2LYDA

The solution structure of the dm dcp1 evh1 domain in complex with the xrn1 dbm peptide
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
134
structure length
134
Chain Sequence
GPHMADLMADESITRMNLAAIKKIDPYAKEIVDSSSHVAFYTFNSSQNEWEKTDVEGAFFIYHRNAEPFHSIFINNRLNTTSFVEPITGSLELQSQPPFLLYRNERSRIRGFWFYNSEECDRISGLVNGLLKSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/protein binding
molecule keywords Decapping protein 1
publication title A direct interaction between DCP1 and XRN1 couples mRNA decapping to 5' exonucleolytic degradation.
pubmed doi rcsb
source organism Drosophila melanogaster
total genus 23
structure length 134
sequence length 134
ec nomenclature
pdb deposition date 2012-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06058 DCP1 Dcp1-like decapping family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2lydA00
1DDWA 5J3YA 1ZSQA 2YRYA 2V76A 1MK7B 1TQZA 2OTXA 4MY6A 5FI1A 1MIZB 2CRFA 3TFMA 5KQ1A 4HAVB 1WGQA 2Q13A 4Y94A 5C5BA 4F7UP 1DBHA 4KHOA 3BJIA 3AJ4A 1BTKA 5HE0A 5L81A 2CY5A 5CLQB 3T06A 2XQNM 5D3VA 2DYNA 3HQCA 5C6RA 4PNKA 2D9YA 1IRSA 1E5WA 5CLLB 1N3HA 1SHCA 1ISNA 2NMBA 4HAZB 2I5CA 4IFSA 2N0YA 2E2XA 2YT1A 2L1CA 2MWNB 5JLJB 1MAIA 3ODXA 1UNQA 2DN6A 3SO6A 2YVCA 3PVLA 1PMSA 2K00A 1X11A 2J0JA 4KAXB 2W2XC 1FGYA 3F0WA 2L2IA 3ODOA 5J3QA 1ZM0A 3PSCA 2DX5A 2ELAA 2CODA 3F5RA 2DHJA 1X86A 2D9VA 1UPQA 2DFKA 2D9WA 4BBKA 4HATB 4HAYB 2DLWA 2D9ZA 1FOEA 2Z0QA 1EGXA 1BTNA 2ROZB 3P6AA 3PG7A 2DKQA 2X18A 4HDQA 1U5FA 2PZ1A 2AEHA 1V5UA 2MDXA 2LOXA 4EJNA 1P6SA 2ADZA 5DIFB 4C0AA 3A8PA 3A98B 5EFXA 2BCJA 3PVWA 4GZUA 1GG3A 1M7EA 4CYEA 4YL8A 2YT0A 4A6FB 4ZRKA 3HW2B 4WJ7A 1WVHA 4ZRJA 2K2JA 4DX8A 2H7EA 2COFA 3G9WA 1U27A 4DX90 3DXCA 2N23A 2Z0OA 4NY0A 3TW1A 1NU2A 2QKMA 4WSFA 3D8FA 1AWEA 1X1GA 3AU5A 1XKEA 3SUZA 2UVMA 