5L81A

Crystal structure of the ph domain of murine kindlin-3
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
133
structure length
133
Chain Sequence
b'SLTTIPELKDHLRIFRPRKLTLKGYRQYWVVFKDTTLSYYKSQDEAPGDPTQQLNLKGCEVVPDVNVSGQKFCIKLLVPSPEGMSEIYLRCQDEQQYAQWMAACRLASKGRTMADSSYASEVQAILAFLSLQR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Fermitin family homolog 3
publication title Structure and lipid-binding properties of the kindlin-3 pleckstrin homology domain.
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
total genus 31
structure length 133
sequence length 133
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 5l81A00
2COFA 2J0KA 1WGUA 2M38A 1Z87A 2W2WA 1WVHA 1U5FA 2IYBA 5D3XA 3UZTA 2W2XC 4GZUA 1PFJA 4PNKA 5LONB 2CY5A 3PVLA 1RRPB 1FHXA 2DKQA 3LJUX 1TJ6A 3PSCA 1GC7A 1WJMA 4B6HA 4F7HA 4HB2B 2EMSA 5D3YA 2M14A 3DXCA 1W1HA 1DDVA 5J3TA 3CIKA 3RCPA 2Y8GA 1U5GA 2D10A 1UPQA 1DDWA 1GC6A 2DHKA 3O96A 2Z0PA 2Q13A 3BINA 4HB3B 1M7RA 3N7CA 2P0FA 1QC6A 2LKOA 2I1JA 2J59M 1MK9B 4A6KA 2RLOA 1U5DA 4MT7A 3QIJA 2ZPYA 3WA0A 4EKUA 2W2XD 2PZ1A 1Q67A 5J3QA 1K5GB 2DHIA 1ZC4B 2ELBA 1MPHA 4WJ7A 4NSWA 1M7EA 1U5EA 1MIZB 1B55A 4K2PA 3MPXA 1P3RA 2OQBA 2QKLA 2Z0OA 1U2BA 2CAYA 2AL6A 4IOYX 2NZ8B 4Z2NA 2VRWB 4KHAA 4MK0A 5HE1A 2AEHA 3PEGA 4DX90 2GJYA 5JHHA 3A98B 2D2QA 2P8VA 3P6AA 5DHFB 3TO1A 5D3VA 1BTNA 1FHOA 3PP2A 2NMBA 3HQCA 1KZ7A 3DXEA 4HHVA 3SUZA 1BAKA 2YSZA 4YL8A 1OQNA 4HB4B 2H7DA 1PLSA 3X23A 4KAXB 2GS0A 1WI1A 2H7EA 3AU4A 5FI0A 2COCA 3P7ZA 1DYNA 1X1GA 2I5FA 3FEHA 1SGHA 1X86A 2ADZA 4K2OA 1I7AA 3F5RA 1FGZA 1UPRA 1DDMA 2YT1A 1K5DB 4WSFA 2N0YA 1TQZA 2EMTA 3CXBB 4HAYB 1EGXA 2XQNM 2DYNA 3SYXA 1KZGA 4D0NB 4HAVB 4IFSA 3ML4A 1U29A 2YRYA 5L81A 5KQ1A 3PVUA 3AJ4A 1MAIA 3DXDA 5DIFB 2RUKB 4ZRIA 5LOPB 1P5TA 2EJ8A 2IFSA 5HE3A 2DLWA 1V5PA 2LYDA 4HDOA 1EVHA 1FHWA 2YVCA 1ISNA 5C6RA 1P6SA 3VIAA 1ZSQA 2CRFA 3FSSA 3OANA 2MWNB 2YS1A 4Y94A 3AU5A 3D8FA 2V76A 1Y19B 4GXBA 5C16A 1TXDA 3TFMA 1X05A 4NY0A 5C5BB 5JP4A 4F7GA 2J0MA 1BTKA 3BJIA 2UVMA 4Z2MB 4HAZB 3IVFA 3KRWA 3GYOA 5C79A 1EF1A 4TKNA 2Z0QA 1NU2A 4GPTB 4A6FB 3FM8C 2FJLA 5DH9B 2DN6A 2VKIA 4DX8A 1FAOA 1W1DA 1AWEA 1V5MA 3KRXA 2DA0A 1I2HA 1XKEA 2D11A 4HDQA 3PVWA 5KCVA 2MDXA 4CYEA 2RNRB 2ROVA 2ELAA 4CHMA 2MFQA 4F7UP 5FI1A 4K81A 4ZRJA 4CHJA 3U8ZA 2YF0A 2I5CA 1ZC3B 5KQ4A 3A8QA 3D8EA 4TYZA 4PQ0A 2DTCA 3SV1A 2J0JA 4DBBA 3TW1A 2G35A 5J3YA 3ULBA 2YS3A 1V88A 3T06A 5HE2A 2UZSA 4GMXB 4A6FA 2GCJA 2KGXB 1J0WA 3VOQA 1XD4A 1E5WA 2DYQA 2GCLA 2L1CA 2D9YA 1ZM0A 4HAXB 4YONA 3U7DA 2EC1A 2LOXA 1UNPA 5DHAB 1BWNA 2K2UA 2RSGA 3ULCA 3MDBC 1GG3A 1MK7B 2D9VA 2RGNB 4DXAB 1OMWA 2D4QA 3PZDA 3WYFB 2Y8FA 1X1FA 1NTYA 4EMOA 1J19A 2D9XA 1FB8A 2LULA 2YT0A 4H8SA 2YS5A 3KZ1A 3TCAA 4K17A 1AQCA 4KHBB 2LOZA 5JHGA 4HAUB 5JLJB 5HE0A 1W1GA 3V5WA 2DX5A 1XODA 1OY2A 3NSUA 4IAPA 1H10A 3ODWA 3GYPA 3KSYA 4L6EA 4EJNA 2JP2A 1FOEA 1NTVA 5DI9B 4HAWB 3QBVB 1XCGA 2N23A 3HW2B 2E2XA 2KUPA 3M1IB 