  1W1G A;  1P3R A;  2R0D A;  3A8P A;  1V5M A;  1ZM0 A;  1ZSQ A;  2Y8F A;  2YT0 A;  5D27 A;  1SHC A;  2K2U A;  1EGX A;  2LG1 A;  4CHM A;  1EVH A;  1TJ6 A;  4MK0 A; 
#chains in the Genus database with same CATH topology
 5D3V A;  3B77 A;  3PVW A;  2GCJ A;  2KIE A;  3BJI A;  2UZR A;  1U29 A;  4EJN A;  5LOP B;  3P7Z A;  1E5W A;  4IFS A;  5DHF B;  4EMO A;  1ZC3 B;  5FI1 A;  4F7H A;  2IFS A;  5KQ1 A;  1MK9 B;  4HHV A;  2CY4 A;  1KZG A;  5C6R A;  2MKR A;  1WI1 A;  1V5U A;  3A58 A;  2COA A;  5JP4 A;  1BTN A;  3TO1 A;  2DFK A;  2D9W A;  5C5B A;  1Y5O A;  2CAY A;  3V5W A;  2Z0O A;  2I1J A;  3HSA A;  4P7I A;  1XX0 A;  4KHA A;  4HAX B;  5GOW B;  5D3Y A;  2DKP A;  3VIA A;  4YL8 A;  1SGH A;  2DLW A;  3PG7 A;  1IRS A;  2DN6 A;  2PZ1 A;  1XCG A;  2Z59 A;  3HK0 A;  1FAO A;  1XKE A;  2RNR B;  1U5D A;  2OQB A;  5C16 A;  4WVF B;  1K5D B;  2Z4D A;  1PMS A;  2K49 A;  4IAP A;  3ODX A;  3UZT A;  4A6F A;  1U27 A;  1BTK A;  3OAN A;  4H8S A;  4WJ7 A;  2VSZ A;  2DHJ A;  3AJ4 A;  3DXC A;  4GOU A;  5D3X A;  4L1R A;  3M1I B;  4HB0 B;  1UPQ A;  3HQC A;  2ELA A;  3X23 A;  3ZVR A;  1GC7 A;  2RLO A;  1I7A A;  4TYZ A;  4F7G A;  5CLL B;  3DXD A;  1UNP A;  1MKE A;  2Z14 A;  2RGN B;  4IOY X;  5J3Q A;  2H7E A;  1NTY A;  4GPT B;  2NZ8 B;  2W2X C;  1H4R A;  4MT7 A;  1P5T A;  2LYD A;  5HE1 A;  2HE7 A;  2Y7B A;  2D11 A;  3NSU A;  3WA0 A;  1WGQ A;  3T06 A;  3DCX A;  3HIE A;  1MAI A;  1WG7 A;  4Z2M B;  3NWD A;  1NTV A;  1W1D A;  1N3H A;  2D9Y A;  1UPR A;  2J0M A;  4CYE A;  4KVG B;  4PQ0 A;  4HB4 B;  2FJU B;  1MK7 B;  1OMW A;  4ZRK A;  2J59 M;  4GZU A;  4WSF A;  4DBB A;  3U7D A;  3CXB B;  3KZ1 A;  3TW1 A;  5LON B;  4QJ4 B;  2D9Z A;  3IVF A;  2ZKM X;  4OSN A;  2R2Y A;  2K00 A;  2RRF A;  1W1H A;  4EKU A;  4YON A;  4HAU B;  3VOQ A;  2R09 A;  4DX8 A;  1X86 A;  2DYQ A;  1UNQ A;  3PSC A;  1QC6 A;  4HAZ B;  2M14 A;  4HSI A;  1NI2 A;  2LUL A;  4GN1 A;  2ADZ A;  5HE3 A;  4QJ5 B;  4ZRI A;  4TKN A;  1FHW A;  3SYX A;  1FGY A;  1ISN A;  1XOD A;  3HW2 B;  3TCA A;  1U5E A;  3OHM B;  4ZRJ A;  1X11 A;  3D8D A;  4GNK B;  4HDO A;  4KHB B;  3TFM A;  1TXD A;  4K17 A;  2HTH B;  3TVV A;  4DIX A;  2I5C A;  2OTX A;  1DYN A;  3KRX A;  1EF1 A;  3FEH A;  2V76 A;  2W2X D;  3F0W A;  1KZ7 A;  1Y19 B;  3CIK A;  3AU4 A;  1RRP B;  4NSW A;  1XD4 A;  1EAZ A;  2D9V A;  2UVM A;  3FSS A;  1QQG A;  2AEH A;  