5L81A

Crystal structure of the ph domain of murine kindlin-3
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
133
structure length
133
Chain Sequence
SLTTIPELKDHLRIFRPRKLTLKGYRQYWVVFKDTTLSYYKSQDEAPGDPTQQLNLKGCEVVPDVNVSGQKFCIKLLVPSPEGMSEIYLRCQDEQQYAQWMAACRLASKGRTMADSSYASEVQAILAFLSLQR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Fermitin family homolog 3
publication title Structure and lipid-binding properties of the kindlin-3 pleckstrin homology domain.
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
total genus 31
structure length 133
sequence length 133
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 5l81A00
1TXDA 1FOEA 2CODA 4GPTB 4L6EA 1WVHA 5HE3A 1MPHA 3O96A 3PVLA 4WVFB 4XWXA 5C5BB 1V89A 1EAZA 4PQ0A 4HHVA 1PLSA 2DKPA 2D9VA 1X05A 3TFMA 2P0DA 4NY0A 2ROZB 4TYZA 3F5RA 1GC6A 5D3YA 1FHWA 1WI1A 2DN6A 3CIKA 4HDQA 2R0DA 1MK9B 2D2QA 4Y94A 3PVWA 4IAPA 3SO6A 3AJ4A 1W1DA 2RUKB 2N23A 2RNRB 4HAZB 1GC7A 2UZRA 1AWEA 4KHBB 1RJ2A 1WJMA 1XODA 4C0AA 4HATB 1W1GA 4KVGB 1OQNA 3D8DA 5D27A 2JP2A 2M14A 3HW2B 2VRWB 1U5GA 1N3HA 2DTCA 2J0MA 2MFQA 1KI1B 3KRWA 2PZ1A 3TO1A 2EMTA 3TCAA 4IFSA 4GN1A 2G35A 1UNPA 4K17A 1M7RA 2J0JA 3SUZA 2OTXA 3MPXA 5DH9B 1FB8A 1MK7B 2I1KA 3D8EA 2DX5A 2VSZA 4A5KA 3N7CA 1ISNA 2VKIA 3CXBB 3AU4A 5DIFB 5CLQB 2J59M 1WJ1A 5HE2A 4K2OA 5JP4A 1SHCA 4HAUB 4DX90 2MDXA 2DHIA 2ROVA 1H10A 2D9WA 2H7EA 3ULBA 4Z2MB 4EJNA 3OANA 2M38A 3U8ZA 3TVVA 1ZC4B 5J3YA 3FSSA 3WA0A 1X11A 1LW3A 5JHGA 1W1HA 4HB3B 3ZVRA 5C16A 3KRXA 2DLWA 2N0YA 4DX8A 2YS1A 2DA0A 2DFKA 4HAVB 2K00A 3QIJA 2XQNM 4GMXB 1XCGA 1K5GB 1Y19B 2COAA 5DHFB 1SGHA 2GCLA 2OQBA 1ZM0A 4HAXB 4A6HA 3KSYA 1Z87A 2L1CA 2DHJA 2YS5A 1EGXA 1P6SA 3PEGA 4YONA 2W2WA 2H7DA 4HAYB 3IVFA 3LJUX 4WJ7A 2LOXA 2RVBB 3DXDA 1MKEA 2D9YA 1V88A 4A6FA 2DKQA 4MY6A 5C5BA 2COFA 1BTKA 1U27A 1XKEA 2D10A 2ELAA 1EF1A 4MT7A 3A98B 1QC6A 2CY5A 3MDBC 3QBVB 5GOWB 1DBHA 2FJLA 1I7AA 2D11A 1X1GA 1TQZA 2KUPA 4NSWA 2ADZA 5C79A 5J3TA 3KY9A 3DXEA 2RGNB 1MIXA 1XR0B 2I5FA 2Z0QA 4K81A 3VOQA 4BBKA 1FGZA 5LONB 1WGQA 2K2JA 2E2XA 1AQCA 1B55A 1X86A 3SNHA 5EFXA 2EJ8A 2YT0A 1EVHA 2GCJA 2LULA 4F7HA 3TW1A 1DDVA 1QQGA 2K2UA 1BTNA 3SYXA 1X1FA 4CHJA 2CY4A 3BINA 2P0FA 5HE0A 2D9XA 1K5DB 3U7DA 3SV1A 5J3QA 2NZ8B 1OMWA 1Y5OA 1J0WA 1NI2A 2X18A 1DROA 4EMOA 3FEHA 2HE7A 1XD4A 3UZTA 1UPRA 2R09A 3GYPA 4A6KA 1NTYA 1BWNA 1V5PA 2YS3A 3M1IB 2IYBA 2GS0A 2DYQA 4H8SA 3PP2A 1PFJA 3WYFB 4GZUA 4F7GA 2LG1A 5FI0A 3QWMA 1FGYA 2LOZA 1I2HA 5DHAB 2I5CA 1MIZB 1NTVA 2Z0PA 1MAIA 5KQ4A 5D3XA 2LYDA 4HB4B 2UZSA 4DBBA 5L81A 2QKLA 1Q67A 1WGUA 4ZRKA 2W2XC 2RSGA 1ZVRA 1KZGA 5LOPB 4ZRJA 1V5UA 2IFSA 4HDOA 5JHHA 4YL8A 3DXCA 4PNKA 2DYNA 3BJIA 3V5WA 4KHOA 1E5WA 2ELBA 2YT1A 5DI9B 1H4RA 1KZ7A 1ZSQA 2DHKA 1PMSA 1FHXA 2Z0OA 2V76A 1V61A 1P3RA 4A6FB 1P5TA 3KZ1A 1XX0A 1U5FA 3RCPA 5KCVA 2HTHB 4HAWB 3NSUA 2P0HA 3PG7A 4MK0A 5JLJB 2DX1A 1UEFA 4K2PA 2YVCA 3A8PA 2UVMA 3ML4A 4WSFA 1NU2A 3HQCA 5D3VA 2KGXB 