3SNHA 2Y7BA 2DFKA 2K2JA 1Y5OA 2OTXA 1EAZA 1SHCA 1XX0A 1WJ1A 1XR0B 4KHOA 4P7IA 2DKPA 3HK0A 1FGYA 1IRSA 1UEFA 5GOWB 2HTHB 1DBHA 2DX1A 2L2IA 3SO6A 1UNQA 1LB1A 2P0DA 1MIXA 1U27A 4MY6A 3TVVA 2KCJA 2VSZA 3D8DA 1QQGA 2I1KA 2HE7A 5CLLB 3ZDTA 1PMSA 4GN1A 2COAA 1V5UA 1DROA 4HATB 4WVFB 3ZVRA 3A8PA 3F0WA 4A5KA 4A6HA 5C5BA 2P0HA 1LW3A 4BBKA 2BCJA 2R0DA 4XWXA 5CLQB 1V89A 2UZRA 4GMVA 4KVGB 2RVBB 4HB0B 2X18A 3ODXA 5D3WA 1KI1B 2LG1A 1X11A 1H4RA 3G9WA 5EFXA 1MKEA 1RJ2A 3ODOA 2MKRA 2QKMA 1WG7A 2ROZB 2CODA 3KY9A 2D9WA 1V61A 1N3HA 1UNRA 4C0AA 3PG7A 2R09A 2K00A 2CY4A 2D9ZA 5D27A 3QWMA 1WGQA 1ZVRA 4ZRKA 2DHJA 1NI2A
chains in the Genus database with same CATH superfamily
2COFA 2J0KA 1WGUA 2M38A 1Z87A 2W2WA 1WVHA 1U5FA 2IYBA 5D3XA 3UZTA 2W2XC 4GZUA 2K49A 1PFJA 4PNKA 5LONB 2CY5A 3PVLA 1RRPB 1FHXA 2DKQA 3LJUX 1TJ6A 3PSCA 1GC7A 1WJMA 4B6HA 4F7HA 4HB2B 2EMSA 2KIEA 5D3YA 2M14A 3DXCA 1W1HA 1DDVA 5J3TA 3CIKA 3RCPA 2Y8GA 1U5GA 2D10A 1ZYIA 1UPQA 1DDWA 1GC6A 2DHKA 2KIGA 3O96A 2Z0PA 2Q13A 3BINA 4HB3B 1M7RA 4OT1A 3N7CA 2P0FA 1QC6A 2LKOA 2I1JA 2J59M 1MK9B 4A6KA 2RLOA 1U5DA 4MT7A 3U12A 3QIJA 2ZPYA 3WA0A 4EKUA 2W2XD 2PZ1A 2Z4DA 1MI1A 1Q67A 2K8EA 5J3QA 1K5GB 2DHIA 4KHBA 1ZC4B 2ELBA 1MPHA 4WJ7A 4NSWA 1M7EA 1U5EA 2RRFA 1MIZB 1B55A 4K2PA 3MPXA 1P3RA 2OQBA 2QKLA 2Z0OA 1U2BA 4QJ4B 2CAYA 2AL6A 4IOYX 2NZ8B 4Z2NA 2Z14A 2VRWB 2NBVA 2KUQA 4KHAA 4MK0A 5HE1A 2AEHA 3PEGA 4DX90 2GJYA 5JHHA 3A98B 2D2QA 2P8VA 3HSAA 3P6AA 5DHFB 3TO1A 5D3VA 1BTNA 4CSQA 1FHOA 3PP2A 2NMBA 3HQCA 1KZ7A 3DXEA 4HHVA 3SUZA 1BAKA 2YSZA 4YL8A 1OQNA 4HB4B 2H7DA 1PLSA 3X23A 4KAXB 2GS0A 1WI1A 2H7EA 3AU4A 5FI0A 2COCA 3P7ZA 1DYNA 1X1GA 2I5FA 3FEHA 1SGHA 1X86A 2ADZA 5IRSA 2Z59A 3NW8A 4K2OA 1I7AA 3F5RA 1FGZA 3B77A 1UPRA 1DDMA 2YT1A 1K5DB 4OSNA 4WSFA 2N0YA 1TQZA 2EMTA 3CXBB 4HAYB 1EGXA 2XQNM 4QJ5B 2DYNA 3SYXA 1KZGA 4GOUA 4D0NB 4HAVB 4IFSA 3ML4A 1U29A 2YRYA 5L81A 5KQ1A 3PVUA 3AJ4A 2Z13A 1MAIA 3DXDA 5DIFB 2RUKB 4ZRIA 5LOPB 5LG4B 1P5TA 2EJ8A 2IFSA 5HE3A 2DLWA 1V5PA 2LYDA 4HDOA 1EVHA 1FHWA 2YVCA 1ISNA 5C6RA 1P6SA 3VIAA 2YT2A 1ZSQA 2CRFA 3FSSA 3OANA 2MWNB 2YS1A 4Y94A 3AU5A 3D8FA 2V76A 1Y19B 4GXBA 5C16A 1TXDA 3TFMA 1X05A 4NY0A 5C5BB 5JP4A 4F7GA 2J0MA 1BTKA 2ZKMX 3BJIA 2UVMA 4Z2MB 4HAZB 3IVFA 3KRWA 3GYOA 5C79A 1EF1A 4TKNA 2Z0QA 1NU2A 4GPTB 4A6FB 3FM8C 2FJLA 5DH9B 2DN6A 4L1RA 2VKIA 2GUMA 4DX8A 1FAOA 1W1DA 1AWEA 1V5MA 3KRXA 2DA0A 1I2HA 1XKEA 2D11A 3NWAA 4HDQA 3PVWA 5KCVA 2MDXA 4CYEA 2RNRB 2ROVA 2ELAA 4CHMA 2MFQA 4F7UP 5FI1A 4K81A 4ZRJA 5I2MA 4CHJA 3U8ZA 2YF0A 2I5CA 1ZC3B 5KQ4A 3A8QA 3D8EA 4TYZA 4PQ0A 2DTCA 3SV1A 2J0JA 4DBBA 3TW1A 2G35A 1T77A 5J3YA 3ULBA 2YS3A 1V88A 3T06A 5HE2A 2UZSA 4GMXB 4A6FA 2GCJA 2KGXB 1J0WA 3VOQA 1XD4A 3A58A 1E5WA 2DYQA 2GCLA 2L1CA 2D9YA 1ZM0A 4HAXB 4YONA 3U7DA 2EC1A 2LOXA 1UNPA 5DHAB 1BWNA 2K2UA 4QJ3B 2RSGA 3ULCA 3MDBC 1GG3A 1MK7B 2D9VA 2RGNB 4DXAB 1OMWA 2D4QA 3PZDA 3WYFB 2Y8FA 1X1FA 1NTYA 4EMOA 1J19A 3HIEA 4QXAB 2D9XA 1FB8A 