5L81A

Crystal structure of the ph domain of murine kindlin-3
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
133
structure length
133
Chain Sequence
SLTTIPELKDHLRIFRPRKLTLKGYRQYWVVFKDTTLSYYKSQDEAPGDPTQQLNLKGCEVVPDVNVSGQKFCIKLLVPSPEGMSEIYLRCQDEQQYAQWMAACRLASKGRTMADSSYASEVQAILAFLSLQR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Signaling protein
molecule keywords Fermitin family homolog 3
publication title Structure and lipid-binding properties of the kindlin-3 pleckstrin homology domain.
pubmed doi rcsb
source organism Mus musculus
total genus 31
structure length 133
sequence length 133
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 5l81A00
3CXBB 3TO1A 2I5CA 3ZVRA 4K81A 3HK0A 5HE0A 2PZ1A 2J0KA 1B55A 3PSCA 4HB4B 3D8DA 1U27A 2R09A 5C5BA 2P0FA 4WVFB 5GOWB 3ODOA 2RSGA 3PP2A 1WGQA 3TCAA 1FHXA 2BCJA 2DYNA 2Z0QA 3AU4A 5D3VA 2CODA 2E2XA 4NSWA 1Q67A 4ZRJA 3P6AA 2H7DA 2I1JA 5L81A 4CYEA 2K2JA 4DX8A 5C6RA 4P7IA 2COCA 2DLWA 4C0AA 2AEHA 2OQBA 4HAXB 2D9VA 2ZPYA 4CHMA 2G35A 1J0WA 1Y19B 1DDMA 3WA0A 3CIKA 5D27A 5C16A 1FOEA 2IYBA 4HHVA 4GMXB 1RRPB 2D10A 2P0DA 1V88A 1QC6A 3DXDA 3QBVB 5DHAB 1U5GA 2D2QA 1P5TA 2GCLA 3UZTA 4KAXB 1UNPA 1ZSQA 3A8PA 5C79A 5CLQB 1K5DB 2ADZA 3PEGA 3A98B 3FSSA 4L6EA 5LOPB 4A6FA 5FI1A 5D3XA 2W2XC 3ULCA 2LG1A 4YL8A 2YT1A 1V5PA 4D0NB 5J3QA 2VKIA 1NTYA 4KVGB 1KZ7A 1MIZB 4HB2B 2YF0A 1XKEA 3G9WA 3DXEA 5JLJB 2CY5A 1MK7B 4DXAB 2RUKB 4F7GA 3SV1A 2X18A 1UNRA 2EMTA 1MIXA 1DDVA 1X1GA 3U8ZA 2EC1A 4Y94A 3TFMA 1N3HA 1WG7A 2XQNM 1U5EA 1X1FA 1RJ2A 3P7ZA 4GN1A 4HATB 3WYFB 4MT7A 1FHOA 2MWNB 2AL6A 2QKMA 1OY2A 1SGHA 5DHFB 5HE3A 4ZRIA 1AQCA 4DX90 2UVMA 1P6SA 2D9YA 5J3TA 2DX1A 2GJYA 4HAYB 1V61A 1FGZA 2DKPA 2D11A 2M14A 1K5GB 1E5WA 2LYDA 2L1CA 2MFQA 1ISNA 3MPXA 4GXBA 2ELAA 1OMWA 4XWXA 2JP2A 4A5KA 4DBBA 2DYQA 1BTKA 1FGYA 2RNRB 2Y7BA 4MY6A 4F7UP 5EFXA 1LB1A 2M38A 5JHGA 1EAZA 1QQGA 2J59M 3HW2B 4CHJA 1LW3A 4KHAA 5HE2A 4B6HA 2YT0A 3OANA 4HB3B 2LULA 2V76A 2YS3A 3FM8C 1GC7A 1U5FA 3KZ1A 1I2HA 4EKUA 4NY0A 1WJ1A 2YS1A 4TKNA 4TYZA 2EJ8A 1U5DA 3SO6A 2CRFA 1P3RA 1UNQA 4EJNA 5JP4A 1AWEA 1TXDA 1Y5OA 2P8VA 3TW1A 1EF1A 1H4RA 2QKLA 2D9WA 4MK0A 2LKOA 1WVHA 5DH9B 3GYPA 1I7AA 3X23A 2P0HA 4KHOA 2D4QA 3IVFA 2HTHB 3ML4A 3PVUA 1DBHA 5KCVA 1XX0A 1ZM0A 2FJLA 3FEHA 2D9ZA 2NZ8B 2Q13A 5KQ4A 4GPTB 3KSYA 4H8SA 2DX5A 1FHWA 5LONB 2H7EA 4IFSA 4HAWB 2N0YA 2VRWB 5C5BB 2COFA 1TJ6A 2RGNB 4HDQA 3SNHA 2COAA 2EMSA 1XD4A 1XCGA 2ROZB 1ZC3B 1XR0B 2UZSA 3MDBC 2K00A 2DKQA 4WSFA 5D3YA 3O96A 1BTNA 3SUZA 3PZDA 2Y8GA 1DYNA 2LOXA 4PNKA 3ULBA 2NMBA 3TVVA 1DROA 1SHCA 2DHKA 2YVCA 3HQCA 1ZVRA 3U7DA 5HE1A 2W2XD 1X86A 1FAOA 1UPQA 3AJ4A 3BINA 5KQ1A 3SYXA 3D8EA 4YONA 3ODXA 3M1IB 3AU5A 3V5WA 2GCJA 2J0JA 3RCPA 1XODA 1J19A 4K17A 4K2PA 3A8QA 3VOQA 3KRXA 3VIAA 3F5RA 1UPRA 4HB0B 2RLOA 2CAYA 3D8FA 2MKRA 1W1HA 2KGXB 5CLLB 4A6FB 4BBKA 2ROVA 3DXCA 1UEFA 2DHJA 1NTVA 2RVBB 1DDWA 4GMVA 2DN6A 1U29A 1X05A 1X11A 1Z87A 3QWMA 