1UPQA 2RLOA 3PSCA 2YSZA 1U2BA 1DDWA 5HE1A 1RRPB 4TKNA 2Y8FA 4KHAA 3FM8C 1FHOA 1OY2A 2J0KA 4GXBA 1DYNA 2Q13A 3A8QA 5C6RA 2D4QA 4HB0B 1GG3A 2MKRA 2NMBA 2CAYA 2L2IA 2P8VA 3F0WA 3PZDA 3T06A 1J19A 2EC1A 4GMVA 1M7EA 3ZDTA 3ULCA 3GYOA 3ODXA 2AEHA 1UNRA 4CHMA 1U29A 4KAXB 4D0NB 3X23A 5CLLB 1IRSA 2MWNB 2CRFA 1BAKA 1ZC3B 2GJYA 4CYEA 1U5EA 1DDMA 2Y8GA 3G9WA 4F7UP 3P7ZA 1TJ6A 2COCA 5KQ1A 5D3WA 4DXAB 2YRYA 3D8FA 1WG7A 2YF0A 2ZPYA 2BCJA 4EKUA 1V5MA 2EMSA 2KCJA 2D9ZA 1FAOA 2LKOA 3VIAA 3ODWA 5FI1A 1U5DA 4IOYX 3AU5A 3PVUA 1UNQA 2W2XD 2AL6A 3P6AA 4B6HA 2I1JA 2Y7BA 3ODOA 4HB2B 4ZRIA 4P7IA 1LB1A 3HK0A 4Z2NA 2QKMA
chains in the Genus database with same CATH superfamily
1TXDA 1FOEA 2CODA 4GPTB 4L6EA 1WVHA 5HE3A 1MPHA 3O96A 3PVLA 4WVFB 4XWXA 5C5BB 1V89A 1EAZA 4PQ0A 4HHVA 1PLSA 2DKPA 2D9VA 1X05A 2Z59A 3TFMA 2P0DA 4NY0A 2ROZB 4TYZA 3F5RA 1GC6A 5D3YA 1FHWA 1WI1A 2DN6A 3CIKA 4HDQA 2R0DA 1MK9B 2D2QA 5I2SA 4Y94A 3PVWA 4IAPA 3SO6A 3AJ4A 1W1DA 2RUKB 2N23A 2RNRB 4HAZB 1GC7A 2UZRA 1AWEA 4KHBB 1RJ2A 1WJMA 1XODA 4C0AA 4HATB 1W1GA 4KVGB 2NBVA 1OQNA 3D8DA 5D27A 2JP2A 2M14A 3HW2B 2VRWB 1U5GA 1N3HA 2DTCA 2J0MA 2MFQA 1KI1B 3KRWA 2PZ1A 3TO1A 2EMTA 3TCAA 2GUMA 4IFSA 4QJ4B 4GN1A 2G35A 1UNPA 4K17A 1M7RA 2J0JA 4GOUA 5LG4B 3SUZA 4L1RA 2OTXA 3MPXA 5DH9B 1FB8A 1MK7B 2KR0A 2I1KA 3D8EA 2DX5A 2VSZA 2Z13A 4A5KA 3N7CA 1ISNA 2VKIA 3CXBB 3AU4A 5DIFB 5CLQB 2J59M 1WJ1A 5HE2A 4D6WA 4K2OA 2FJUB 1SHCA 4HAUB 5JP4A 2ZKMX 4DX90 2MDXA 2DHIA 2ROVA 1H10A 2D9WA 3B77A 2H7EA 3ULBA 4Z2MB 4EJNA 3OANA 2M38A 3U8ZA 3TVVA 1ZC4B 5J3YA 3FSSA 3WA0A 1X11A 1LW3A 5JHGA 1W1HA 4HB3B 3ZVRA 5C16A 3KRXA 2DLWA 2N0YA 4DX8A 2YS1A 2DA0A 2DFKA 4HAVB 2K00A 3QIJA 2XQNM 4GMXB 1XCGA 1K5GB 4DIXA 1Y19B 2COAA 5DHFB 4QXAB 1SGHA 2GCLA 2OQBA 1T77A 1ZM0A 4HAXB 4A6HA 3OHMB 3KSYA 1Z87A 2L1CA 2DHJA 2YS5A 1EGXA 1P6SA 3PEGA 4YONA 2W2WA 2H7DA 4HAYB 3IVFA 2Z4DA 3LJUX 4WJ7A 2LOXA 2RVBB 3DXDA 3U12A 1MKEA 2D9YA 1V88A 3HIEA 2DKQA 4MY6A 4A6FA 5C5BA 2COFA 1BTKA 1U27A 1XKEA 2D10A 2ELAA 1EF1A 4MT7A 3A98B 1QC6A 2CY5A 3MDBC 3QBVB 5GOWB 1DBHA 2FJLA 1I7AA 2D11A 1X1GA 1TQZA 2KUPA 3HSAA 1MI1A 4NSWA 2ADZA 5C79A 5J3TA 3KY9A 3DXEA 2RGNB 1MIXA 1XR0B 2I5FA 2Z0QA 4K81A 3VOQA 4BBKA 3DCXA 1FGZA 5LONB 1WGQA 2K2JA 2E2XA 1AQCA 1B55A 1X86A 3SNHA 5EFXA 4HSIA 2EJ8A 2YT0A 1EVHA 2GCJA 2LULA 4QJ5B 4F7HA 3TW1A 1DDVA 1QQGA 2K2UA 1BTNA 3SYXA 1X1FA 4CHJA 2CY4A 3NWFA 3BINA 2P0FA 5HE0A 2D9XA 1K5DB 3U7DA 3SV1A 5J3QA 2NZ8B 1OMWA 1Y5OA 1J0WA 1NI2A 2X18A 1DROA 3FVCA 4EMOA 4QJ3B 3FEHA 2HE7A 1XD4A 3UZTA 1UPRA 4OSNA 2R09A 3GYPA 4A6KA 1NTYA 1BWNA 5M4YB 1V5PA 2YS3A 3M1IB 2IYBA 2GS0A 2DYQA 4H8SA 3PP2A 1PFJA 3WYFB 2K49A 4GZUA 4F7GA 2LG1A 5FI0A 3QWMA 1FGYA 2LOZA 1I2HA 2R2YA 5DHAB 2I5CA 1MIZB 1NTVA 2Z0PA 1MAIA 5KQ4A 5D3XA 2LYDA 2RRFA 4HB4B 2UZSA 4DBBA 5L81A 2QKLA 1Q67A 1WGUA 4ZRKA 2W2XC 2RSGA 1ZVRA 1KZGA 2Z14A 5LOPB 4ZRJA 1V5UA 2IFSA 4HDOA 3A58A 5JHHA 5I2MA 4YL8A 3DXCA 4PNKA 2DYNA 3BJIA 2YT2A 3V5WA 4KHOA 