1MIZ B;  2P0D A;  5DIF B;  2H7D A;  1LB1 A;  2GUM A;  2Q13 A;  5KQ4 A;  2I5F A;  2Z0Q A;  2QKL A;  2VKI A;  3SO6 A;  1X1F A;  2E2X A;  2YVC A;  3KSY A;  1PFJ A;  2N23 A;  1U5F A;  3A98 B;  2IYB A;  2UZS A;  1WJM A;  5DHA B;  2EC1 A;  5I2M A;  1DRO A;  1V61 A;  4QXA B;  3LJU X;  3PEG A;  2EMS A;  5C79 A;  4DXA B;  1V89 A;  1K5G B;  2DKQ A;  4A5K A;  2YRY A;  1DBH A;  4Z2N A;  2YT2 A;  2L2I A;  4D6W A;  1GG3 A;  2ROV A;  4K2O A;  3ZDT A;  2M38 A;  1Q67 A;  4PNK A;  4BBK A;  2YS1 A;  3PP2 A;  3NWA A;  4C0A A;  1M7E A;  2Z13 A;  5IRS A;  3QBV B;  1LW3 A;  1UEF A;  2W2W A;  2KIG A;  4HB3 B;  1PLS A;  5JHH A;  1V5P A;  2P0H A;  4KHB A;  2K2J A;  3DXE A;  3PVL A;  1DDV A;  1J19 A;  5J3T A;  5M4Y B;  2YS3 A;  2MDX A;  2YSZ A;  4A6H A;  2JP2 A;  2P8V A;  3ODW A;  4GMV A;  2VRW B;  3D8E A;  2D2Q A;  2ELB A;  1H10 A;  2MWN B;  2COF A;  5JLJ B;  2YS5 A;  2ROZ B;  1DDM A;  2GCL A;  2NMB A;  3U8Z A;  2DTC A;  1ZYI A;  1V88 A;  3G9W A;  2CY5 A;  4KHO A;  2QKM A;  3FVC A;  1WGU A;  2G35 A;  3MDB C;  2KUQ A;  3MPX A;  2J0K A;  4HAT B;  4NY0 A;  5D3W A;  3RCP A;  1AQC A;  1MPH A;  1UNR A;  1X1G A;  2DX1 A;  2YF0 A;  2FJL A;  5I2S A;  1B55 A;  4A6K A;  2DHI A;  4XWX A;  2J0J A;  3GYO A;  2MFQ A;  3F5R A;  3ULC A;  1WVH A;  2CRF A;  4CHJ A;  1MIX A;  1BAK A;  3ULB A;  1U2B A;  1FGZ A;  4KAX B;  1GC6 A;  3A8Q A;  5KCV A;  5L81 A;  4F7U P;  1AWE A;  1T77 A;  3SNH A;  5J3Y A;  1FOE A;  1OY2 A;  2KR0 A;  1J0W A;  2EMT A;  2BCJ A;  4HAV B;  3PZD A;  2P0F A;  2RVB B;  2GJY A;  3NWF A;  1X05 A;  1ZC4 B;  1WJ1 A;  4B6H A;  2LOX A;  3AU5 A;  5CLQ B;  4L6E A;  4MY6 A;  2N0Y A;  1U5G A;  1FHO A;  3N7C A;  3KY9 A;  2ZPY A;  1XR0 B;  2KGX B;  3FM8 C;  3P6A A;  2Z0P A;  3NW8 A;  3PVU A;  2XQN M;  5DH9 B;  2KCJ A;  2EJ8 A;  2DX5 A;  1NU2 A;  4A6F B;  3QWM A;  2Y8G A;  3KRW A;  5DI9 B;  3D8F A;  4GXB A;  4OT1 A;  2LKO A;  2I1K A;  3BIN A;  1OQN A;  1TQZ A;  2COD A;  4QJ3 B;  5FI0 A;  4GMX B;  1KI1 B;  4HAY B;  5JHG A;  1RJ2 A;  5LG4 B;  2GS0 A;  5C5B B;  4Y94 A;  3ML4 A;  3SV1 A;  5HE0 A;  1ZVR A;  2COC A;  3QIJ A;  3SUZ A;  1MI1 A;  3GYP A;  4DX9 0;  3U12 A;  2X18 A;  2RUK B;  2L1C A;  2YT1 A;  2DHK A;  3ODO A;  2AL6 A;  1Z87 A;  1M7R A;  1DDW A;  1BWN A;  4K2P A;  2RSG A;  3O96 A;  4HDQ A;  2D4Q A;  2KUP A;  4D0N B;  3WYF B;  2D9X A;  5EFX A;  2DA0 A;  2D10 A;  4HAW B;  1P6S A;  1I2H A;  4CSQ A;  2K8E A;  2DYN A;  2LOZ A;  4K81 A;  2NBV A;  1FB8 A;  5HE2 A;  1FHX A;  4HB2 B;  1W1G A;  1P3R A;  2R0D A;  3A8P A;  1V5M A;  1ZM0 A;  1ZSQ A;  2Y8F A;  2YT0 A;  5D27 A;  1SHC A;  2K2U A;  1EGX A;  2LG1 A;  4CHM A;  1EVH A;  1TJ6 A;  4MK0 A; 