4Z2NA 2D4QA 1Y5OA 3UZTA 1RJ2A 1AQCA 1MKEA 4XWXA 2GCLA 4GXBA 1OY2A 1MIXA 3FM8C 3QIJA 3NSUA 1NTVA 2P0FA 5D3XA 5KCVA 1W1DA 5J3TA 3QBVB 1FGZA 4Z2MB 2P0DA 1LB1A 4K17A 3SV1A 3DXEA 1K5GB 3GYPA 2DHKA 1FHOA 4D0NB 4PQ0A 3IVFA 1TXDA 3ODWA 1WJ1A 2RUKB 1ZVRA 2HE7A 3ZDTA 2OQBA 3U7DA 2YS5A 2I1JA 1DROA 2COAA 3KY9A 3M1IB 1H4RA 3P7ZA 4TKNA 1ZC3B 2ROVA 1BWNA 1FHWA 3HK0A 1BAKA 2EMSA 2DKPA 4MT7A 1UNPA 4DBBA 4F7HA 5D3WA 5JHHA 2VSZA 2EMTA 3D8EA 1XCGA 1K5DB 1MPHA 2YS3A 3O96A 2W2WA 2M14A 1LW3A 1U5GA 4IOYX 2FJLA 2K2UA 3MDBC 1B55A 4NSWA 1V88A 4IAPA 5KQ4A 1XD4A 3WYFB 1I7AA 2UZRA 3FEHA 2I5FA 5LOPB 3DXDA 3ZVRA 1ZC4B 3TVVA 3OANA 2J0MA 3KRXA 4L6EA 3RCPA 1V5MA 1H10A 2DYQA 2YF0A 4HB3B 3PZDA 1NTYA 1P5TA 1FB8A 1KZ7A 2R09A 4HB2B 4HB0B 4A6KA 2YS1A 4HB4B 2CY4A 1WGUA 4HAXB 1X05A 1Z87A 5HE3A 2Z0PA 3TO1A 5DI9B 1W1HA 2HTHB 2DHIA 1UNRA 4HAWB 2COCA 4KHAA 4K2OA 1FAOA 1MK9B 2EC1A 1I2HA 5JP4A 1XX0A 1DDVA 2RVBB 4HAUB 2DX1A 2UZSA 1XR0B 2Y8FA 1V89A 2GCJA 2IFSA 1Y19B 4H8SA 3A8QA 5C16A 1GC6A 1DDMA 4F7GA 3N7CA 1EVHA 2KGXB 4EMOA 2H7DA 2AL6A 2VRWB 2J59M 5FI0A 1UEFA 2GJYA 3KRWA 4MK0A 1W1GA 1WI1A 1RRPB 2LOZA 1V61A 3WA0A 1OMWA 1PFJA 3PVUA 2KUPA 2LKOA 2KCJA 2ZPYA 2D2QA 1QQGA 2P0HA 4P7IA 1GC7A 3SYXA 3FSSA 2M38A 1KZGA 5DHAB 4CHMA 1PLSA 4ZRIA 1U29A 3KZ1A 4KVGB 3V5WA 3QWMA 2LG1A 1KI1B 2W2XD 3CXBB 1EAZA 5C5BB 4KHBB 3LJUX 4A5KA 1QC6A 4K2PA 2D11A 3PP2A 3X23A 5LONB 2JP2A 4A6FA 1OQNA 4GMVA 2Y8GA 5GOWB 2NZ8B 1Q67A 5DH9B 3GYOA 3SNHA 4A6HA 1EF1A 1DYNA 1SGHA 2P8VA 4TYZA 5D3YA 4K81A 1P3RA 5HE1A 2J0KA 4B6HA 4DXAB 1M7RA 5DHFB 1FHXA 4YONA 2LYDA 3D8DA 2ELBA 4HDOA 2G35A 2DA0A 1U5DA 1V5PA 2QKLA 2RGNB 1WG7A 1NI2A 1J19A 4GN1A 1J0WA 2DTCA 1UPRA 2LULA 2YSZA 3CIKA 3KSYA 1U5EA 5C79A 2R0DA 3ML4A 2GS0A 1XODA 2MFQA 2RNRB 2CAYA 2RSGA 2IYBA 1WJMA 2MKRA 3MPXA 3ULBA 4EKUA 4WVFB 3VOQA 3VIAA 3PEGA 1X1FA 4GPTB 5HE2A 2RLOA 4GMXB 1U2BA 2VKIA 2I1KA 5JHGA 3AU4A 3BINA 1TJ6A 2D10A 5D27A 3ULCA 3U8ZA 4HHVA 4CHJA 3TCAA 2EJ8A 2D9XA 2Y7BA