1E5WA 2ELBA 2YT1A 5DI9B 1H4RA 2KUQA 1KZ7A 1ZSQA 2DHKA 1PMSA 1FHXA 2Z0OA 2V76A 1V61A 1P3RA 4A6FB 4CSQA 1P5TA 3KZ1A 1XX0A 1U5FA 3RCPA 5KCVA 2HTHB 4HAWB 5IRSA 3NSUA 2P0HA 3PG7A 4MK0A 5JLJB 2DX1A 1UEFA 4K2PA 3NW8A 2YVCA 3A8PA 2UVMA 3ML4A 4WSFA 2K8EA 1NU2A 3HQCA 5D3VA 2KGXB 4OT1A 1UPQA 2RLOA 3PSCA 3NWDA 2YSZA 1U2BA 1DDWA 5HE1A 1RRPB 4TKNA 2Y8FA 4KHAA 3FM8C 4KHBA 1FHOA 1OY2A 2J0KA 4GXBA 1DYNA 2KIGA 2Q13A 3A8QA 5C6RA 2D4QA 4HB0B 1GG3A 2MKRA 2NMBA 2CAYA 3NWAA 2L2IA 2P8VA 3F0WA 3PZDA 1ZYIA 3T06A 1J19A 2EC1A 4GMVA 1M7EA 3ZDTA 3ULCA 3GYOA 3ODXA 2AEHA 1UNRA 4CHMA 1U29A 2KIEA 4KAXB 4D0NB 3X23A 5CLLB 1IRSA 4GNKB 2MWNB 2CRFA 1BAKA 1ZC3B 2GJYA 4CYEA 1U5EA 1DDMA 2Y8GA 3G9WA 4F7UP 3P7ZA 1TJ6A 2COCA 5KQ1A 5D3WA 4DXAB 2YRYA 3D8FA 1WG7A 2YF0A 2ZPYA 2BCJA 4EKUA 1V5MA 2EMSA 2KCJA 2D9ZA 1FAOA 2LKOA 3VIAA 3ODWA 5FI1A 1U5DA 4IOYX 3AU5A 3PVUA 1UNQA 2W2XD 2AL6A 3P6AA 4B6HA 2I1JA 2Y7BA 3ODOA 4HB2B 4ZRIA 4P7IA 1LB1A 3HK0A 4Z2NA 2QKMA
chains in the Genus database with same CATH topology
1TXDA 1FOEA 2CODA 4GPTB 4L6EA 1WVHA 5HE3A 1MPHA 3O96A 3PVLA 4WVFB 4XWXA 5C5BB 1V89A 1EAZA 4PQ0A 4HHVA 1PLSA 2DKPA 2D9VA 1X05A 3TFMA 2P0DA 4NY0A 2ROZB 4TYZA 3F5RA 1GC6A 5D3YA 1FHWA 1WI1A 2DN6A 3CIKA 4HDQA 2R0DA 1MK9B 2D2QA 4Y94A 3PVWA 4IAPA 3SO6A 3AJ4A 1W1DA 2RUKB 2N23A 2RNRB 4HAZB 1GC7A 2UZRA 1AWEA 4KHBB 1RJ2A 1WJMA 1XODA 4C0AA 4HATB 1W1GA 4KVGB 1OQNA 3D8DA 5D27A 2JP2A 2M14A 3HW2B 2VRWB 1U5GA 1N3HA 2DTCA 2J0MA 2MFQA 1KI1B 3KRWA 2PZ1A 3TO1A 2EMTA 3TCAA 4IFSA 4GN1A 2G35A 1UNPA 4K17A 1M7RA 2J0JA 3SUZA 2OTXA 3MPXA 5DH9B 1FB8A 1MK7B 2I1KA 3D8EA 2DX5A 2VSZA 4A5KA 3N7CA 1ISNA 2VKIA 3CXBB 3AU4A 5DIFB 5CLQB 2J59M 1WJ1A 5HE2A 4K2OA 5JP4A 1SHCA 4HAUB 4DX90 2MDXA 2DHIA 2ROVA 1H10A 2D9WA 2H7EA 3ULBA 4Z2MB 4EJNA 3OANA 2M38A 3U8ZA 3TVVA 1ZC4B 5J3YA 3FSSA 3WA0A 1X11A 1LW3A 5JHGA 1W1HA 4HB3B 3ZVRA 5C16A 3KRXA 2DLWA 2N0YA 4DX8A 2YS1A 2DA0A 2DFKA 4HAVB 2K00A 3QIJA 2XQNM 4GMXB 1XCGA 1K5GB 1Y19B 2COAA 5DHFB 1SGHA 2GCLA 2OQBA 1ZM0A 4HAXB 4A6HA 3KSYA 1Z87A 2L1CA 2DHJA 2YS5A 1EGXA 1P6SA 3PEGA 4YONA 2W2WA 2H7DA 4HAYB 3IVFA 3LJUX 4WJ7A 2LOXA 2RVBB 3DXDA 1MKEA 2D9YA 1V88A 4A6FA 2DKQA 4MY6A 5C5BA 2COFA 1BTKA 1U27A 1XKEA 2D10A 2ELAA 1EF1A 4MT7A 3A98B 1QC6A 2CY5A 3MDBC 3QBVB 5GOWB 1DBHA 2FJLA 1I7AA 2D11A 1X1GA 1TQZA 2KUPA 4NSWA 2ADZA 5C79A 5J3TA 3KY9A 3DXEA 2RGNB 1MIXA 1XR0B 2I5FA 2Z0QA 4K81A 3VOQA 4BBKA 1FGZA 5LONB 1WGQA 2K2JA 2E2XA 1AQCA 1B55A 1X86A 3SNHA 5EFXA 2EJ8A 2YT0A 1EVHA 2GCJA 2LULA 4F7HA 3TW1A 1DDVA 1QQGA 2K2UA 1BTNA 3SYXA 1X1FA 4CHJA 2CY4A 3BINA 2P0FA 5HE0A 2D9XA 1K5DB 3U7DA 3SV1A 5J3QA 2NZ8B 1OMWA 1Y5OA 1J0WA 1NI2A 2X18A 1DROA 4EMOA 3FEHA 2HE7A 1XD4A 3UZTA 1UPRA 2R09A 3GYPA 4A6KA 1NTYA 1BWNA 1V5PA 2YS3A 3M1IB 2IYBA 2GS0A 2DYQA 4H8SA 3PP2A 1PFJA 3WYFB 4GZUA 4F7GA 2LG1A 5FI0A 3QWMA 1FGYA 2LOZA 1I2HA 5DHAB 2I5CA 1MIZB 1NTVA 2Z0PA 1MAIA 5KQ4A 5D3XA 2LYDA 4HB4B 2UZSA 4DBBA 5L81A 2QKLA 1Q67A 1WGUA 4ZRKA 2W2XC 2RSGA 1ZVRA 