#chains in the Genus database with same CATH homology
 5D3V A;  3PVW A;  2GCJ A;  3BJI A;  2UZR A;  1U29 A;  4EJN A;  5LOP B;  3P7Z A;  1E5W A;  4IFS A;  5DHF B;  4EMO A;  1ZC3 B;  5FI1 A;  4F7H A;  2IFS A;  5KQ1 A;  1MK9 B;  4HHV A;  2CY4 A;  1KZG A;  5C6R A;  2MKR A;  1WI1 A;  1V5U A;  2COA A;  5JP4 A;  1BTN A;  3TO1 A;  2DFK A;  2D9W A;  5C5B A;  1Y5O A;  2CAY A;  3V5W A;  2Z0O A;  2I1J A;  4P7I A;  1XX0 A;  4KHA A;  4HAX B;  5GOW B;  5D3Y A;  2DKP A;  3VIA A;  4YL8 A;  1SGH A;  2DLW A;  3PG7 A;  1IRS A;  2DN6 A;  2PZ1 A;  1XCG A;  3HK0 A;  1FAO A;  1XKE A;  2RNR B;  1U5D A;  2OQB A;  5C16 A;  4WVF B;  1K5D B;  1PMS A;  4IAP A;  3ODX A;  3UZT A;  4A6F A;  1U27 A;  1BTK A;  3OAN A;  4H8S A;  4WJ7 A;  2VSZ A;  2DHJ A;  3AJ4 A;  3DXC A;  5D3X A;  3M1I B;  4HB0 B;  1UPQ A;  3HQC A;  2ELA A;  3X23 A;  3ZVR A;  1GC7 A;  2RLO A;  1I7A A;  4TYZ A;  4F7G A;  5CLL B;  3DXD A;  1UNP A;  1MKE A;  2RGN B;  4IOY X;  5J3Q A;  2H7E A;  1NTY A;  4GPT B;  2NZ8 B;  2W2X C;  1H4R A;  4MT7 A;  1P5T A;  2LYD A;  5HE1 A;  2HE7 A;  2Y7B A;  2D11 A;  3NSU A;  3WA0 A;  1WGQ A;  3T06 A;  1MAI A;  1WG7 A;  4Z2M B;  1NTV A;  1W1D A;  1N3H A;  2D9Y A;  1UPR A;  2J0M A;  4CYE A;  4KVG B;  4PQ0 A;  4HB4 B;  1MK7 B;  1OMW A;  4ZRK A;  2J59 M;  4GZU A;  4WSF A;  4DBB A;  3U7D A;  3CXB B;  3KZ1 A;  3TW1 A;  5LON B;  2D9Z A;  3IVF A;  2K00 A;  1W1H A;  4EKU A;  4YON A;  4HAU B;  3VOQ A;  2R09 A;  4DX8 A;  1X86 A;  2DYQ A;  1UNQ A;  3PSC A;  1QC6 A;  4HAZ B;  2M14 A;  1NI2 A;  2LUL A;  4GN1 A;  2ADZ A;  5HE3 A;  4ZRI A;  4TKN A;  1FHW A;  3SYX A;  1FGY A;  1ISN A;  1XOD A;  3HW2 B;  3TCA A;  1U5E A;  4ZRJ A;  1X11 A;  3D8D A;  4HDO A;  4KHB B;  3TFM A;  1TXD A;  4K17 A;  2HTH B;  3TVV A;  2I5C A;  2OTX A;  1DYN A;  3KRX A;  1EF1 A;  3FEH A;  2V76 A;  2W2X D;  3F0W A;  1KZ7 A;  1Y19 B;  3CIK A;  3AU4 A;  1RRP B;  4NSW A;  1XD4 A;  1EAZ A;  2D9V A;  2UVM A;  3FSS A;  1QQG A;  2AEH A;  1MIZ B;  2P0D A;  5DIF B;  2H7D A;  1LB1 A;  2Q13 A;  5KQ4 A;  2I5F A;  2Z0Q A;  2QKL A;  2VKI