2LULA 2YT0A 4H8SA 2YS5A 3KZ1A 3TCAA 4K17A 1AQCA 4KHBB 2LOZA 5JHGA 4HAUB 5JLJB 5HE0A 1W1GA 3V5WA 2DX5A 1XODA 5I2SA 1OY2A 3NSUA 4IAPA 1H10A 3ODWA 3GYPA 3KSYA 4L6EA 4EJNA 2JP2A 1FOEA 1NTVA 5DI9B 3NWDA 4HAWB 3QBVB 1XCGA 2N23A 3HW2B 3FVCA 2E2XA 2KUPA 3M1IB 3SNHA 2Y7BA 2DFKA 2K2JA 1Y5OA 2OTXA 1EAZA 1SHCA 1XX0A 1WJ1A 1XR0B 4KHOA 4P7IA 2DKPA 3HK0A 1FGYA 3NWFA 1IRSA 1UEFA 5GOWB 2HTHB 1DBHA 2DX1A 2L2IA 3SO6A 1UNQA 1LB1A 2P0DA 2R2YA 1MIXA 1U27A 4MY6A 3TVVA 2KCJA 2VSZA 3D8DA 1QQGA 2I1KA 2HE7A 5CLLB 3ZDTA 1PMSA 4GN1A 5M4YB 2COAA 4HSIA 1V5UA 1DROA 4D6WA 4HATB 4WVFB 3ZVRA 3A8PA 3F0WA 4A5KA 4A6HA 5C5BA 2P0HA 1LW3A 4BBKA 2BCJA 2R0DA 4XWXA 5CLQB 1V89A 2UZRA 4DIXA 4GMVA 4KVGB 2RVBB 4HB0B 2X18A 3ODXA 5D3WA 1KI1B 2FJUB 3OHMB 2LG1A 1X11A 1H4RA 3G9WA 5EFXA 1MKEA 1RJ2A 2KR0A 3DCXA 3ODOA 2MKRA 2QKMA 1WG7A 2ROZB 2CODA 3KY9A 2D9WA 4GNKB 1V61A 1N3HA 1UNRA 4C0AA 3PG7A 2R09A 2K00A 2CY4A 2D9ZA 5D27A 3QWMA 1WGQA 1ZVRA 4ZRKA 2DHJA 1NI2A
chains in the Genus database with same CATH topology
2COFA 2J0KA 1WGUA 2M38A 1Z87A 2W2WA 1WVHA 1U5FA 2IYBA 5D3XA 3UZTA 2W2XC 4GZUA 1PFJA 4PNKA 5LONB 2CY5A 3PVLA 1RRPB 1FHXA 2DKQA 3LJUX 1TJ6A 3PSCA 1GC7A 1WJMA 4B6HA 4F7HA 4HB2B 2EMSA 5D3YA 2M14A 3DXCA 1W1HA 1DDVA 5J3TA 3CIKA 3RCPA 2Y8GA 1U5GA 2D10A 1UPQA 1DDWA 1GC6A 2DHKA 3O96A 2Z0PA 2Q13A 3BINA 4HB3B 1M7RA 3N7CA 2P0FA 1QC6A 2LKOA 2I1JA 2J59M 1MK9B 4A6KA 2RLOA 1U5DA 4MT7A 3QIJA 2ZPYA 3WA0A 4EKUA 2W2XD 2PZ1A 1Q67A 5J3QA 1K5GB 2DHIA 1ZC4B 2ELBA 1MPHA 4WJ7A 4NSWA 1M7EA 1U5EA 1MIZB 1B55A 4K2PA 3MPXA 1P3RA 2OQBA 2QKLA 2Z0OA 1U2BA 2CAYA 2AL6A 4IOYX 2NZ8B 4Z2NA 2VRWB 4KHAA 4MK0A 5HE1A 2AEHA 3PEGA 4DX90 2GJYA 5JHHA 3A98B 2D2QA 2P8VA 3P6AA 5DHFB 3TO1A 5D3VA 1BTNA 1FHOA 3PP2A 2NMBA 3HQCA 1KZ7A 3DXEA 4HHVA 3SUZA 1BAKA 2YSZA 4YL8A 1OQNA 4HB4B 2H7DA 1PLSA 3X23A 4KAXB 2GS0A 1WI1A 2H7EA 3AU4A 5FI0A 2COCA 3P7ZA 1DYNA 1X1GA 2I5FA 3FEHA 1SGHA 1X86A 2ADZA 4K2OA 1I7AA 3F5RA 1FGZA 1UPRA 1DDMA 2YT1A 1K5DB 4WSFA 2N0YA 1TQZA 2EMTA 3CXBB 4HAYB 1EGXA 2XQNM 2DYNA 3SYXA 1KZGA 4D0NB 4HAVB 4IFSA 3ML4A 1U29A 2YRYA 5L81A 5KQ1A 3PVUA 3AJ4A 1MAIA 3DXDA 5DIFB 2RUKB 4ZRIA 5LOPB 1P5TA 2EJ8A 2IFSA 5HE3A 2DLWA 1V5PA 2LYDA 4HDOA 1EVHA 1FHWA 2YVCA 1ISNA 5C6RA 1P6SA 3VIAA 1ZSQA 2CRFA 3FSSA 3OANA 2MWNB 2YS1A 4Y94A 3AU5A 3D8FA 2V76A 1Y19B 4GXBA 5C16A 1TXDA 3TFMA 1X05A 4NY0A 5C5BB 5JP4A 4F7GA 2J0MA 1BTKA 3BJIA 2UVMA 4Z2MB 4HAZB 3IVFA 3KRWA 3GYOA 5C79A 1EF1A 4TKNA 2Z0QA 1NU2A 4GPTB 4A6FB 3FM8C 2FJLA 5DH9B 2DN6A 2VKIA 4DX8A 1FAOA 1W1DA 1AWEA 1V5MA 3KRXA 2DA0A 1I2HA 1XKEA 2D11A 4HDQA 3PVWA 5KCVA 2MDXA 4CYEA 2RNRB 2ROVA 2ELAA 4CHMA 2MFQA 4F7UP 5FI1A 4K81A 4ZRJA 4CHJA 3U8ZA 2YF0A 2I5CA 1ZC3B 5KQ4A 3A8QA 3D8EA 4TYZA 4PQ0A 2DTCA 3SV1A 2J0JA 4DBBA 3TW1A 2G35A 5J3YA 3ULBA 2YS3A 1V88A 3T06A 5HE2A 2UZSA 4GMXB 4A6FA 2GCJA 2KGXB 1J0WA 3VOQA 1XD4A 1E5WA 2DYQA 2GCLA 2L1CA 2D9YA 1ZM0A 4HAXB 4YONA 3U7DA 2EC1A 2LOXA 1UNPA 5DHAB 1BWNA 2K2UA 2RSGA 3ULCA 3MDBC 1GG3A 