1KZGA 5LOPB 4ZRJA 1V5UA 2IFSA 4HDOA 5JHHA 4YL8A 3DXCA 4PNKA 2DYNA 3BJIA 3V5WA 4KHOA 1E5WA 2ELBA 2YT1A 5DI9B 1H4RA 1KZ7A 1ZSQA 2DHKA 1PMSA 1FHXA 2Z0OA 2V76A 1V61A 1P3RA 4A6FB 1P5TA 3KZ1A 1XX0A 1U5FA 3RCPA 5KCVA 2HTHB 4HAWB 3NSUA 2P0HA 3PG7A 4MK0A 5JLJB 2DX1A 1UEFA 4K2PA 2YVCA 3A8PA 2UVMA 3ML4A 4WSFA 1NU2A 3HQCA 5D3VA 2KGXB 1UPQA 2RLOA 3PSCA 2YSZA 1U2BA 1DDWA 5HE1A 1RRPB 4TKNA 2Y8FA 4KHAA 3FM8C 1FHOA 1OY2A 2J0KA 4GXBA 1DYNA 2Q13A 3A8QA 5C6RA 2D4QA 4HB0B 1GG3A 2MKRA 2NMBA 2CAYA 2L2IA 2P8VA 3F0WA 3PZDA 3T06A 1J19A 2EC1A 4GMVA 1M7EA 3ZDTA 3ULCA 3GYOA 3ODXA 2AEHA 1UNRA 4CHMA 1U29A 4KAXB 4D0NB 3X23A 5CLLB 1IRSA 2MWNB 2CRFA 1BAKA 1ZC3B 2GJYA 4CYEA 1U5EA 1DDMA 2Y8GA 3G9WA 4F7UP 3P7ZA 1TJ6A 2COCA 5KQ1A 5D3WA 4DXAB 2YRYA 3D8FA 1WG7A 2YF0A 2ZPYA 2BCJA 4EKUA 1V5MA 2EMSA 2KCJA 2D9ZA 1FAOA 2LKOA 3VIAA 3ODWA 5FI1A 1U5DA 4IOYX 3AU5A 3PVUA 1UNQA 2W2XD 2AL6A 3P6AA 4B6HA 2I1JA 2Y7BA 3ODOA 4HB2B 4ZRIA 4P7IA 1LB1A 3HK0A 4Z2NA 2QKMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TXD A;  1FOE A;  2COD A;  4GPT B;  4L6E A;  1WVH A;  5HE3 A;  1MPH A;  3O96 A;  3PVL A;  4WVF B;  4XWX A;  5C5B B;  1V89 A;  1EAZ A;  4PQ0 A;  4HHV A;  1PLS A;  2DKP A;  2D9V A;  1X05 A;  3TFM A;  2P0D A;  4NY0 A;  2ROZ B;  4TYZ A;  3F5R A;  1GC6 A;  5D3Y A;  1FHW A;  1WI1 A;  2DN6 A;  3CIK A;  4HDQ A;  2R0D A;  1MK9 B;  2D2Q A;  4Y94 A;  3PVW A;  4IAP A;  3SO6 A;  3AJ4 A;  1W1D A;  2RUK B;  2N23 A;  2RNR B;  4HAZ B;  1GC7 A;  2UZR A;  1AWE A;  4KHB B;  1RJ2 A;  1WJM A;  1XOD A;  4C0A A;  4HAT B;  1W1G A;  4KVG B;  1OQN A;  3D8D A;  5D27 A;  2JP2 A;  2M14 A;  3HW2 B;  2VRW B;  1U5G A;  1N3H A;  2DTC A;  2J0M A;  2MFQ A;  1KI1 B;  3KRW A;  2PZ1 A;  3TO1 A;  2EMT A;  3TCA A;  4IFS A;  4GN1 A;  2G35 A;  1UNP A;  4K17 A;  1M7R A;  2J0J A;  3SUZ A;  2OTX A;  3MPX A;  5DH9 B;  1FB8 A;  1MK7 B;  2I1K A;  3D8E A;  2DX5 A;  2VSZ A;  4A5K A;  3N7C A;  1ISN A;  2VKI A;  3CXB B;  3AU4 A;  5DIF B;  5CLQ B;  2J59 M;  1WJ1 A;  5HE2 A;  4K2O A;  5JP4 A;  1SHC A;  4HAU B;  4DX9 0;  2MDX A;  2DHI A;  2ROV A;  1H10 A;  2D9W A;  2H7E A;  3ULB A;  4Z2M B;  4EJN A;  3OAN A;  2M38 A;  3U8Z A;  3TVV A;  1ZC4 B;  5J3Y A;  3FSS A;  3WA0 A;  1X11 A;  1LW3 A;  5JHG A;  1W1H A;  4HB3 B;  3ZVR A;  5C16 A;  3KRX A;  2DLW A;  2N0Y A;  4DX8 A;  2YS1 A;  2DA0 A;  2DFK A;  4HAV B;  2K00 A;  3QIJ A;  2XQN M;  4GMX B;  1XCG A;  1K5G B;  1Y19 B;  2COA A;  5DHF B;  1SGH A;  2GCL A;  2OQB A;  1ZM0 A;  4HAX B;  4A6H A;  3KSY A;  1Z87 A;  2L1C A;  2DHJ A;  2YS5 A;  1EGX A;  1P6S A;  3PEG A;  4YON A;  2W2W A;  2H7D A;  4HAY B;  3IVF A;  3LJU X;  4WJ7 A;  2LOX A;  2RVB B;  3DXD A;  1MKE A;  2D9Y A;  1V88 A;  4A6F A;  2DKQ A;  4MY6 A;  5C5B A;  2COF A;  1BTK A;  1U27 A;  1XKE A;  2D10 A;  2ELA A;  1EF1 A;  4MT7 A;  3A98 B;  1QC6 A;  2CY5 A;  3MDB C;  3QBV B;  5GOW B;  1DBH A;  2FJL A;  1I7A A;  2D11 A;  1X1G A;  1TQZ A;  2KUP A;  4NSW