1GC6A 3BJIA 2MDXA 3PG7A 3T06A 4IOYX 3N7CA 2D9XA 5D3WA 4GZUA 2YS5A 2GS0A 2W2WA 1EGXA 2UZRA 1MPHA 2KCJA 1NI2A 3KY9A 4WJ7A 5FI0A 4A6HA 5JHHA 2DHIA 2HE7A 1WI1A 3ODWA 1WGUA 1BWNA 3F0WA 1FB8A 2VSZA 1KZGA 1PFJA 3LJUX 3QIJA 3GYOA 4HAZB 3PVWA 4K2OA 2IFSA 2R0DA 4HDOA 3PVLA 1MAIA 2Z0PA 4ZRKA 4EMOA 1MK9B 2Y8FA 4A6KA 1H10A 1GG3A 2N23A 1NU2A 1KI1B 2Z0OA 2K2UA 3KRWA 1TQZA 1M7EA 1W1GA 1W1DA 1WJMA 2ELBA 4F7HA 1IRSA 1PLSA 5J3YA 1V5UA 2LOZA 4KHBB 4HAVB 2DTCA 4IAPA 1EVHA 4Z2MB 2DFKA 2KUPA 2CY4A 5DI9B 1PMSA 2L2IA 2OTXA 2DA0A 1MKEA 4Z2NA 3ZDTA 2I5FA 1BAKA 1M7RA 4PQ0A 1U2BA 2YRYA 1V89A 5DIFB 2YSZA 1V5MA 1OQNA 1ZC4B 2J0MA 3NSUA 2I1KA 4HAUB
chains in the Genus database with same CATH superfamily
3CXBB 3TO1A 2I5CA 4L1RA 3ZVRA 4K81A 3HK0A 5HE0A 2PZ1A 4GOUA 2J0KA 1B55A 3PSCA 4HB4B 3D8DA 1U27A 2R09A 5C5BA 2P0FA 4WVFB 5GOWB 3ODOA 2RSGA 3PP2A 1WGQA 3TCAA 1FHXA 2BCJA 2DYNA 2Z0QA 3AU4A 5D3VA 2CODA 2E2XA 4NSWA 1Q67A 4ZRJA 3DCXA 3P6AA 2H7DA 4OSNA 2I1JA 5L81A 4CYEA 2K2JA 4QXAB 4DX8A 5C6RA 4P7IA 2COCA 2DLWA 2YT2A 4C0AA 2AEHA 2OQBA 4HAXB 2D9VA 2ZPYA 4CHMA 2G35A 1J0WA 1Y19B 1DDMA 3WA0A 3CIKA 5D27A 1T77A 5C16A 1FOEA 2IYBA 4HHVA 4GMXB 1RRPB 2D10A 2P0DA 1V88A 1QC6A 3DXDA 3QBVB 5DHAB 1U5GA 2D2QA 1P5TA 2GCLA 3UZTA 4KAXB 1UNPA 1ZSQA 3A8PA 5C79A 5CLQB 1K5DB 2RRFA 2ADZA 3PEGA 3A98B 3FSSA 4L6EA 5LOPB 4A6FA 5FI1A 5D3XA 2W2XC 3ULCA 2LG1A 4YL8A 2YT1A 1V5PA 4D0NB 5J3QA 2VKIA 1NTYA 4KVGB 1KZ7A 2K8EA 1MIZB 3NWAA 4HB2B 2YF0A 1XKEA 3G9WA 3DXEA 5JLJB 2CY5A 1MK7B 4DXAB 2RUKB 4F7GA 3SV1A 2X18A 1UNRA 2EMTA 1MIXA 1DDVA 1X1GA 3U8ZA 2EC1A 4Y94A 3TFMA 3HSAA 1N3HA 1WG7A 2XQNM 1U5EA 4OT1A 1X1FA 1RJ2A 3P7ZA 4GN1A 4HATB 3WYFB 4MT7A 1FHOA 2MWNB 2AL6A 2QKMA 1OY2A 1SGHA 1ZYIA 5DHFB 5HE3A 4ZRIA 1AQCA 4DX90 2UVMA 5I2SA 1P6SA 2Z59A 2D9YA 5J3TA 2DX1A 2GJYA 4HAYB 2R2YA 1V61A 5LG4B 2KUQA 1FGZA 2DKPA 2D11A 2M14A 1K5GB 1E5WA 2LYDA 5I2MA 4KHBA 5IRSA 2L1CA 2MFQA 1ISNA 3MPXA 4GXBA 4D6WA 2ELAA 1OMWA 4XWXA 2JP2A 4A5KA 4DBBA 2DYQA 1BTKA 1FGYA 2RNRB 2Y7BA 4MY6A 4F7UP 5EFXA 1LB1A 2M38A 5JHGA 1EAZA 1QQGA 2J59M 3HW2B 4CHJA 1LW3A 4KHAA 5HE2A 4B6HA 2YT0A 3OANA 2KR0A 4HB3B 2LULA 2V76A 2YS3A 3FM8C 1GC7A 1U5FA 3KZ1A 1I2HA 4EKUA 4HSIA 4NY0A 4QJ5B 1WJ1A 1MI1A 2YS1A 4DIXA 4TKNA 4TYZA 2EJ8A 1U5DA 3SO6A 2CRFA 1P3RA 1UNQA 4EJNA 5JP4A 2ZKMX 1AWEA 1TXDA 1Y5OA 2P8VA 3FVCA 3TW1A 1EF1A 1H4RA 2QKLA 3HIEA 2D9WA 4MK0A 4CSQA 2LKOA 1WVHA 5DH9B 3GYPA 1I7AA 3X23A 2P0HA 4KHOA 2D4QA 3IVFA 2HTHB 2K49A 3ML4A 3PVUA 1DBHA 2KIEA 5KCVA 1XX0A 1ZM0A 2FJLA 3FEHA 2D9ZA 2NZ8B 2Q13A 5KQ4A 4GPTB 3KSYA 4H8SA 2DX5A 1FHWA 5LONB 2H7EA 4IFSA 4GNKB 4HAWB 2N0YA 2VRWB 5C5BB 2COFA 1TJ6A 2RGNB 4HDQA 3SNHA 2COAA 4QJ3B 2EMSA 5M4YB 1XD4A 1XCGA 2ROZB 1ZC3B 1XR0B 2UZSA 3MDBC 2K00A 2FJUB 2DKQA 4WSFA 5D3YA 3O96A 1BTNA 3SUZA 3PZDA 2Y8GA 1DYNA 2LOXA 4PNKA 2NBVA 3ULBA 2NMBA 3TVVA 1DROA 1SHCA 2DHKA 2YVCA 3HQCA 1ZVRA 2KIGA 3U7DA 5HE1A 2W2XD 1X86A 1FAOA 1UPQA 3AJ4A 3BINA 5KQ1A 3SYXA 3D8EA 4YONA 3ODXA 