A;  3SO6 A;  1X1F A;  2E2X A;  2YVC A;  3KSY A;  1PFJ A;  2N23 A;  1U5F A;  3A98 B;  2IYB A;  2UZS A;  1WJM A;  5DHA B;  2EC1 A;  1DRO A;  1V61 A;  3LJU X;  3PEG A;  2EMS A;  5C79 A;  4DXA B;  1V89 A;  1K5G B;  2DKQ A;  4A5K A;  2YRY A;  1DBH A;  4Z2N A;  2L2I A;  1GG3 A;  2ROV A;  4K2O A;  3ZDT A;  2M38 A;  1Q67 A;  4PNK A;  4BBK A;  2YS1 A;  3PP2 A;  4C0A A;  1M7E A;  3QBV B;  1LW3 A;  1UEF A;  2W2W A;  4HB3 B;  1PLS A;  5JHH A;  1V5P A;  2P0H A;  2K2J A;  3DXE A;  3PVL A;  1DDV A;  1J19 A;  5J3T A;  2YS3 A;  2MDX A;  2YSZ A;  4A6H A;  2JP2 A;  2P8V A;  3ODW A;  4GMV A;  2VRW B;  3D8E A;  2D2Q A;  2ELB A;  1H10 A;  2MWN B;  2COF A;  5JLJ B;  2YS5 A;  2ROZ B;  1DDM A;  2GCL A;  2NMB A;  3U8Z A;  2DTC A;  1V88 A;  3G9W A;  2CY5 A;  4KHO A;  2QKM A;  1WGU A;  2G35 A;  3MDB C;  4HAT B;  3MPX A;  2J0K A;  4NY0 A;  5D3W A;  3RCP A;  1AQC A;  1MPH A;  1UNR A;  1X1G A;  2DX1 A;  2YF0 A;  2FJL A;  1B55 A;  4A6K A;  2DHI A;  4XWX A;  2J0J A;  3GYO A;  2MFQ A;  3F5R A;  3ULC A;  1WVH A;  2CRF A;  4CHJ A;  1MIX A;  1BAK A;  3ULB A;  1U2B A;  1FGZ A;  4KAX B;  1GC6 A;  3A8Q A;  5KCV A;  5L81 A;  4F7U P;  1AWE A;  3SNH A;  5J3Y A;  1FOE A;  1OY2 A;  1J0W A;  2EMT A;  2BCJ A;  4HAV B;  3PZD A;  2P0F A;  2RVB B;  2GJY A;  1X05 A;  1ZC4 B;  1WJ1 A;  4B6H A;  2LOX A;  3AU5 A;  5CLQ B;  4L6E A;  4MY6 A;  2N0Y A;  1U5G A;  1FHO A;  3N7C A;  3KY9 A;  2ZPY A;  1XR0 B;  2KGX B;  3FM8 C;  3P6A A;  2Z0P A;  3PVU A;  2XQN M;  5DH9 B;  2KCJ A;  2EJ8 A;  2DX5 A;  1NU2 A;  4A6F B;  3QWM A;  2Y8G A;  3KRW A;  5DI9 B;  3D8F A;  4GXB A;  2LKO A;  2I1K A;  3BIN A;  1OQN A;  1TQZ A;  2COD A;  5FI0 A;  4GMX B;  1KI1 B;  4HAY B;  5JHG A;  1RJ2 A;  2GS0 A;  5C5B B;  4Y94 A;  3ML4 A;  3SV1 A;  5HE0 A;  1ZVR A;  2COC A;  3QIJ A;  3SUZ A;  3GYP A;  4DX9 0;  2X18 A;  2RUK B;  2L1C A;  2YT1 A;  2DHK A;  3ODO A;  2AL6 A;  1Z87 A;  1M7R A;  1DDW A;  1BWN A;  4K2P A;  2RSG A;  3O96 A;  4HDQ A;  2D4Q A;  2KUP A;  4D0N B;  3WYF B;  2D9X A;  5EFX A;  2DA0 A;  2D10 A;  4HAW B;  1P6S A;  1I2H A;  2LOZ A;  2DYN A;  4K81 A;  1FB8 A;  5HE2 A;  4HB2 B;  1FHX A;  1W1G A;  1P3R A;  2R0D A;  3A8P A;  1V5M A;  1ZM0 A;  1ZSQ A;  2Y8F A;  2YT0 A;  5D27 A;  1SHC A;  2K2U A;  1EGX A;  2LG1 A;  4CHM A;  1EVH A;  1TJ6 A;  4MK0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...