A;  2ADZ A;  5C79 A;  5J3T A;  3KY9 A;  3DXE A;  2RGN B;  1MIX A;  1XR0 B;  2I5F A;  2Z0Q A;  4K81 A;  3VOQ A;  4BBK A;  1FGZ A;  5LON B;  1WGQ A;  2K2J A;  2E2X A;  1AQC A;  1B55 A;  1X86 A;  3SNH A;  5EFX A;  2EJ8 A;  2YT0 A;  1EVH A;  2GCJ A;  2LUL A;  4F7H A;  3TW1 A;  1DDV A;  1QQG A;  2K2U A;  1BTN A;  3SYX A;  1X1F A;  4CHJ A;  2CY4 A;  3BIN A;  2P0F A;  5HE0 A;  2D9X A;  1K5D B;  3U7D A;  3SV1 A;  5J3Q A;  2NZ8 B;  1OMW A;  1Y5O A;  1J0W A;  1NI2 A;  2X18 A;  1DRO A;  4EMO A;  3FEH A;  2HE7 A;  1XD4 A;  3UZT A;  1UPR A;  2R09 A;  3GYP A;  4A6K A;  1NTY A;  1BWN A;  1V5P A;  2YS3 A;  3M1I B;  2IYB A;  2GS0 A;  2DYQ A;  4H8S A;  3PP2 A;  1PFJ A;  3WYF B;  4GZU A;  4F7G A;  2LG1 A;  5FI0 A;  3QWM A;  1FGY A;  2LOZ A;  1I2H A;  5DHA B;  2I5C A;  1MIZ B;  1NTV A;  2Z0P A;  1MAI A;  5KQ4 A;  5D3X A;  2LYD A;  4HB4 B;  2UZS A;  4DBB A;  5L81 A;  2QKL A;  1Q67 A;  1WGU A;  4ZRK A;  2W2X C;  2RSG A;  1ZVR A;  1KZG A;  5LOP B;  4ZRJ A;  1V5U A;  2IFS A;  4HDO A;  5JHH A;  4YL8 A;  3DXC A;  4PNK A;  2DYN A;  3BJI A;  3V5W A;  4KHO A;  1E5W A;  2ELB A;  2YT1 A;  5DI9 B;  1H4R A;  1KZ7 A;  1ZSQ A;  2DHK A;  1PMS A;  1FHX A;  2Z0O A;  2V76 A;  1V61 A;  1P3R A;  4A6F B;  1P5T A;  3KZ1 A;  1XX0 A;  1U5F A;  3RCP A;  5KCV A;  2HTH B;  4HAW B;  3NSU A;  2P0H A;  3PG7 A;  4MK0 A;  5JLJ B;  2DX1 A;  1UEF A;  4K2P A;  2YVC A;  3A8P A;  2UVM A;  3ML4 A;  4WSF A;  1NU2 A;  3HQC A;  5D3V A;  2KGX B;  1UPQ A;  2RLO A;  3PSC A;  2YSZ A;  1U2B A;  1DDW A;  5HE1 A;  1RRP B;  4TKN A;  2Y8F A;  4KHA A;  3FM8 C;  1FHO A;  1OY2 A;  2J0K A;  4GXB A;  1DYN A;  2Q13 A;  3A8Q A;  5C6R A;  2D4Q A;  4HB0 B;  1GG3 A;  2MKR A;  2NMB A;  2CAY A;  2L2I A;  2P8V A;  3F0W A;  3PZD A;  3T06 A;  1J19 A;  2EC1 A;  4GMV A;  1M7E A;  3ZDT A;  3ULC A;  3GYO A;  3ODX A;  2AEH A;  1UNR A;  4CHM A;  1U29 A;  4KAX B;  4D0N B;  3X23 A;  5CLL B;  1IRS A;  2MWN B;  2CRF A;  1BAK A;  1ZC3 B;  2GJY A;  4CYE A;  1U5E A;  1DDM A;  2Y8G A;  3G9W A;  4F7U P;  3P7Z A;  1TJ6 A;  2COC A;  5KQ1 A;  5D3W A;  4DXA B;  2YRY A;  3D8F A;  1WG7 A;  2YF0 A;  2ZPY A;  2BCJ A;  4EKU A;  1V5M A;  2EMS A;  2KCJ A;  2D9Z A;  1FAO A;  2LKO A;  3VIA A;  3ODW A;  5FI1 A;  1U5D A;  4IOY X;  3AU5 A;  3PVU A;  1UNQ A;  2W2X D;  2AL6 A;  3P6A A;  4B6H A;  2I1J A;  2Y7B A;  3ODO A;  4HB2 B;  4ZRI A;  4P7I A;  1LB1 A;  3HK0 A;  4Z2N A;  2QKM A; 
#chains in the Genus database with same CATH topology
 1TXD A;  1FOE A;  2COD A;  4GPT B;  4L6E A;  1WVH A;  5HE3 A;  1MPH A;  3O96 A;  3PVL A;  4WVF B;  4XWX A;  5C5B B;  1V89 A;  1EAZ A;  4PQ0 A;  4HHV A;  1PLS A;  2DKP A;  2D9V A;  1X05 A;  2Z59 A;  3TFM A;  2P0D A;  4NY0 A;  2ROZ B;  4TYZ A;  3F5R A;  1GC6 A;  5D3Y A;  1FHW A;  1WI1 A;  2DN6 A;  3CIK A;  4HDQ A;  2R0D A;  1MK9 B;  2D2Q A;  5I2S A;  4Y94 A;  3PVW A;  4IAP A;  3SO6 A;  3AJ4 A;  1W1D A;  2RUK B;  2N23 A;  2RNR B;  