3M1IB 3AU5A 3V5WA 2GCJA 2J0JA 2Z14A 3RCPA 1XODA 1J19A 4K17A 4K2PA 3A8QA 3VOQA 3KRXA 3VIAA 3F5RA 4QJ4B 1UPRA 4HB0B 2RLOA 2CAYA 3D8FA 2MKRA 3U12A 1W1HA 2KGXB 5CLLB 4A6FB 4BBKA 2ROVA 3DXCA 1UEFA 2DHJA 1NTVA 2RVBB 1DDWA 4GMVA 2DN6A 1U29A 1X05A 1X11A 1Z87A 3QWMA 1GC6A 3BJIA 2MDXA 3PG7A 3T06A 4IOYX 3N7CA 2D9XA 5D3WA 3NWDA 4GZUA 2YS5A 2GS0A 2W2WA 3OHMB 1EGXA 2UZRA 1MPHA 2KCJA 3NWFA 1NI2A 3KY9A 4WJ7A 5FI0A 4A6HA 5JHHA 2DHIA 2HE7A 1WI1A 3ODWA 1WGUA 1BWNA 3F0WA 1FB8A 2VSZA 1KZGA 1PFJA 3LJUX 3QIJA 3GYOA 4HAZB 3PVWA 4K2OA 2Z13A 2IFSA 2R0DA 4HDOA 3PVLA 1MAIA 3NW8A 2Z0PA 4ZRKA 4EMOA 1MK9B 2Y8FA 4A6KA 1H10A 1GG3A 2N23A 1NU2A 1KI1B 2Z0OA 2K2UA 3KRWA 2Z4DA 3A58A 1TQZA 1M7EA 1W1GA 1W1DA 1WJMA 2ELBA 4F7HA 1IRSA 1PLSA 5J3YA 1V5UA 2LOZA 4KHBB 4HAVB 2DTCA 4IAPA 1EVHA 4Z2MB 2DFKA 2KUPA 3B77A 2CY4A 5DI9B 1PMSA 2L2IA 2OTXA 2DA0A 1MKEA 4Z2NA 3ZDTA 2I5FA 1BAKA 1M7RA 4PQ0A 1U2BA 2YRYA 1V89A 5DIFB 2YSZA 1V5MA 2GUMA 1OQNA 1ZC4B 2J0MA 3NSUA 2I1KA 4HAUB
chains in the Genus database with same CATH topology
3CXBB 3TO1A 2I5CA 3ZVRA 4K81A 3HK0A 5HE0A 2PZ1A 2J0KA 1B55A 3PSCA 4HB4B 3D8DA 1U27A 2R09A 5C5BA 2P0FA 4WVFB 5GOWB 3ODOA 2RSGA 3PP2A 1WGQA 3TCAA 1FHXA 2BCJA 2DYNA 2Z0QA 3AU4A 5D3VA 2CODA 2E2XA 4NSWA 1Q67A 4ZRJA 3P6AA 2H7DA 2I1JA 5L81A 4CYEA 2K2JA 4DX8A 5C6RA 4P7IA 2COCA 2DLWA 4C0AA 2AEHA 2OQBA 4HAXB 2D9VA 2ZPYA 4CHMA 2G35A 1J0WA 1Y19B 1DDMA 3WA0A 3CIKA 5D27A 5C16A 1FOEA 2IYBA 4HHVA 4GMXB 1RRPB 2D10A 2P0DA 1V88A 1QC6A 3DXDA 3QBVB 5DHAB 1U5GA 2D2QA 1P5TA 2GCLA 3UZTA 4KAXB 1UNPA 1ZSQA 3A8PA 5C79A 5CLQB 1K5DB 2ADZA 3PEGA 3A98B 3FSSA 4L6EA 5LOPB 4A6FA 5FI1A 5D3XA 2W2XC 3ULCA 2LG1A 4YL8A 2YT1A 1V5PA 4D0NB 5J3QA 2VKIA 1NTYA 4KVGB 1KZ7A 1MIZB 4HB2B 2YF0A 1XKEA 3G9WA 3DXEA 5JLJB 2CY5A 1MK7B 4DXAB 2RUKB 4F7GA 3SV1A 2X18A 1UNRA 2EMTA 1MIXA 1DDVA 1X1GA 3U8ZA 2EC1A 4Y94A 3TFMA 1N3HA 1WG7A 2XQNM 1U5EA 1X1FA 1RJ2A 3P7ZA 4GN1A 4HATB 3WYFB 4MT7A 1FHOA 2MWNB 2AL6A 2QKMA 1OY2A 1SGHA 5DHFB 5HE3A 4ZRIA 1AQCA 4DX90 2UVMA 1P6SA 2D9YA 5J3TA 2DX1A 2GJYA 4HAYB 1V61A 1FGZA 2DKPA 2D11A 2M14A 1K5GB 1E5WA 2LYDA 2L1CA 2MFQA 1ISNA 3MPXA 4GXBA 2ELAA 1OMWA 4XWXA 2JP2A 4A5KA 4DBBA 2DYQA 1BTKA 1FGYA 2RNRB 2Y7BA 4MY6A 4F7UP 5EFXA 1LB1A 2M38A 5JHGA 1EAZA 1QQGA 2J59M 3HW2B 4CHJA 1LW3A 4KHAA 5HE2A 4B6HA 2YT0A 3OANA 4HB3B 2LULA 2V76A 2YS3A 3FM8C 1GC7A 1U5FA 3KZ1A 1I2HA 4EKUA 4NY0A 1WJ1A 2YS1A 4TKNA 4TYZA 2EJ8A 1U5DA 3SO6A 2CRFA 1P3RA 1UNQA 4EJNA 5JP4A 1AWEA 1TXDA 1Y5OA 2P8VA 3TW1A 1EF1A 1H4RA 2QKLA 2D9WA 4MK0A 2LKOA 1WVHA 5DH9B 3GYPA 1I7AA 3X23A 2P0HA 4KHOA 2D4QA 3IVFA 2HTHB 3ML4A 3PVUA 1DBHA 5KCVA 1XX0A 1ZM0A 2FJLA 3FEHA 2D9ZA 2NZ8B 2Q13A 5KQ4A 4GPTB 3KSYA 4H8SA 2DX5A 1FHWA 5LONB 2H7EA 4IFSA 4HAWB 2N0YA 2VRWB 5C5BB 2COFA 1TJ6A 2RGNB 4HDQA 3SNHA 2COAA 2EMSA 1XD4A 1XCGA 2ROZB 1ZC3B 1XR0B 2UZSA 3MDBC 2K00A 2DKQA 4WSFA 5D3YA 3O96A 1BTNA 3SUZA 3PZDA 2Y8GA 1DYNA 2LOXA 4PNKA 3ULBA 2NMBA 3TVVA 1DROA 1SHCA 2DHKA 2YVCA 3HQCA 1ZVRA 