1MK7B 2D9VA 2RGNB 4DXAB 1OMWA 2D4QA 3PZDA 3WYFB 2Y8FA 1X1FA 1NTYA 4EMOA 1J19A 2D9XA 1FB8A 2LULA 2YT0A 4H8SA 2YS5A 3KZ1A 3TCAA 4K17A 1AQCA 4KHBB 2LOZA 5JHGA 4HAUB 5JLJB 5HE0A 1W1GA 3V5WA 2DX5A 1XODA 1OY2A 3NSUA 4IAPA 1H10A 3ODWA 3GYPA 3KSYA 4L6EA 4EJNA 2JP2A 1FOEA 1NTVA 5DI9B 4HAWB 3QBVB 1XCGA 2N23A 3HW2B 2E2XA 2KUPA 3M1IB 3SNHA 2Y7BA 2DFKA 2K2JA 1Y5OA 2OTXA 1EAZA 1SHCA 1XX0A 1WJ1A 1XR0B 4KHOA 4P7IA 2DKPA 3HK0A 1FGYA 1IRSA 1UEFA 5GOWB 2HTHB 1DBHA 2DX1A 2L2IA 3SO6A 1UNQA 1LB1A 2P0DA 1MIXA 1U27A 4MY6A 3TVVA 2KCJA 2VSZA 3D8DA 1QQGA 2I1KA 2HE7A 5CLLB 3ZDTA 1PMSA 4GN1A 2COAA 1V5UA 1DROA 4HATB 4WVFB 3ZVRA 3A8PA 3F0WA 4A5KA 4A6HA 5C5BA 2P0HA 1LW3A 4BBKA 2BCJA 2R0DA 4XWXA 5CLQB 1V89A 2UZRA 4GMVA 4KVGB 2RVBB 4HB0B 2X18A 3ODXA 5D3WA 1KI1B 2LG1A 1X11A 1H4RA 3G9WA 5EFXA 1MKEA 1RJ2A 3ODOA 2MKRA 2QKMA 1WG7A 2ROZB 2CODA 3KY9A 2D9WA 1V61A 1N3HA 1UNRA 4C0AA 3PG7A 2R09A 2K00A 2CY4A 2D9ZA 5D27A 3QWMA 1WGQA 1ZVRA 4ZRKA 2DHJA 1NI2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2COF A;  2J0K A;  1WGU A;  2M38 A;  1Z87 A;  2W2W A;  1WVH A;  1U5F A;  2IYB A;  5D3X A;  3UZT A;  2W2X C;  4GZU A;  1PFJ A;  4PNK A;  5LON B;  2CY5 A;  3PVL A;  1RRP B;  1FHX A;  2DKQ A;  3LJU X;  1TJ6 A;  3PSC A;  1GC7 A;  1WJM A;  4B6H A;  4F7H A;  4HB2 B;  2EMS A;  5D3Y A;  2M14 A;  3DXC A;  1W1H A;  1DDV A;  5J3T A;  3CIK A;  3RCP A;  2Y8G A;  1U5G A;  2D10 A;  1UPQ A;  1DDW A;  1GC6 A;  2DHK A;  3O96 A;  2Z0P A;  2Q13 A;  3BIN A;  4HB3 B;  1M7R A;  3N7C A;  2P0F A;  1QC6 A;  2LKO A;  2I1J A;  2J59 M;  1MK9 B;  4A6K A;  2RLO A;  1U5D A;  4MT7 A;  3QIJ A;  2ZPY A;  3WA0 A;  4EKU A;  2W2X D;  2PZ1 A;  1Q67 A;  5J3Q A;  1K5G B;  2DHI A;  1ZC4 B;  2ELB A;  1MPH A;  4WJ7 A;  4NSW A;  1M7E A;  1U5E A;  1MIZ B;  1B55 A;  4K2P A;  3MPX A;  1P3R A;  2OQB A;  2QKL A;  2Z0O A;  1U2B A;  2CAY A;  2AL6 A;  4IOY X;  2NZ8 B;  4Z2N A;  2VRW B;  4KHA A;  4MK0 A;  5HE1 A;  2AEH A;  3PEG A;  4DX9 0;  2GJY A;  5JHH A;  3A98 B;  2D2Q A;  2P8V A;  3P6A A;  5DHF B;  3TO1 A;  5D3V A;  1BTN A;  1FHO A;  3PP2 A;  2NMB A;  3HQC A;  1KZ7 A;  3DXE A;  4HHV A;  3SUZ A;  1BAK A;  2YSZ A;  4YL8 A;  1OQN A;  4HB4 B;  2H7D A;  1PLS A;  3X23 A;  4KAX B;  2GS0 A;  1WI1 A;  2H7E A;  3AU4 A;  5FI0 A;  2COC A;  3P7Z A;  1DYN A;  1X1G A;  2I5F A;  3FEH A;  1SGH A;  1X86 A;  2ADZ A;  4K2O A;  1I7A A;  3F5R A;  1FGZ A;  1UPR A;  1DDM A;  2YT1 A;  1K5D B;  4WSF A;  2N0Y A;  1TQZ A;  2EMT A;  3CXB B;  4HAY B;  1EGX A;  2XQN M;  2DYN A;  3SYX A;  1KZG A;  4D0N B;  4HAV B;  4IFS A;  3ML4 A;  1U29 A;  2YRY A;  5L81 A;  5KQ1 A;  3PVU A;  3AJ4 A;  1MAI A;  3DXD A;  5DIF B;  2RUK B;  4ZRI A;  5LOP B;  1P5T A;  2EJ8 A;  2IFS A;  5HE3 A;  2DLW A;  1V5P A;  2LYD A;  4HDO A;  1EVH A;  1FHW A;  2YVC A;  1ISN A;  5C6R A;  1P6S A;  3VIA A;  1ZSQ A;  2CRF A;  3FSS A;  3OAN A;  2MWN B;  2YS1 A;  4Y94 A;  3AU5 A;  3D8F A;  2V76 A;  1Y19 B;  