4HAZ B;  1GC7 A;  2UZR A;  1AWE A;  4KHB B;  1RJ2 A;  1WJM A;  1XOD A;  4C0A A;  4HAT B;  1W1G A;  4KVG B;  2NBV A;  1OQN A;  3D8D A;  5D27 A;  2JP2 A;  2M14 A;  3HW2 B;  2VRW B;  1U5G A;  1N3H A;  2DTC A;  2J0M A;  2MFQ A;  1KI1 B;  3KRW A;  2PZ1 A;  3TO1 A;  2EMT A;  3TCA A;  2GUM A;  4IFS A;  4QJ4 B;  4GN1 A;  2G35 A;  1UNP A;  4K17 A;  1M7R A;  2J0J A;  4GOU A;  5LG4 B;  3SUZ A;  4L1R A;  2OTX A;  3MPX A;  5DH9 B;  1FB8 A;  1MK7 B;  2KR0 A;  2I1K A;  3D8E A;  2DX5 A;  2VSZ A;  2Z13 A;  4A5K A;  3N7C A;  1ISN A;  2VKI A;  3CXB B;  3AU4 A;  5DIF B;  5CLQ B;  2J59 M;  1WJ1 A;  5HE2 A;  4D6W A;  4K2O A;  2FJU B;  1SHC A;  4HAU B;  5JP4 A;  2ZKM X;  4DX9 0;  2MDX A;  2DHI A;  2ROV A;  1H10 A;  2D9W A;  3B77 A;  2H7E A;  3ULB A;  4Z2M B;  4EJN A;  3OAN A;  2M38 A;  3U8Z A;  3TVV A;  1ZC4 B;  5J3Y A;  3FSS A;  3WA0 A;  1X11 A;  1LW3 A;  5JHG A;  1W1H A;  4HB3 B;  3ZVR A;  5C16 A;  3KRX A;  2DLW A;  2N0Y A;  4DX8 A;  2YS1 A;  2DA0 A;  2DFK A;  4HAV B;  2K00 A;  3QIJ A;  2XQN M;  4GMX B;  1XCG A;  1K5G B;  4DIX A;  1Y19 B;  2COA A;  5DHF B;  4QXA B;  1SGH A;  2GCL A;  2OQB A;  1T77 A;  1ZM0 A;  4HAX B;  4A6H A;  3OHM B;  3KSY A;  1Z87 A;  2L1C A;  2DHJ A;  2YS5 A;  1EGX A;  1P6S A;  3PEG A;  4YON A;  2W2W A;  2H7D A;  4HAY B;  3IVF A;  2Z4D A;  3LJU X;  4WJ7 A;  2LOX A;  2RVB B;  3DXD A;  3U12 A;  1MKE A;  2D9Y A;  1V88 A;  3HIE A;  2DKQ A;  4MY6 A;  4A6F A;  5C5B A;  2COF A;  1BTK A;  1U27 A;  1XKE A;  2D10 A;  2ELA A;  1EF1 A;  4MT7 A;  3A98 B;  1QC6 A;  2CY5 A;  3MDB C;  3QBV B;  5GOW B;  1DBH A;  2FJL A;  1I7A A;  2D11 A;  1X1G A;  1TQZ A;  2KUP A;  3HSA A;  1MI1 A;  4NSW A;  2ADZ A;  5C79 A;  5J3T A;  3KY9 A;  3DXE A;  2RGN B;  1MIX A;  1XR0 B;  2I5F A;  2Z0Q A;  4K81 A;  3VOQ A;  4BBK A;  3DCX A;  1FGZ A;  5LON B;  1WGQ A;  2K2J A;  2E2X A;  1AQC A;  1B55 A;  1X86 A;  3SNH A;  5EFX A;  4HSI A;  2EJ8 A;  2YT0 A;  1EVH A;  2GCJ A;  2LUL A;  4QJ5 B;  4F7H A;  3TW1 A;  1DDV A;  1QQG A;  2K2U A;  1BTN A;  3SYX A;  1X1F A;  4CHJ A;  2CY4 A;  3NWF A;  3BIN A;  2P0F A;  5HE0 A;  2D9X A;  1K5D B;  3U7D A;  3SV1 A;  5J3Q A;  2NZ8 B;  1OMW A;  1Y5O A;  1J0W A;  1NI2 A;  2X18 A;  1DRO A;  3FVC A;  4EMO A;  4QJ3 B;  3FEH A;  2HE7 A;  1XD4 A;  3UZT A;  1UPR A;  4OSN A;  2R09 A;  3GYP A;  4A6K A;  1NTY A;  1BWN A;  5M4Y B;  1V5P A;  2YS3 A;  3M1I B;  2IYB A;  2GS0 A;  2DYQ A;  4H8S A;  3PP2 A;  1PFJ A;  3WYF B;  2K49 A;  4GZU A;  4F7G A;  2LG1 A;  5FI0 A;  3QWM A;  1FGY A;  2LOZ A;  1I2H A;  2R2Y A;  5DHA B;  2I5C A;  1MIZ B;  1NTV A;  2Z0P A;  1MAI A;  5KQ4 A;  5D3X A;  2LYD A;  2RRF A;  4HB4 B;  2UZS A;  4DBB A;  5L81 A;  2QKL A;  1Q67 A;  1WGU A;  4ZRK A;  2W2X C;  2RSG A;  1ZVR A;  1KZG A;  2Z14 A;  5LOP B;  4ZRJ A;  1V5U A;  2IFS A;  4HDO A;  3A58 A;  5JHH A;  5I2M A;  4YL8 A;  3DXC A;  4PNK A;  2DYN A;  3BJI A;  2YT2 A;  3V5W A;  4KHO A;  1E5W A;  2ELB A;  