3U7DA 5HE1A 2W2XD 1X86A 1FAOA 1UPQA 3AJ4A 3BINA 5KQ1A 3SYXA 3D8EA 4YONA 3ODXA 3M1IB 3AU5A 3V5WA 2GCJA 2J0JA 3RCPA 1XODA 1J19A 4K17A 4K2PA 3A8QA 3VOQA 3KRXA 3VIAA 3F5RA 1UPRA 4HB0B 2RLOA 2CAYA 3D8FA 2MKRA 1W1HA 2KGXB 5CLLB 4A6FB 4BBKA 2ROVA 3DXCA 1UEFA 2DHJA 1NTVA 2RVBB 1DDWA 4GMVA 2DN6A 1U29A 1X05A 1X11A 1Z87A 3QWMA 1GC6A 3BJIA 2MDXA 3PG7A 3T06A 4IOYX 3N7CA 2D9XA 5D3WA 4GZUA 2YS5A 2GS0A 2W2WA 1EGXA 2UZRA 1MPHA 2KCJA 1NI2A 3KY9A 4WJ7A 5FI0A 4A6HA 5JHHA 2DHIA 2HE7A 1WI1A 3ODWA 1WGUA 1BWNA 3F0WA 1FB8A 2VSZA 1KZGA 1PFJA 3LJUX 3QIJA 3GYOA 4HAZB 3PVWA 4K2OA 2IFSA 2R0DA 4HDOA 3PVLA 1MAIA 2Z0PA 4ZRKA 4EMOA 1MK9B 2Y8FA 4A6KA 1H10A 1GG3A 2N23A 1NU2A 1KI1B 2Z0OA 2K2UA 3KRWA 1TQZA 1M7EA 1W1GA 1W1DA 1WJMA 2ELBA 4F7HA 1IRSA 1PLSA 5J3YA 1V5UA 2LOZA 4KHBB 4HAVB 2DTCA 4IAPA 1EVHA 4Z2MB 2DFKA 2KUPA 2CY4A 5DI9B 1PMSA 2L2IA 2OTXA 2DA0A 1MKEA 4Z2NA 3ZDTA 2I5FA 1BAKA 1M7RA 4PQ0A 1U2BA 2YRYA 1V89A 5DIFB 2YSZA 1V5MA 1OQNA 1ZC4B 2J0MA 3NSUA 2I1KA 4HAUB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CXB B;  3TO1 A;  2I5C A;  3ZVR A;  4K81 A;  3HK0 A;  5HE0 A;  2PZ1 A;  2J0K A;  1B55 A;  3PSC A;  4HB4 B;  3D8D A;  1U27 A;  2R09 A;  5C5B A;  2P0F A;  4WVF B;  5GOW B;  3ODO A;  2RSG A;  3PP2 A;  1WGQ A;  3TCA A;  1FHX A;  2BCJ A;  2DYN A;  2Z0Q A;  3AU4 A;  5D3V A;  2COD A;  2E2X A;  4NSW A;  1Q67 A;  4ZRJ A;  3P6A A;  2H7D A;  2I1J A;  5L81 A;  4CYE A;  2K2J A;  4DX8 A;  5C6R A;  4P7I A;  2COC A;  2DLW A;  4C0A A;  2AEH A;  2OQB A;  4HAX B;  2D9V A;  2ZPY A;  4CHM A;  2G35 A;  1J0W A;  1Y19 B;  1DDM A;  3WA0 A;  3CIK A;  5D27 A;  5C16 A;  1FOE A;  2IYB A;  4HHV A;  4GMX B;  1RRP B;  2D10 A;  2P0D A;  1V88 A;  1QC6 A;  3DXD A;  3QBV B;  5DHA B;  1U5G A;  2D2Q A;  1P5T A;  2GCL A;  3UZT A;  4KAX B;  1UNP A;  1ZSQ A;  3A8P A;  5C79 A;  5CLQ B;  1K5D B;  2ADZ A;  3PEG A;  3A98 B;  3FSS A;  4L6E A;  5LOP B;  4A6F A;  5FI1 A;  5D3X A;  2W2X C;  3ULC A;  2LG1 A;  4YL8 A;  2YT1 A;  1V5P A;  4D0N B;  5J3Q A;  2VKI A;  1NTY A;  4KVG B;  1KZ7 A;  1MIZ B;  4HB2 B;  2YF0 A;  1XKE A;  3G9W A;  3DXE A;  5JLJ B;  2CY5 A;  1MK7 B;  4DXA B;  2RUK B;  4F7G A;  3SV1 A;  2X18 A;  1UNR A;  2EMT A;  1MIX A;  1DDV A;  1X1G A;  3U8Z A;  2EC1 A;  4Y94 A;  3TFM A;  1N3H A;  1WG7 A;  2XQN M;  1U5E A;  1X1F A;  1RJ2 A;  3P7Z A;  4GN1 A;  4HAT B;  3WYF B;  4MT7 A;  1FHO A;  2MWN B;  2AL6 A;  2QKM A;  1OY2 A;  1SGH A;  5DHF B;  5HE3 A;  4ZRI A;  1AQC A;  4DX9 0;  2UVM A;  1P6S A;  2D9Y A;  5J3T A;  2DX1 A;  2GJY A;  4HAY B;  1V61 A;  1FGZ A;  2DKP A;  2D11 A;  2M14 A;  1K5G B;  1E5W A;  2LYD A;  2L1C A;  2MFQ A;  1ISN A;  3MPX A;  4GXB A;  2ELA A;  1OMW A;  4XWX A;  2JP2 A;  4A5K A;  4DBB A;  2DYQ A;  1BTK A;  1FGY A;  2RNR B;  2Y7B A;  4MY6 A;  4F7U P;  5EFX A;  1LB1 A;  2M38 A;  5JHG A;  1EAZ A;  1QQG A;  2J59 M;  3HW2 B;  4CHJ A;  1LW3 A;  4KHA A;  5HE2 A;  4B6H A;  2YT0 A;  3OAN A;  4HB3 B;  2LUL A;  