4GXB A;  5C16 A;  1TXD A;  3TFM A;  1X05 A;  4NY0 A;  5C5B B;  5JP4 A;  4F7G A;  2J0M A;  1BTK A;  3BJI A;  2UVM A;  4Z2M B;  4HAZ B;  3IVF A;  3KRW A;  3GYO A;  5C79 A;  1EF1 A;  4TKN A;  2Z0Q A;  1NU2 A;  4GPT B;  4A6F B;  3FM8 C;  2FJL A;  5DH9 B;  2DN6 A;  2VKI A;  4DX8 A;  1FAO A;  1W1D A;  1AWE A;  1V5M A;  3KRX A;  2DA0 A;  1I2H A;  1XKE A;  2D11 A;  4HDQ A;  3PVW A;  5KCV A;  2MDX A;  4CYE A;  2RNR B;  2ROV A;  2ELA A;  4CHM A;  2MFQ A;  4F7U P;  5FI1 A;  4K81 A;  4ZRJ A;  4CHJ A;  3U8Z A;  2YF0 A;  2I5C A;  1ZC3 B;  5KQ4 A;  3A8Q A;  3D8E A;  4TYZ A;  4PQ0 A;  2DTC A;  3SV1 A;  2J0J A;  4DBB A;  3TW1 A;  2G35 A;  5J3Y A;  3ULB A;  2YS3 A;  1V88 A;  3T06 A;  5HE2 A;  2UZS A;  4GMX B;  4A6F A;  2GCJ A;  2KGX B;  1J0W A;  3VOQ A;  1XD4 A;  1E5W A;  2DYQ A;  2GCL A;  2L1C A;  2D9Y A;  1ZM0 A;  4HAX B;  4YON A;  3U7D A;  2EC1 A;  2LOX A;  1UNP A;  5DHA B;  1BWN A;  2K2U A;  2RSG A;  3ULC A;  3MDB C;  1GG3 A;  1MK7 B;  2D9V A;  2RGN B;  4DXA B;  1OMW A;  2D4Q A;  3PZD A;  3WYF B;  2Y8F A;  1X1F A;  1NTY A;  4EMO A;  1J19 A;  2D9X A;  1FB8 A;  2LUL A;  2YT0 A;  4H8S A;  2YS5 A;  3KZ1 A;  3TCA A;  4K17 A;  1AQC A;  4KHB B;  2LOZ A;  5JHG A;  4HAU B;  5JLJ B;  5HE0 A;  1W1G A;  3V5W A;  2DX5 A;  1XOD A;  1OY2 A;  3NSU A;  4IAP A;  1H10 A;  3ODW A;  3GYP A;  3KSY A;  4L6E A;  4EJN A;  2JP2 A;  1FOE A;  1NTV A;  5DI9 B;  4HAW B;  3QBV B;  1XCG A;  2N23 A;  3HW2 B;  2E2X A;  2KUP A;  3M1I B;  3SNH A;  2Y7B A;  2DFK A;  2K2J A;  1Y5O A;  2OTX A;  1EAZ A;  1SHC A;  1XX0 A;  1WJ1 A;  1XR0 B;  4KHO A;  4P7I A;  2DKP A;  3HK0 A;  1FGY A;  1IRS A;  1UEF A;  5GOW B;  2HTH B;  1DBH A;  2DX1 A;  2L2I A;  3SO6 A;  1UNQ A;  1LB1 A;  2P0D A;  1MIX A;  1U27 A;  4MY6 A;  3TVV A;  2KCJ A;  2VSZ A;  3D8D A;  1QQG A;  2I1K A;  2HE7 A;  5CLL B;  3ZDT A;  1PMS A;  4GN1 A;  2COA A;  1V5U A;  1DRO A;  4HAT B;  4WVF B;  3ZVR A;  3A8P A;  3F0W A;  4A5K A;  4A6H A;  5C5B A;  2P0H A;  1LW3 A;  4BBK A;  2BCJ A;  2R0D A;  4XWX A;  5CLQ B;  1V89 A;  2UZR A;  4GMV A;  4KVG B;  2RVB B;  4HB0 B;  2X18 A;  3ODX A;  5D3W A;  1KI1 B;  2LG1 A;  1X11 A;  1H4R A;  3G9W A;  5EFX A;  1MKE A;  1RJ2 A;  3ODO A;  2MKR A;  2QKM A;  1WG7 A;  2ROZ B;  2COD A;  3KY9 A;  2D9W A;  1V61 A;  1N3H A;  1UNR A;  4C0A A;  3PG7 A;  2R09 A;  2K00 A;  2CY4 A;  2D9Z A;  5D27 A;  3QWM A;  1WGQ A;  1ZVR A;  4ZRK A;  2DHJ A;  1NI2 A; 
#chains in the Genus database with same CATH topology
 2COF A;  2J0K A;  1WGU A;  2M38 A;  1Z87 A;  2W2W A;  1WVH A;  1U5F A;  2IYB A;  5D3X A;  3UZT A;  2W2X C;  4GZU A;  2K49 A;  1PFJ A;  4PNK A;  5LON B;  2CY5 A;  3PVL A;  1RRP B;  1FHX A;  2DKQ A;  3LJU X;  1TJ6 A;  3PSC A;  1GC7 A;  1WJM A;  4B6H A;  4F7H A;  4HB2 B;  2EMS A;  2KIE A;  5D3Y A;  2M14 A;  3DXC A;  1W1H A;  1DDV A;  5J3T A;  3CIK A;  3RCP A;  2Y8G A;  1U5G A;  2D10 A;  1ZYI A;  1UPQ A;  1DDW A;  1GC6 A;  2DHK A;  