chains in the Genus database with same CATH superfamily
1DDWA 5J3YA 1ZSQA 2YRYA 2V76A 1MK7B 1TQZA 2OTXA 4MY6A 5FI1A 1MIZB 2CRFA 3TFMA 5KQ1A 4HAVB 1WGQA 2Q13A 4Y94A 5C5BA 4KHBA 4F7UP 1DBHA 4KHOA 3BJIA 3AJ4A 1BTKA 5HE0A 5L81A 4D6WA 2CY5A 2R2YA 5CLQB 3T06A 2XQNM 5D3VA 2DYNA 3HQCA 2Z4DA 5C6RA 4PNKA 2D9YA 1IRSA 1E5WA 5CLLB 1N3HA 1SHCA 1ISNA 2KIGA 2NMBA 4HAZB 2I5CA 4IFSA 2N0YA 2E2XA 2YT1A 2L1CA 2MWNB 5JLJB 1MAIA 3ODXA 1UNQA 2ZKMX 2DN6A 3SO6A 2YVCA 3PVLA 1PMSA 2K00A 1X11A 2J0JA 4KAXB 2W2XC 1FGYA 3F0WA 2L2IA 3NWAA 3ODOA 5J3QA 1ZM0A 3PSCA 2DX5A 2ELAA 3B77A 2CODA 3F5RA 2DHJA 5LG4B 1X86A 2D9VA 1UPQA 2DFKA 2D9WA 4BBKA 4HATB 4HAYB 2DLWA 2D9ZA 1FOEA 2Z0QA 1EGXA 1BTNA 2ROZB 2DKQA 2X18A 3P6AA 3PG7A 4HDQA 1U5FA 2PZ1A 2AEHA 1V5UA 2MDXA 2LOXA 4EJNA 1P6SA 2ADZA 5DIFB 4C0AA 3A8PA 3A98B 3NW8A 5EFXA 2NBVA 2BCJA 4QJ5B 3PVWA 4GZUA 1GG3A 4GOUA 1M7EA 4CYEA 4YL8A 2YT0A 4A6FB 4ZRKA 3HW2B 4WJ7A 1WVHA 4ZRJA 2K2JA 4DX8A 2H7EA 2COFA 3G9WA 1U27A 4DX90 3DXCA 2N23A 2Z0OA 4NY0A 3TW1A 1NU2A 2QKMA 4WSFA 1MI1A 3D8FA 1AWEA 1X1GA 3AU5A 1XKEA 2Z13A 3SUZA 2UVMA 4Z2NA 2D4QA 1Y5OA 5IRSA 3UZTA 1RJ2A 1AQCA 1MKEA 5I2SA 4XWXA 2GCLA 4GXBA 1OY2A 1MIXA 3FM8C 3QIJA 3NSUA 1NTVA 2P0FA 5D3XA 5KCVA 1W1DA 5J3TA 3QBVB 1FGZA 4Z2MB 2P0DA 1LB1A 4K17A 3SV1A 3DXEA 1K5GB 3GYPA 2DHKA 1FHOA 2KR0A 4D0NB 4PQ0A 2Z14A 3IVFA 1TXDA 3ODWA 1WJ1A 2RUKB 1ZVRA 2HE7A 3ZDTA 2OQBA 3U7DA 3OHMB 2YS5A 2I1JA 1DROA 2COAA 3KY9A 3M1IB 1H4RA 3P7ZA 4TKNA 1ZC3B 2ROVA 1BWNA 3HK0A 1FHWA 1BAKA 2EMSA 2DKPA 4MT7A 1UNPA 5I2MA 4DBBA 3HSAA 4F7HA 5D3WA 5JHHA 2VSZA 2EMTA 3D8EA 1XCGA 1K5DB 1MPHA 2YS3A 3O96A 2W2WA 2M14A 1LW3A 1U5GA 4IOYX 5M4YB 2FJLA 2K2UA 2KIEA 4QJ3B 2YT2A 3MDBC 