2V76 A;  2YS3 A;  3FM8 C;  1GC7 A;  1U5F A;  3KZ1 A;  1I2H A;  4EKU A;  4NY0 A;  1WJ1 A;  2YS1 A;  4TKN A;  4TYZ A;  2EJ8 A;  1U5D A;  3SO6 A;  2CRF A;  1P3R A;  1UNQ A;  4EJN A;  5JP4 A;  1AWE A;  1TXD A;  1Y5O A;  2P8V A;  3TW1 A;  1EF1 A;  1H4R A;  2QKL A;  2D9W A;  4MK0 A;  2LKO A;  1WVH A;  5DH9 B;  3GYP A;  1I7A A;  3X23 A;  2P0H A;  4KHO A;  2D4Q A;  3IVF A;  2HTH B;  3ML4 A;  3PVU A;  1DBH A;  5KCV A;  1XX0 A;  1ZM0 A;  2FJL A;  3FEH A;  2D9Z A;  2NZ8 B;  2Q13 A;  5KQ4 A;  4GPT B;  3KSY A;  4H8S A;  2DX5 A;  1FHW A;  5LON B;  2H7E A;  4IFS A;  4HAW B;  2N0Y A;  2VRW B;  5C5B B;  2COF A;  1TJ6 A;  2RGN B;  4HDQ A;  3SNH A;  2COA A;  2EMS A;  1XD4 A;  1XCG A;  2ROZ B;  1ZC3 B;  1XR0 B;  2UZS A;  3MDB C;  2K00 A;  2DKQ A;  4WSF A;  5D3Y A;  3O96 A;  1BTN A;  3SUZ A;  3PZD A;  2Y8G A;  1DYN A;  2LOX A;  4PNK A;  3ULB A;  2NMB A;  3TVV A;  1DRO A;  1SHC A;  2DHK A;  2YVC A;  3HQC A;  1ZVR A;  3U7D A;  5HE1 A;  2W2X D;  1X86 A;  1FAO A;  1UPQ A;  3AJ4 A;  3BIN A;  5KQ1 A;  3SYX A;  3D8E A;  4YON A;  3ODX A;  3M1I B;  3AU5 A;  3V5W A;  2GCJ A;  2J0J A;  3RCP A;  1XOD A;  1J19 A;  4K17 A;  4K2P A;  3A8Q A;  3VOQ A;  3KRX A;  3VIA A;  3F5R A;  1UPR A;  4HB0 B;  2RLO A;  2CAY A;  3D8F A;  2MKR A;  1W1H A;  2KGX B;  5CLL B;  4A6F B;  4BBK A;  2ROV A;  3DXC A;  1UEF A;  2DHJ A;  1NTV A;  2RVB B;  1DDW A;  4GMV A;  2DN6 A;  1U29 A;  1X05 A;  1X11 A;  1Z87 A;  3QWM A;  1GC6 A;  3BJI A;  2MDX A;  3PG7 A;  3T06 A;  4IOY X;  3N7C A;  2D9X A;  5D3W A;  4GZU A;  2YS5 A;  2GS0 A;  2W2W A;  1EGX A;  2UZR A;  1MPH A;  2KCJ A;  1NI2 A;  3KY9 A;  4WJ7 A;  5FI0 A;  4A6H A;  5JHH A;  2DHI A;  2HE7 A;  1WI1 A;  3ODW A;  1WGU A;  1BWN A;  3F0W A;  1FB8 A;  2VSZ A;  1KZG A;  1PFJ A;  3LJU X;  3QIJ A;  3GYO A;  4HAZ B;  3PVW A;  4K2O A;  2IFS A;  2R0D A;  4HDO A;  3PVL A;  1MAI A;  2Z0P A;  4ZRK A;  4EMO A;  1MK9 B;  2Y8F A;  4A6K A;  1H10 A;  1GG3 A;  2N23 A;  1NU2 A;  1KI1 B;  2Z0O A;  2K2U A;  3KRW A;  1TQZ A;  1M7E A;  1W1G A;  1W1D A;  1WJM A;  2ELB A;  4F7H A;  1IRS A;  1PLS A;  5J3Y A;  1V5U A;  2LOZ A;  4KHB B;  4HAV B;  2DTC A;  4IAP A;  1EVH A;  4Z2M B;  2DFK A;  2KUP A;  2CY4 A;  5DI9 B;  1PMS A;  2L2I A;  2OTX A;  2DA0 A;  1MKE A;  4Z2N A;  3ZDT A;  2I5F A;  1BAK A;  1M7R A;  4PQ0 A;  1U2B A;  2YRY A;  1V89 A;  5DIF B;  2YSZ A;  1V5M A;  1OQN A;  1ZC4 B;  2J0M A;  3NSU A;  2I1K A;  4HAU B; 
#chains in the Genus database with same CATH topology
 3CXB B;  3TO1 A;  2I5C A;  4L1R A;  3ZVR A;  4K81 A;  3HK0 A;  5HE0 A;  2PZ1 A;  4GOU A;  2J0K A;  1B55 A;  3PSC A;  4HB4 B;  3D8D A;  1U27 A;  2R09 A;  5C5B A;  2P0F A;  4WVF B;  5GOW B;  3ODO A;  2RSG A;  3PP2 A;  1WGQ A;  3TCA A;  1FHX A;  2BCJ A;  2DYN A;  2Z0Q A;  3AU4 A;  5D3V A;  2COD A;  2E2X A;  4NSW A;  1Q67 A;  4ZRJ A;  3DCX A;  3P6A A;  2H7D A;  4OSN A;  2I1J A;  5L81 A;  4CYE A;  2K2J A;  4QXA B;  4DX8 A;  