2KIG A;  3O96 A;  2Z0P A;  2Q13 A;  3BIN A;  4HB3 B;  1M7R A;  4OT1 A;  3N7C A;  2P0F A;  1QC6 A;  2LKO A;  2I1J A;  2J59 M;  1MK9 B;  4A6K A;  2RLO A;  1U5D A;  4MT7 A;  3U12 A;  3QIJ A;  2ZPY A;  3WA0 A;  4EKU A;  2W2X D;  2PZ1 A;  2Z4D A;  1MI1 A;  1Q67 A;  2K8E A;  5J3Q A;  1K5G B;  2DHI A;  4KHB A;  1ZC4 B;  2ELB A;  1MPH A;  4WJ7 A;  4NSW A;  1M7E A;  1U5E A;  2RRF A;  1MIZ B;  1B55 A;  4K2P A;  3MPX A;  1P3R A;  2OQB A;  2QKL A;  2Z0O A;  1U2B A;  4QJ4 B;  2CAY A;  2AL6 A;  4IOY X;  2NZ8 B;  4Z2N A;  2Z14 A;  2VRW B;  2NBV A;  2KUQ A;  4KHA A;  4MK0 A;  5HE1 A;  2AEH A;  3PEG A;  4DX9 0;  2GJY A;  5JHH A;  3A98 B;  2D2Q A;  2P8V A;  3HSA A;  3P6A A;  5DHF B;  3TO1 A;  5D3V A;  1BTN A;  4CSQ A;  1FHO A;  3PP2 A;  2NMB A;  3HQC A;  1KZ7 A;  3DXE A;  4HHV A;  3SUZ A;  1BAK A;  2YSZ A;  4YL8 A;  1OQN A;  4HB4 B;  2H7D A;  1PLS A;  3X23 A;  4KAX B;  2GS0 A;  1WI1 A;  2H7E A;  3AU4 A;  5FI0 A;  2COC A;  3P7Z A;  1DYN A;  1X1G A;  2I5F A;  3FEH A;  1SGH A;  1X86 A;  2ADZ A;  5IRS A;  2Z59 A;  3NW8 A;  4K2O A;  1I7A A;  3F5R A;  1FGZ A;  3B77 A;  1UPR A;  1DDM A;  2YT1 A;  1K5D B;  4OSN A;  4WSF A;  2N0Y A;  1TQZ A;  2EMT A;  3CXB B;  4HAY B;  1EGX A;  2XQN M;  4QJ5 B;  2DYN A;  3SYX A;  1KZG A;  4GOU A;  4D0N B;  4HAV B;  4IFS A;  3ML4 A;  1U29 A;  2YRY A;  5L81 A;  5KQ1 A;  3PVU A;  3AJ4 A;  2Z13 A;  1MAI A;  3DXD A;  5DIF B;  2RUK B;  4ZRI A;  5LOP B;  5LG4 B;  1P5T A;  2EJ8 A;  2IFS A;  5HE3 A;  2DLW A;  1V5P A;  2LYD A;  4HDO A;  1EVH A;  1FHW A;  2YVC A;  1ISN A;  5C6R A;  1P6S A;  3VIA A;  2YT2 A;  1ZSQ A;  2CRF A;  3FSS A;  3OAN A;  2MWN B;  2YS1 A;  4Y94 A;  3AU5 A;  3D8F A;  2V76 A;  1Y19 B;  4GXB A;  5C16 A;  1TXD A;  3TFM A;  1X05 A;  4NY0 A;  5C5B B;  5JP4 A;  4F7G A;  2J0M A;  1BTK A;  2ZKM X;  3BJI A;  2UVM A;  4Z2M B;  4HAZ B;  3IVF A;  3KRW A;  3GYO A;  5C79 A;  1EF1 A;  4TKN A;  2Z0Q A;  1NU2 A;  4GPT B;  4A6F B;  3FM8 C;  2FJL A;  5DH9 B;  2DN6 A;  4L1R A;  2VKI A;  2GUM A;  4DX8 A;  1FAO A;  1W1D A;  1AWE A;  1V5M A;  3KRX A;  2DA0 A;  1I2H A;  1XKE A;  2D11 A;  3NWA A;  4HDQ A;  3PVW A;  5KCV A;  2MDX A;  4CYE A;  2RNR B;  2ROV A;  2ELA A;  4CHM A;  2MFQ A;  4F7U P;  5FI1 A;  4K81 A;  4ZRJ A;  5I2M A;  4CHJ A;  3U8Z A;  2YF0 A;  2I5C A;  1ZC3 B;  5KQ4 A;  3A8Q A;  3D8E A;  4TYZ A;  4PQ0 A;  2DTC A;  3SV1 A;  2J0J A;  4DBB A;  3TW1 A;  2G35 A;  1T77 A;  5J3Y A;  3ULB A;  2YS3 A;  1V88 A;  3T06 A;  5HE2 A;  2UZS A;  4GMX B;  4A6F A;  2GCJ A;  2KGX B;  1J0W A;  3VOQ A;  1XD4 A;  3A58 A;  1E5W A;  2DYQ A;  2GCL A;  2L1C A;  2D9Y A;  1ZM0 A;  4HAX B;  4YON A;  3U7D A;  2EC1 A;  2LOX A;  1UNP A;  5DHA B;  1BWN A;  2K2U A;  4QJ3 B;  2RSG A;  3ULC A;  3MDB C;  1GG3 A;  1MK7 B;  2D9V A;  2RGN B;  4DXA B;  1OMW A;  2D4Q A;  3PZD A;  3WYF B;  2Y8F A;  1X1F A;  1NTY A;  4EMO A;  1J19 A;  3HIE A;  4QXA B;  2D9X A;  1FB8 A;  2LUL A;  2YT0 A;  