1B55A 4NSWA 1V88A 4IAPA 5KQ4A 1XD4A 3WYFB 1I7AA 2UZRA 3FEHA 2I5FA 5LOPB 3DXDA 3ZVRA 1ZC4B 3TVVA 2KUQA 3OANA 2J0MA 3KRXA 4L6EA 3RCPA 1V5MA 1H10A 2DYQA 2YF0A 4HB3B 3PZDA 1NTYA 1P5TA 1FB8A 1KZ7A 2R09A 2K8EA 4HB2B 4HB0B 3DCXA 4OT1A 4A6KA 2YS1A 4HB4B 2CY4A 1WGUA 4HAXB 1X05A 1Z87A 5HE3A 2Z0PA 3TO1A 5DI9B 1W1HA 2HTHB 2DHIA 1UNRA 4HAWB 2COCA 4KHAA 4K2OA 1FAOA 1MK9B 2EC1A 1I2HA 5JP4A 1XX0A 1DDVA 2RVBB 1ZYIA 4HAUB 2DX1A 2UZSA 1XR0B 2Y8FA 1V89A 2GCJA 2IFSA 1Y19B 4H8SA 3A8QA 5C16A 1GC6A 1DDMA 4F7GA 3N7CA 1EVHA 2KGXB 4EMOA 2H7DA 4DIXA 2RRFA 2AL6A 3A58A 2VRWB 2J59M 5FI0A 1UEFA 2GJYA 3KRWA 4MK0A 1W1GA 1WI1A 1RRPB 2LOZA 1V61A 3WA0A 1OMWA 1PFJA 3PVUA 2KUPA 2LKOA 2KCJA 2ZPYA 2D2QA 1QQGA 2P0HA 4P7IA 1GC7A 3SYXA 3FVCA 3FSSA 2M38A 1KZGA 5DHAB 4CHMA 1PLSA 4ZRIA 1U29A 4OSNA 3KZ1A 4KVGB 3V5WA 3QWMA 2LG1A 3NWFA 1KI1B 3HIEA 2W2XD 3CXBB 4HSIA 1EAZA 5C5BB 4KHBB 3LJUX 4A5KA 3NWDA 1QC6A 4K2PA 2D11A 3PP2A 3X23A 5LONB 2JP2A 4A6FA 2GUMA 1OQNA 4GMVA 2Y8GA 5GOWB 2NZ8B 1Q67A 5DH9B 3GYOA 3SNHA 4A6HA 1EF1A 1DYNA 1SGHA 2P8VA 4TYZA 5D3YA 4K81A 1P3RA 5HE1A 2J0KA 4B6HA 4GNKB 4DXAB 1M7RA 5DHFB 1FHXA 4YONA 2LYDA 3D8DA 2ELBA 4HDOA 2K49A 3U12A 2G35A 2DA0A 1U5DA 1V5PA 2QKLA 2RGNB 1WG7A 1NI2A 1J19A 4GN1A 1J0WA 4QXAB 2DTCA 2FJUB 1UPRA 2LULA 2YSZA 3CIKA 3KSYA 1U5EA 5C79A 2R0DA 3ML4A 2GS0A 1XODA 2MFQA 2RNRB 2CAYA 2RSGA 2IYBA 1WJMA 2MKRA 3MPXA 3ULBA 4CSQA 4EKUA 4WVFB 3VOQA 3VIAA 3PEGA 1T77A 1X1FA 4GPTB 2Z59A 5HE2A 4QJ4B 2RLOA 4GMXB 1U2BA 2VKIA 2I1KA 5JHGA 3AU4A 3BINA 1TJ6A 2D10A 5D27A 3ULCA 3U8ZA 4HHVA 4CHJA 3TCAA 4L1RA 2EJ8A 2D9XA 2Y7BA
chains in the Genus database with same CATH topology