5C6R A;  4P7I A;  2COC A;  2DLW A;  2YT2 A;  4C0A A;  2AEH A;  2OQB A;  4HAX B;  2D9V A;  2ZPY A;  4CHM A;  2G35 A;  1J0W A;  1Y19 B;  1DDM A;  3WA0 A;  3CIK A;  5D27 A;  1T77 A;  5C16 A;  1FOE A;  2IYB A;  4HHV A;  4GMX B;  1RRP B;  2D10 A;  2P0D A;  1V88 A;  1QC6 A;  3DXD A;  3QBV B;  5DHA B;  1U5G A;  2D2Q A;  1P5T A;  2GCL A;  3UZT A;  4KAX B;  1UNP A;  1ZSQ A;  3A8P A;  5C79 A;  5CLQ B;  1K5D B;  2RRF A;  2ADZ A;  3PEG A;  3A98 B;  3FSS A;  4L6E A;  5LOP B;  4A6F A;  5FI1 A;  5D3X A;  2W2X C;  3ULC A;  2LG1 A;  4YL8 A;  2YT1 A;  1V5P A;  4D0N B;  5J3Q A;  2VKI A;  1NTY A;  4KVG B;  1KZ7 A;  2K8E A;  1MIZ B;  3NWA A;  4HB2 B;  2YF0 A;  1XKE A;  3G9W A;  3DXE A;  5JLJ B;  2CY5 A;  1MK7 B;  4DXA B;  2RUK B;  4F7G A;  3SV1 A;  2X18 A;  1UNR A;  2EMT A;  1MIX A;  1DDV A;  1X1G A;  3U8Z A;  2EC1 A;  4Y94 A;  3TFM A;  3HSA A;  1N3H A;  1WG7 A;  2XQN M;  1U5E A;  4OT1 A;  1X1F A;  1RJ2 A;  3P7Z A;  4GN1 A;  4HAT B;  3WYF B;  4MT7 A;  1FHO A;  2MWN B;  2AL6 A;  2QKM A;  1OY2 A;  1SGH A;  1ZYI A;  5DHF B;  5HE3 A;  4ZRI A;  1AQC A;  4DX9 0;  2UVM A;  5I2S A;  1P6S A;  2Z59 A;  2D9Y A;  5J3T A;  2DX1 A;  2GJY A;  4HAY B;  2R2Y A;  1V61 A;  5LG4 B;  2KUQ A;  1FGZ A;  2DKP A;  2D11 A;  2M14 A;  1K5G B;  1E5W A;  2LYD A;  5I2M A;  4KHB A;  5IRS A;  2L1C A;  2MFQ A;  1ISN A;  3MPX A;  4GXB A;  4D6W A;  2ELA A;  1OMW A;  4XWX A;  2JP2 A;  4A5K A;  4DBB A;  2DYQ A;  1BTK A;  1FGY A;  2RNR B;  2Y7B A;  4MY6 A;  4F7U P;  5EFX A;  1LB1 A;  2M38 A;  5JHG A;  1EAZ A;  1QQG A;  2J59 M;  3HW2 B;  4CHJ A;  1LW3 A;  4KHA A;  5HE2 A;  4B6H A;  2YT0 A;  3OAN A;  2KR0 A;  4HB3 B;  2LUL A;  2V76 A;  2YS3 A;  3FM8 C;  1GC7 A;  1U5F A;  3KZ1 A;  1I2H A;  4EKU A;  4HSI A;  4NY0 A;  4QJ5 B;  1WJ1 A;  1MI1 A;  2YS1 A;  4DIX A;  4TKN A;  4TYZ A;  2EJ8 A;  1U5D A;  3SO6 A;  2CRF A;  1P3R A;  1UNQ A;  4EJN A;  5JP4 A;  2ZKM X;  1AWE A;  1TXD A;  1Y5O A;  2P8V A;  3FVC A;  3TW1 A;  1EF1 A;  1H4R A;  2QKL A;  3HIE A;  2D9W A;  4MK0 A;  4CSQ A;  2LKO A;  1WVH A;  5DH9 B;  3GYP A;  1I7A A;  3X23 A;  2P0H A;  4KHO A;  2D4Q A;  3IVF A;  2HTH B;  2K49 A;  3ML4 A;  3PVU A;  1DBH A;  2KIE A;  5KCV A;  1XX0 A;  1ZM0 A;  2FJL A;  3FEH A;  2D9Z A;  2NZ8 B;  2Q13 A;  5KQ4 A;  4GPT B;  3KSY A;  4H8S A;  2DX5 A;  1FHW A;  5LON B;  2H7E A;  4IFS A;  4GNK B;  4HAW B;  2N0Y A;  2VRW B;  5C5B B;  2COF A;  1TJ6 A;  2RGN B;  4HDQ A;  3SNH A;  2COA A;  4QJ3 B;  2EMS A;  5M4Y B;  1XD4 A;  1XCG A;  2ROZ B;  1ZC3 B;  1XR0 B;  2UZS A;  3MDB C;  2K00 A;  2FJU B;  2DKQ A;  4WSF A;  5D3Y A;  3O96 A;  1BTN A;  3SUZ A;  3PZD A;  2Y8G A;  1DYN A;  2LOX A;  4PNK A;  2NBV A;  3ULB A;  2NMB A;  3TVV A;  1DRO A;  1SHC A;  2DHK A;  2YVC A;  3HQC A;  1ZVR A;  2KIG A;  3U7D A;  5HE1 A;  2W2X D;  1X86 A;  1FAO A;  1UPQ A;  3AJ4 A;  3BIN A;  5KQ1 A;  3SYX A;  3D8E A;  4YON A;  3ODX A;  3M1I B;  3AU5 A;  3V5W A;  2GCJ A;  2J0J