4H8S A;  2YS5 A;  3KZ1 A;  3TCA A;  4K17 A;  1AQC A;  4KHB B;  2LOZ A;  5JHG A;  4HAU B;  5JLJ B;  5HE0 A;  1W1G A;  3V5W A;  2DX5 A;  1XOD A;  5I2S A;  1OY2 A;  3NSU A;  4IAP A;  1H10 A;  3ODW A;  3GYP A;  3KSY A;  4L6E A;  4EJN A;  2JP2 A;  1FOE A;  1NTV A;  5DI9 B;  3NWD A;  4HAW B;  3QBV B;  1XCG A;  2N23 A;  3HW2 B;  3FVC A;  2E2X A;  2KUP A;  3M1I B;  3SNH A;  2Y7B A;  2DFK A;  2K2J A;  1Y5O A;  2OTX A;  1EAZ A;  1SHC A;  1XX0 A;  1WJ1 A;  1XR0 B;  4KHO A;  4P7I A;  2DKP A;  3HK0 A;  1FGY A;  3NWF A;  1IRS A;  1UEF A;  5GOW B;  2HTH B;  1DBH A;  2DX1 A;  2L2I A;  3SO6 A;  1UNQ A;  1LB1 A;  2P0D A;  2R2Y A;  1MIX A;  1U27 A;  4MY6 A;  3TVV A;  2KCJ A;  2VSZ A;  3D8D A;  1QQG A;  2I1K A;  2HE7 A;  5CLL B;  3ZDT A;  1PMS A;  4GN1 A;  5M4Y B;  2COA A;  4HSI A;  1V5U A;  1DRO A;  4D6W A;  4HAT B;  4WVF B;  3ZVR A;  3A8P A;  3F0W A;  4A5K A;  4A6H A;  5C5B A;  2P0H A;  1LW3 A;  4BBK A;  2BCJ A;  2R0D A;  4XWX A;  5CLQ B;  1V89 A;  2UZR A;  4DIX A;  4GMV A;  4KVG B;  2RVB B;  4HB0 B;  2X18 A;  3ODX A;  5D3W A;  1KI1 B;  2FJU B;  3OHM B;  2LG1 A;  1X11 A;  1H4R A;  3G9W A;  5EFX A;  1MKE A;  1RJ2 A;  2KR0 A;  3DCX A;  3ODO A;  2MKR A;  2QKM A;  1WG7 A;  2ROZ B;  2COD A;  3KY9 A;  2D9W A;  4GNK B;  1V61 A;  1N3H A;  1UNR A;  4C0A A;  3PG7 A;  2R09 A;  2K00 A;  2CY4 A;  2D9Z A;  5D27 A;  3QWM A;  1WGQ A;  1ZVR A;  4ZRK A;  2DHJ A;  1NI2 A; 
#chains in the Genus database with same CATH homology
 2COF A;  2J0K A;  1WGU A;  2M38 A;  1Z87 A;  2W2W A;  1WVH A;  1U5F A;  2IYB A;  5D3X A;  3UZT A;  2W2X C;  4GZU A;  1PFJ A;  4PNK A;  5LON B;  2CY5 A;  3PVL A;  1RRP B;  1FHX A;  2DKQ A;  3LJU X;  1TJ6 A;  3PSC A;  1GC7 A;  1WJM A;  4B6H A;  4F7H A;  4HB2 B;  2EMS A;  5D3Y A;  2M14 A;  3DXC A;  1W1H A;  1DDV A;  5J3T A;  3CIK A;  3RCP A;  2Y8G A;  1U5G A;  2D10 A;  1UPQ A;  1DDW A;  1GC6 A;  2DHK A;  3O96 A;  2Z0P A;  2Q13 A;  3BIN A;  4HB3 B;  1M7R A;  3N7C A;  2P0F A;  1QC6 A;  2LKO A;  2I1J A;  2J59 M;  1MK9 B;  4A6K A;  2RLO A;  1U5D A;  4MT7 A;  3QIJ A;  2ZPY A;  3WA0 A;  4EKU A;  2W2X D;  2PZ1 A;  1Q67 A;  5J3Q A;  1K5G B;  2DHI A;  1ZC4 B;  2ELB A;  1MPH A;  4WJ7 A;  4NSW A;  1M7E A;  1U5E A;  1MIZ B;  1B55 A;  4K2P A;  3MPX A;  1P3R A;  2OQB A;  2QKL A;  2Z0O A;  1U2B A;  2CAY A;  2AL6 A;  4IOY X;  2NZ8 B;  4Z2N A;  2VRW B;  4KHA A;  4MK0 A;  5HE1 A;  2AEH A;  3PEG A;  4DX9 0;  2GJY A;  5JHH A;  3A98 B;  2D2Q A;  2P8V A;  3P6A A;  5DHF B;  3TO1 A;  5D3V A;  1BTN A;  1FHO A;  3PP2 A;  2NMB A;  3HQC A;  1KZ7 A;  3DXE A;  4HHV A;  3SUZ A;  1BAK A;  2YSZ A;  4YL8 A;  1OQN A;  4HB4 B;  2H7D A;  1PLS A;  3X23 A;  4KAX B;  2GS0 A;  1WI1 A;  2H7E A;  3AU4 A;  5FI0 A;  2COC A;  3P7Z A;  1DYN A;  1X1G A;  2I5F A;  3FEH A;  1SGH A;  1X86 A;  2ADZ A;  4K2O A;  1I7A A;  3F5R A;  1FGZ A;  1UPR A;  1DDM A;  2YT1 A;  1K5D B;  4WSF A;  2N0Y A;  1TQZ A;  2EMT A;  3CXB