2YT1 A;  5DI9 B;  1H4R A;  2KUQ A;  1KZ7 A;  1ZSQ A;  2DHK A;  1PMS A;  1FHX A;  2Z0O A;  2V76 A;  1V61 A;  1P3R A;  4A6F B;  4CSQ A;  1P5T A;  3KZ1 A;  1XX0 A;  1U5F A;  3RCP A;  5KCV A;  2HTH B;  4HAW B;  5IRS A;  3NSU A;  2P0H A;  3PG7 A;  4MK0 A;  5JLJ B;  2DX1 A;  1UEF A;  4K2P A;  3NW8 A;  2YVC A;  3A8P A;  2UVM A;  3ML4 A;  4WSF A;  2K8E A;  1NU2 A;  3HQC A;  5D3V A;  2KGX B;  4OT1 A;  1UPQ A;  2RLO A;  3PSC A;  3NWD A;  2YSZ A;  1U2B A;  1DDW A;  5HE1 A;  1RRP B;  4TKN A;  2Y8F A;  4KHA A;  3FM8 C;  4KHB A;  1FHO A;  1OY2 A;  2J0K A;  4GXB A;  1DYN A;  2KIG A;  2Q13 A;  3A8Q A;  5C6R A;  2D4Q A;  4HB0 B;  1GG3 A;  2MKR A;  2NMB A;  2CAY A;  3NWA A;  2L2I A;  2P8V A;  3F0W A;  3PZD A;  1ZYI A;  3T06 A;  1J19 A;  2EC1 A;  4GMV A;  1M7E A;  3ZDT A;  3ULC A;  3GYO A;  3ODX A;  2AEH A;  1UNR A;  4CHM A;  1U29 A;  2KIE A;  4KAX B;  4D0N B;  3X23 A;  5CLL B;  1IRS A;  4GNK B;  2MWN B;  2CRF A;  1BAK A;  1ZC3 B;  2GJY A;  4CYE A;  1U5E A;  1DDM A;  2Y8G A;  3G9W A;  4F7U P;  3P7Z A;  1TJ6 A;  2COC A;  5KQ1 A;  5D3W A;  4DXA B;  2YRY A;  3D8F A;  1WG7 A;  2YF0 A;  2ZPY A;  2BCJ A;  4EKU A;  1V5M A;  2EMS A;  2KCJ A;  2D9Z A;  1FAO A;  2LKO A;  3VIA A;  3ODW A;  5FI1 A;  1U5D A;  4IOY X;  3AU5 A;  3PVU A;  1UNQ A;  2W2X D;  2AL6 A;  3P6A A;  4B6H A;  2I1J A;  2Y7B A;  3ODO A;  4HB2 B;  4ZRI A;  4P7I A;  1LB1 A;  3HK0 A;  4Z2N A;  2QKM A; 
#chains in the Genus database with same CATH homology
 1TXD A;  1FOE A;  2COD A;  4GPT B;  4L6E A;  1WVH A;  5HE3 A;  1MPH A;  3O96 A;  3PVL A;  4WVF B;  4XWX A;  5C5B B;  1V89 A;  1EAZ A;  4PQ0 A;  4HHV A;  1PLS A;  2DKP A;  2D9V A;  1X05 A;  3TFM A;  2P0D A;  4NY0 A;  2ROZ B;  4TYZ A;  3F5R A;  1GC6 A;  5D3Y A;  1FHW A;  1WI1 A;  2DN6 A;  3CIK A;  4HDQ A;  2R0D A;  1MK9 B;  2D2Q A;  4Y94 A;  3PVW A;  4IAP A;  3SO6 A;  3AJ4 A;  1W1D A;  2RUK B;  2N23 A;  2RNR B;  4HAZ B;  1GC7 A;  2UZR A;  1AWE A;  4KHB B;  1RJ2 A;  1WJM A;  1XOD A;  4C0A A;  4HAT B;  1W1G A;  4KVG B;  1OQN A;  3D8D A;  5D27 A;  2JP2 A;  2M14 A;  3HW2 B;  2VRW B;  1U5G A;  1N3H A;  2DTC A;  2J0M A;  2MFQ A;  1KI1 B;  3KRW A;  2PZ1 A;  3TO1 A;  2EMT A;  3TCA A;  4IFS A;  4GN1 A;  2G35 A;  1UNP A;  4K17 A;  1M7R A;  2J0J A;  3SUZ A;  2OTX A;  3MPX A;  5DH9 B;  1FB8 A;  1MK7 B;  2I1K A;  3D8E A;  2DX5 A;  2VSZ A;  4A5K A;  3N7C A;  1ISN A;  2VKI A;  3CXB B;  3AU4 A;  5DIF B;  5CLQ B;  2J59 M;  1WJ1 A;  5HE2 A;  4K2O A;  5JP4 A;  1SHC A;  4HAU B;  4DX9 0;  2MDX A;  2DHI A;  2ROV A;  1H10 A;  2D9W A;  2H7E A;  3ULB A;  4Z2M B;  4EJN A;  3OAN A;  2M38 A;  3U8Z A;  3TVV A;  1ZC4 B;  5J3Y A;  3FSS A;  3WA0 A;  1X11 A;  1LW3 A;  5JHG A;  1W1H A;  4HB3 B;  3ZVR A;  5C16 A;  3KRX A;  2DLW A;  2N0Y A;  4DX8 A;  2YS1 A;  2DA0 A;  2DFK A;  4HAV B;  2K00 A;  3QIJ A;  2XQN M;  4GMX B;  1XCG A;  1K5G B;  1Y19 B;  2COA A;  5DHF B;  1SGH A;  2GCL A;  2OQB A;  1ZM0 A;  