1DDWA 5J3YA 1ZSQA 2YRYA 2V76A 1MK7B 1TQZA 2OTXA 4MY6A 5FI1A 1MIZB 2CRFA 3TFMA 5KQ1A 4HAVB 1WGQA 2Q13A 4Y94A 5C5BA 4F7UP 1DBHA 4KHOA 3BJIA 3AJ4A 1BTKA 5HE0A 5L81A 2CY5A 5CLQB 3T06A 2XQNM 5D3VA 2DYNA 3HQCA 5C6RA 4PNKA 2D9YA 1IRSA 1E5WA 5CLLB 1N3HA 1SHCA 1ISNA 2NMBA 4HAZB 2I5CA 4IFSA 2N0YA 2E2XA 2YT1A 2L1CA 2MWNB 5JLJB 1MAIA 3ODXA 1UNQA 2DN6A 3SO6A 2YVCA 3PVLA 1PMSA 2K00A 1X11A 2J0JA 4KAXB 2W2XC 1FGYA 3F0WA 2L2IA 3ODOA 5J3QA 1ZM0A 3PSCA 2DX5A 2ELAA 2CODA 3F5RA 2DHJA 1X86A 2D9VA 1UPQA 2DFKA 2D9WA 4BBKA 4HATB 4HAYB 2DLWA 2D9ZA 1FOEA 2Z0QA 1EGXA 1BTNA 2ROZB 3P6AA 3PG7A 2DKQA 2X18A 4HDQA 1U5FA 2PZ1A 2AEHA 1V5UA 2MDXA 2LOXA 4EJNA 1P6SA 2ADZA 5DIFB 4C0AA 3A8PA 3A98B 5EFXA 2BCJA 3PVWA 4GZUA 1GG3A 1M7EA 4CYEA 4YL8A 2YT0A 4A6FB 4ZRKA 3HW2B 4WJ7A 1WVHA 4ZRJA 2K2JA 4DX8A 2H7EA 2COFA 3G9WA 1U27A 4DX90 3DXCA 2N23A 2Z0OA 4NY0A 3TW1A 1NU2A 2QKMA 4WSFA 3D8FA 1AWEA 1X1GA 3AU5A 1XKEA 3SUZA 2UVMA 4Z2NA 2D4QA 1Y5OA 3UZTA 1RJ2A 1AQCA 1MKEA 4XWXA 2GCLA 4GXBA 1OY2A 1MIXA 3FM8C 3QIJA 3NSUA 1NTVA 2P0FA 5D3XA 5KCVA 1W1DA 5J3TA 3QBVB 1FGZA 4Z2MB 2P0DA 1LB1A 4K17A 3SV1A 3DXEA 1K5GB 3GYPA 2DHKA 1FHOA 4D0NB 4PQ0A 3IVFA 1TXDA 3ODWA 1WJ1A 2RUKB 1ZVRA 2HE7A 3ZDTA 2OQBA 3U7DA 2YS5A 2I1JA 1DROA 2COAA 3KY9A 3M1IB 1H4RA 3P7ZA 4TKNA 1ZC3B 2ROVA 1BWNA 1FHWA 3HK0A 1BAKA 2EMSA 2DKPA 4MT7A 1UNPA 4DBBA 4F7HA 5D3WA 5JHHA 2VSZA 2EMTA 3D8EA 1XCGA 1K5DB 1MPHA 2YS3A 3O96A 2W2WA 2M14A 1LW3A 1U5GA 4IOYX 2FJLA 2K2UA 3MDBC 1B55A 4NSWA 1V88A 4IAPA 5KQ4A 1XD4A 3WYFB 1I7AA 2UZRA 3FEHA 2I5FA 5LOPB 3DXDA 3ZVRA 1ZC4B 3TVVA 3OANA 2J0MA 3KRXA 4L6EA 3RCPA 1V5MA 1H10A 2DYQA 2YF0A 4HB3B 3PZDA 1NTYA 1P5TA 1FB8A 1KZ7A 2R09A 4HB2B 4HB0B 4A6KA 2YS1A 4HB4B 2CY4A 1WGUA 4HAXB 1X05A 1Z87A 5HE3A 2Z0PA 3TO1A 5DI9B 1W1HA 2HTHB 2DHIA 1UNRA 4HAWB 2COCA 4KHAA 4K2OA 1FAOA 1MK9B 2EC1A 1I2HA 5JP4A 1XX0A 1DDVA 2RVBB 4HAUB 2DX1A 2UZSA 1XR0B 2Y8FA 1V89A 2GCJA 2IFSA 1Y19B 4H8SA 3A8QA 5C16A 1GC6A 1DDMA 4F7GA 3N7CA 1EVHA 2KGXB 4EMOA 2H7DA 2AL6A 2VRWB 2J59M 5FI0A 