A;  2Z14 A;  3RCP A;  1XOD A;  1J19 A;  4K17 A;  4K2P A;  3A8Q A;  3VOQ A;  3KRX A;  3VIA A;  3F5R A;  4QJ4 B;  1UPR A;  4HB0 B;  2RLO A;  2CAY A;  3D8F A;  2MKR A;  3U12 A;  1W1H A;  2KGX B;  5CLL B;  4A6F B;  4BBK A;  2ROV A;  3DXC A;  1UEF A;  2DHJ A;  1NTV A;  2RVB B;  1DDW A;  4GMV A;  2DN6 A;  1U29 A;  1X05 A;  1X11 A;  1Z87 A;  3QWM A;  1GC6 A;  3BJI A;  2MDX A;  3PG7 A;  3T06 A;  4IOY X;  3N7C A;  2D9X A;  5D3W A;  3NWD A;  4GZU A;  2YS5 A;  2GS0 A;  2W2W A;  3OHM B;  1EGX A;  2UZR A;  1MPH A;  2KCJ A;  3NWF A;  1NI2 A;  3KY9 A;  4WJ7 A;  5FI0 A;  4A6H A;  5JHH A;  2DHI A;  2HE7 A;  1WI1 A;  3ODW A;  1WGU A;  1BWN A;  3F0W A;  1FB8 A;  2VSZ A;  1KZG A;  1PFJ A;  3LJU X;  3QIJ A;  3GYO A;  4HAZ B;  3PVW A;  4K2O A;  2Z13 A;  2IFS A;  2R0D A;  4HDO A;  3PVL A;  1MAI A;  3NW8 A;  2Z0P A;  4ZRK A;  4EMO A;  1MK9 B;  2Y8F A;  4A6K A;  1H10 A;  1GG3 A;  2N23 A;  1NU2 A;  1KI1 B;  2Z0O A;  2K2U A;  3KRW A;  2Z4D A;  3A58 A;  1TQZ A;  1M7E A;  1W1G A;  1W1D A;  1WJM A;  2ELB A;  4F7H A;  1IRS A;  1PLS A;  5J3Y A;  1V5U A;  2LOZ A;  4KHB B;  4HAV B;  2DTC A;  4IAP A;  1EVH A;  4Z2M B;  2DFK A;  2KUP A;  3B77 A;  2CY4 A;  5DI9 B;  1PMS A;  2L2I A;  2OTX A;  2DA0 A;  1MKE A;  4Z2N A;  3ZDT A;  2I5F A;  1BAK A;  1M7R A;  4PQ0 A;  1U2B A;  2YRY A;  1V89 A;  5DIF B;  2YSZ A;  1V5M A;  2GUM A;  1OQN A;  1ZC4 B;  2J0M A;  3NSU A;  2I1K A;  4HAU B; 
#chains in the Genus database with same CATH homology
 3CXB B;  3TO1 A;  2I5C A;  3ZVR A;  4K81 A;  3HK0 A;  5HE0 A;  2PZ1 A;  2J0K A;  1B55 A;  3PSC A;  4HB4 B;  3D8D A;  1U27 A;  2R09 A;  5C5B A;  2P0F A;  4WVF B;  5GOW B;  3ODO A;  2RSG A;  3PP2 A;  1WGQ A;  3TCA A;  1FHX A;  2BCJ A;  2DYN A;  2Z0Q A;  3AU4 A;  5D3V A;  2COD A;  2E2X A;  4NSW A;  1Q67 A;  4ZRJ A;  3P6A A;  2H7D A;  2I1J A;  5L81 A;  4CYE A;  2K2J A;  4DX8 A;  5C6R A;  4P7I A;  2COC A;  2DLW A;  4C0A A;  2AEH A;  2OQB A;  4HAX B;  2D9V A;  2ZPY A;  4CHM A;  2G35 A;  1J0W A;  1Y19 B;  1DDM A;  3WA0 A;  3CIK A;  5D27 A;  5C16 A;  1FOE A;  2IYB A;  4HHV A;  4GMX B;  1RRP B;  2D10 A;  2P0D A;  1V88 A;  1QC6 A;  3DXD A;  3QBV B;  5DHA B;  1U5G A;  2D2Q A;  1P5T A;  2GCL A;  3UZT A;  4KAX B;  1UNP A;  1ZSQ A;  3A8P A;  5C79 A;  5CLQ B;  1K5D B;  2ADZ A;  3PEG A;  3A98 B;  3FSS A;  4L6E A;  5LOP B;  4A6F A;  5FI1 A;  5D3X A;  2W2X C;  3ULC A;  2LG1 A;  4YL8 A;  2YT1 A;  1V5P A;  4D0N B;  5J3Q A;  2VKI A;  1NTY A;  4KVG B;  1KZ7 A;  1MIZ B;  4HB2 B;  2YF0 A;  1XKE A;  3G9W A;  3DXE A;  5JLJ B;  2CY5 A;  1MK7 B;  4DXA B;  2RUK B;  4F7G A;  3SV1 A;  2X18 A;  1UNR A;  2EMT A;  1MIX A;  1DDV A;  1X1G A;  3U8Z A;  2EC1 A;  4Y94 A;  3TFM A;  1N3H A;  1WG7 A;  2XQN M;  1U5E A;  1X1F A;  1RJ2 A;  3P7Z A;  4GN1 A;  4HAT B;  3WYF B;  4MT7 A;  1FHO A;  2MWN B;  2AL6 A;  2QKM A;  1OY2 A;  1SGH A;  5DHF B;  5HE3 A;  4ZRI A;  1AQC A;  4DX9 0;  2UVM A;  1P6S A;  2D9Y