4HAX B;  4A6H A;  3KSY A;  1Z87 A;  2L1C A;  2DHJ A;  2YS5 A;  1EGX A;  1P6S A;  3PEG A;  4YON A;  2W2W A;  2H7D A;  4HAY B;  3IVF A;  3LJU X;  4WJ7 A;  2LOX A;  2RVB B;  3DXD A;  1MKE A;  2D9Y A;  1V88 A;  4A6F A;  2DKQ A;  4MY6 A;  5C5B A;  2COF A;  1BTK A;  1U27 A;  1XKE A;  2D10 A;  2ELA A;  1EF1 A;  4MT7 A;  3A98 B;  1QC6 A;  2CY5 A;  3MDB C;  3QBV B;  5GOW B;  1DBH A;  2FJL A;  1I7A A;  2D11 A;  1X1G A;  1TQZ A;  2KUP A;  4NSW A;  2ADZ A;  5C79 A;  5J3T A;  3KY9 A;  3DXE A;  2RGN B;  1MIX A;  1XR0 B;  2I5F A;  2Z0Q A;  4K81 A;  3VOQ A;  4BBK A;  1FGZ A;  5LON B;  1WGQ A;  2K2J A;  2E2X A;  1AQC A;  1B55 A;  1X86 A;  3SNH A;  5EFX A;  2EJ8 A;  2YT0 A;  1EVH A;  2GCJ A;  2LUL A;  4F7H A;  3TW1 A;  1DDV A;  1QQG A;  2K2U A;  1BTN A;  3SYX A;  1X1F A;  4CHJ A;  2CY4 A;  3BIN A;  2P0F A;  5HE0 A;  2D9X A;  1K5D B;  3U7D A;  3SV1 A;  5J3Q A;  2NZ8 B;  1OMW A;  1Y5O A;  1J0W A;  1NI2 A;  2X18 A;  1DRO A;  4EMO A;  3FEH A;  2HE7 A;  1XD4 A;  3UZT A;  1UPR A;  2R09 A;  3GYP A;  4A6K A;  1NTY A;  1BWN A;  1V5P A;  2YS3 A;  3M1I B;  2IYB A;  2GS0 A;  2DYQ A;  4H8S A;  3PP2 A;  1PFJ A;  3WYF B;  4GZU A;  4F7G A;  2LG1 A;  5FI0 A;  3QWM A;  1FGY A;  2LOZ A;  1I2H A;  5DHA B;  2I5C A;  1MIZ B;  1NTV A;  2Z0P A;  1MAI A;  5KQ4 A;  5D3X A;  2LYD A;  4HB4 B;  2UZS A;  4DBB A;  5L81 A;  2QKL A;  1Q67 A;  1WGU A;  4ZRK A;  2W2X C;  2RSG A;  1ZVR A;  1KZG A;  5LOP B;  4ZRJ A;  1V5U A;  2IFS A;  4HDO A;  5JHH A;  4YL8 A;  3DXC A;  4PNK A;  2DYN A;  3BJI A;  3V5W A;  4KHO A;  1E5W A;  2ELB A;  2YT1 A;  5DI9 B;  1H4R A;  1KZ7 A;  1ZSQ A;  2DHK A;  1PMS A;  1FHX A;  2Z0O A;  2V76 A;  1V61 A;  1P3R A;  4A6F B;  1P5T A;  3KZ1 A;  1XX0 A;  1U5F A;  3RCP A;  5KCV A;  2HTH B;  4HAW B;  3NSU A;  2P0H A;  3PG7 A;  4MK0 A;  5JLJ B;  2DX1 A;  1UEF A;  4K2P A;  2YVC A;  3A8P A;  2UVM A;  3ML4 A;  4WSF A;  1NU2 A;  3HQC A;  5D3V A;  2KGX B;  1UPQ A;  2RLO A;  3PSC A;  2YSZ A;  1U2B A;  1DDW A;  5HE1 A;  1RRP B;  4TKN A;  2Y8F A;  4KHA A;  3FM8 C;  1FHO A;  1OY2 A;  2J0K A;  4GXB A;  1DYN A;  2Q13 A;  3A8Q A;  5C6R A;  2D4Q A;  4HB0 B;  1GG3 A;  2MKR A;  2NMB A;  2CAY A;  2L2I A;  2P8V A;  3F0W A;  3PZD A;  3T06 A;  1J19 A;  2EC1 A;  4GMV A;  1M7E A;  3ZDT A;  3ULC A;  3GYO A;  3ODX A;  2AEH A;  1UNR A;  4CHM A;  1U29 A;  4KAX B;  4D0N B;  3X23 A;  5CLL B;  1IRS A;  2MWN B;  2CRF A;  1BAK A;  1ZC3 B;  2GJY A;  4CYE A;  1U5E A;  1DDM A;  2Y8G A;  3G9W A;  4F7U P;  3P7Z A;  1TJ6 A;  2COC A;  5KQ1 A;  5D3W A;  4DXA B;  2YRY A;  3D8F A;  1WG7 A;  2YF0 A;  2ZPY A;  2BCJ A;  4EKU A;  1V5M A;  2EMS A;  2KCJ A;  2D9Z A;  1FAO A;  2LKO A;  3VIA A;  3ODW A;  5FI1 A;  1U5D A;  4IOY X;  3AU5 A;  3PVU A;  1UNQ A;  2W2X D;  2AL6 A;  3P6A A;  4B6H A;  2I1J A;  2Y7B A;  3ODO A;  4HB2 B;  4ZRI A;  4P7I A;  1LB1 A;  3HK0 A;  4Z2N A;  2QKM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...