B;  4HAY B;  1EGX A;  2XQN M;  2DYN A;  3SYX A;  1KZG A;  4D0N B;  4HAV B;  4IFS A;  3ML4 A;  1U29 A;  2YRY A;  5L81 A;  5KQ1 A;  3PVU A;  3AJ4 A;  1MAI A;  3DXD A;  5DIF B;  2RUK B;  4ZRI A;  5LOP B;  1P5T A;  2EJ8 A;  2IFS A;  5HE3 A;  2DLW A;  1V5P A;  2LYD A;  4HDO A;  1EVH A;  1FHW A;  2YVC A;  1ISN A;  5C6R A;  1P6S A;  3VIA A;  1ZSQ A;  2CRF A;  3FSS A;  3OAN A;  2MWN B;  2YS1 A;  4Y94 A;  3AU5 A;  3D8F A;  2V76 A;  1Y19 B;  4GXB A;  5C16 A;  1TXD A;  3TFM A;  1X05 A;  4NY0 A;  5C5B B;  5JP4 A;  4F7G A;  2J0M A;  1BTK A;  3BJI A;  2UVM A;  4Z2M B;  4HAZ B;  3IVF A;  3KRW A;  3GYO A;  5C79 A;  1EF1 A;  4TKN A;  2Z0Q A;  1NU2 A;  4GPT B;  4A6F B;  3FM8 C;  2FJL A;  5DH9 B;  2DN6 A;  2VKI A;  4DX8 A;  1FAO A;  1W1D A;  1AWE A;  1V5M A;  3KRX A;  2DA0 A;  1I2H A;  1XKE A;  2D11 A;  4HDQ A;  3PVW A;  5KCV A;  2MDX A;  4CYE A;  2RNR B;  2ROV A;  2ELA A;  4CHM A;  2MFQ A;  4F7U P;  5FI1 A;  4K81 A;  4ZRJ A;  4CHJ A;  3U8Z A;  2YF0 A;  2I5C A;  1ZC3 B;  5KQ4 A;  3A8Q A;  3D8E A;  4TYZ A;  4PQ0 A;  2DTC A;  3SV1 A;  2J0J A;  4DBB A;  3TW1 A;  2G35 A;  5J3Y A;  3ULB A;  2YS3 A;  1V88 A;  3T06 A;  5HE2 A;  2UZS A;  4GMX B;  4A6F A;  2GCJ A;  2KGX B;  1J0W A;  3VOQ A;  1XD4 A;  1E5W A;  2DYQ A;  2GCL A;  2L1C A;  2D9Y A;  1ZM0 A;  4HAX B;  4YON A;  3U7D A;  2EC1 A;  2LOX A;  1UNP A;  5DHA B;  1BWN A;  2K2U A;  2RSG A;  3ULC A;  3MDB C;  1GG3 A;  1MK7 B;  2D9V A;  2RGN B;  4DXA B;  1OMW A;  2D4Q A;  3PZD A;  3WYF B;  2Y8F A;  1X1F A;  1NTY A;  4EMO A;  1J19 A;  2D9X A;  1FB8 A;  2LUL A;  2YT0 A;  4H8S A;  2YS5 A;  3KZ1 A;  3TCA A;  4K17 A;  1AQC A;  4KHB B;  2LOZ A;  5JHG A;  4HAU B;  5JLJ B;  5HE0 A;  1W1G A;  3V5W A;  2DX5 A;  1XOD A;  1OY2 A;  3NSU A;  4IAP A;  1H10 A;  3ODW A;  3GYP A;  3KSY A;  4L6E A;  4EJN A;  2JP2 A;  1FOE A;  1NTV A;  5DI9 B;  4HAW B;  3QBV B;  1XCG A;  2N23 A;  3HW2 B;  2E2X A;  2KUP A;  3M1I B;  3SNH A;  2Y7B A;  2DFK A;  2K2J A;  1Y5O A;  2OTX A;  1EAZ A;  1SHC A;  1XX0 A;  1WJ1 A;  1XR0 B;  4KHO A;  4P7I A;  2DKP A;  3HK0 A;  1FGY A;  1IRS A;  1UEF A;  5GOW B;  2HTH B;  1DBH A;  2DX1 A;  2L2I A;  3SO6 A;  1UNQ A;  1LB1 A;  2P0D A;  1MIX A;  1U27 A;  4MY6 A;  3TVV A;  2KCJ A;  2VSZ A;  3D8D A;  1QQG A;  2I1K A;  2HE7 A;  5CLL B;  3ZDT A;  1PMS A;  4GN1 A;  2COA A;  1V5U A;  1DRO A;  4HAT B;  4WVF B;  3ZVR A;  3A8P A;  3F0W A;  4A5K A;  4A6H A;  5C5B A;  2P0H A;  1LW3 A;  4BBK A;  2BCJ A;  2R0D A;  4XWX A;  5CLQ B;  1V89 A;  2UZR A;  4GMV A;  4KVG B;  2RVB B;  4HB0 B;  2X18 A;  3ODX A;  5D3W A;  1KI1 B;  2LG1 A;  1X11 A;  1H4R A;  3G9W A;  5EFX A;  1MKE A;  1RJ2 A;  3ODO A;  2MKR A;  2QKM A;  1WG7 A;  2ROZ B;  2COD A;  3KY9 A;  2D9W A;  1V61 A;  1N3H A;  1UNR A;  4C0A A;  3PG7 A;  2R09 A;  2K00 A;  2CY4 A;  2D9Z A;  5D27 A;  3QWM A;  1WGQ A;  1ZVR A;  4ZRK A;  2DHJ A;  1NI2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...