A;  5J3T A;  2DX1 A;  2GJY A;  4HAY B;  1V61 A;  1FGZ A;  2DKP A;  2D11 A;  2M14 A;  1K5G B;  1E5W A;  2LYD A;  2L1C A;  2MFQ A;  1ISN A;  3MPX A;  4GXB A;  2ELA A;  1OMW A;  4XWX A;  2JP2 A;  4A5K A;  4DBB A;  2DYQ A;  1BTK A;  1FGY A;  2RNR B;  2Y7B A;  4MY6 A;  4F7U P;  5EFX A;  1LB1 A;  2M38 A;  5JHG A;  1EAZ A;  1QQG A;  2J59 M;  3HW2 B;  4CHJ A;  1LW3 A;  4KHA A;  5HE2 A;  4B6H A;  2YT0 A;  3OAN A;  4HB3 B;  2LUL A;  2V76 A;  2YS3 A;  3FM8 C;  1GC7 A;  1U5F A;  3KZ1 A;  1I2H A;  4EKU A;  4NY0 A;  1WJ1 A;  2YS1 A;  4TKN A;  4TYZ A;  2EJ8 A;  1U5D A;  3SO6 A;  2CRF A;  1P3R A;  1UNQ A;  4EJN A;  5JP4 A;  1AWE A;  1TXD A;  1Y5O A;  2P8V A;  3TW1 A;  1EF1 A;  1H4R A;  2QKL A;  2D9W A;  4MK0 A;  2LKO A;  1WVH A;  5DH9 B;  3GYP A;  1I7A A;  3X23 A;  2P0H A;  4KHO A;  2D4Q A;  3IVF A;  2HTH B;  3ML4 A;  3PVU A;  1DBH A;  5KCV A;  1XX0 A;  1ZM0 A;  2FJL A;  3FEH A;  2D9Z A;  2NZ8 B;  2Q13 A;  5KQ4 A;  4GPT B;  3KSY A;  4H8S A;  2DX5 A;  1FHW A;  5LON B;  2H7E A;  4IFS A;  4HAW B;  2N0Y A;  2VRW B;  5C5B B;  2COF A;  1TJ6 A;  2RGN B;  4HDQ A;  3SNH A;  2COA A;  2EMS A;  1XD4 A;  1XCG A;  2ROZ B;  1ZC3 B;  1XR0 B;  2UZS A;  3MDB C;  2K00 A;  2DKQ A;  4WSF A;  5D3Y A;  3O96 A;  1BTN A;  3SUZ A;  3PZD A;  2Y8G A;  1DYN A;  2LOX A;  4PNK A;  3ULB A;  2NMB A;  3TVV A;  1DRO A;  1SHC A;  2DHK A;  2YVC A;  3HQC A;  1ZVR A;  3U7D A;  5HE1 A;  2W2X D;  1X86 A;  1FAO A;  1UPQ A;  3AJ4 A;  3BIN A;  5KQ1 A;  3SYX A;  3D8E A;  4YON A;  3ODX A;  3M1I B;  3AU5 A;  3V5W A;  2GCJ A;  2J0J A;  3RCP A;  1XOD A;  1J19 A;  4K17 A;  4K2P A;  3A8Q A;  3VOQ A;  3KRX A;  3VIA A;  3F5R A;  1UPR A;  4HB0 B;  2RLO A;  2CAY A;  3D8F A;  2MKR A;  1W1H A;  2KGX B;  5CLL B;  4A6F B;  4BBK A;  2ROV A;  3DXC A;  1UEF A;  2DHJ A;  1NTV A;  2RVB B;  1DDW A;  4GMV A;  2DN6 A;  1U29 A;  1X05 A;  1X11 A;  1Z87 A;  3QWM A;  1GC6 A;  3BJI A;  2MDX A;  3PG7 A;  3T06 A;  4IOY X;  3N7C A;  2D9X A;  5D3W A;  4GZU A;  2YS5 A;  2GS0 A;  2W2W A;  1EGX A;  2UZR A;  1MPH A;  2KCJ A;  1NI2 A;  3KY9 A;  4WJ7 A;  5FI0 A;  4A6H A;  5JHH A;  2DHI A;  2HE7 A;  1WI1 A;  3ODW A;  1WGU A;  1BWN A;  3F0W A;  1FB8 A;  2VSZ A;  1KZG A;  1PFJ A;  3LJU X;  3QIJ A;  3GYO A;  4HAZ B;  3PVW A;  4K2O A;  2IFS A;  2R0D A;  4HDO A;  3PVL A;  1MAI A;  2Z0P A;  4ZRK A;  4EMO A;  1MK9 B;  2Y8F A;  4A6K A;  1H10 A;  1GG3 A;  2N23 A;  1NU2 A;  1KI1 B;  2Z0O A;  2K2U A;  3KRW A;  1TQZ A;  1M7E A;  1W1G A;  1W1D A;  1WJM A;  2ELB A;  4F7H A;  1IRS A;  1PLS A;  5J3Y A;  1V5U A;  2LOZ A;  4KHB B;  4HAV B;  2DTC A;  4IAP A;  1EVH A;  4Z2M B;  2DFK A;  2KUP A;  2CY4 A;  5DI9 B;  1PMS A;  2L2I A;  2OTX A;  2DA0 A;  1MKE A;  4Z2N A;  3ZDT A;  2I5F A;  1BAK A;  1M7R A;  4PQ0 A;  1U2B A;  2YRY A;  1V89 A;  5DIF B;  2YSZ A;  1V5M A;  1OQN A;  1ZC4 B;  2J0M A;  3NSU A;  2I1K A;  4HAU B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...