1UEFA 2GJYA 3KRWA 4MK0A 1W1GA 1WI1A 1RRPB 2LOZA 1V61A 3WA0A 1OMWA 1PFJA 3PVUA 2KUPA 2LKOA 2KCJA 2ZPYA 2D2QA 1QQGA 2P0HA 4P7IA 1GC7A 3SYXA 3FSSA 2M38A 1KZGA 5DHAB 4CHMA 1PLSA 4ZRIA 1U29A 3KZ1A 4KVGB 3V5WA 3QWMA 2LG1A 1KI1B 2W2XD 3CXBB 1EAZA 5C5BB 4KHBB 3LJUX 4A5KA 1QC6A 4K2PA 2D11A 3PP2A 3X23A 5LONB 2JP2A 4A6FA 1OQNA 4GMVA 2Y8GA 5GOWB 2NZ8B 1Q67A 5DH9B 3GYOA 3SNHA 4A6HA 1EF1A 1DYNA 1SGHA 2P8VA 4TYZA 5D3YA 4K81A 1P3RA 5HE1A 2J0KA 4B6HA 4DXAB 1M7RA 5DHFB 1FHXA 4YONA 2LYDA 3D8DA 2ELBA 4HDOA 2G35A 2DA0A 1U5DA 1V5PA 2QKLA 2RGNB 1WG7A 1NI2A 1J19A 4GN1A 1J0WA 2DTCA 1UPRA 2LULA 2YSZA 3CIKA 3KSYA 1U5EA 5C79A 2R0DA 3ML4A 2GS0A 1XODA 2MFQA 2RNRB 2CAYA 2RSGA 2IYBA 1WJMA 2MKRA 3MPXA 3ULBA 4EKUA 4WVFB 3VOQA 3VIAA 3PEGA 1X1FA 4GPTB 5HE2A 2RLOA 4GMXB 1U2BA 2VKIA 2I1KA 5JHGA 3AU4A 3BINA 1TJ6A 2D10A 5D27A 3ULCA 3U8ZA 4HHVA 4CHJA 3TCAA 2EJ8A 2D9XA 2Y7BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DDW A;  5J3Y A;  1ZSQ A;  2YRY A;  2V76 A;  1MK7 B;  1TQZ A;  2OTX A;  4MY6 A;  5FI1 A;  1MIZ B;  2CRF A;  3TFM A;  5KQ1 A;  4HAV B;  1WGQ A;  2Q13 A;  4Y94 A;  5C5B A;  4F7U P;  1DBH A;  4KHO A;  3BJI A;  3AJ4 A;  1BTK A;  5HE0 A;  5L81 A;  2CY5 A;  5CLQ B;  3T06 A;  2XQN M;  5D3V A;  2DYN A;  3HQC A;  5C6R A;  4PNK A;  2D9Y A;  1IRS A;  1E5W A;  5CLL B;  1N3H A;  1SHC A;  1ISN A;  2NMB A;  4HAZ B;  2I5C A;  4IFS A;  2N0Y A;  2E2X A;  2YT1 A;  2L1C A;  2MWN B;  5JLJ B;  1MAI A;  3ODX A;  1UNQ A;  2DN6 A;  3SO6 A;  2YVC A;  3PVL A;  1PMS A;  2K00 A;  1X11 A;  2J0J A;  4KAX B;  2W2X C;  1FGY A;  3F0W A;  2L2I A;  3ODO A;  5J3Q A;  1ZM0 A;  3PSC A;  2DX5 A;  2ELA A;  2COD A;  3F5R A;  2DHJ A;  1X86 A;  2D9V A;  1UPQ A;  2DFK A;  2D9W A;  4BBK A;  4HAT B;  4HAY B;  2DLW A;  2D9Z A;  1FOE A;  2Z0Q A;  1EGX A;  1BTN A;  2ROZ B;  3P6A A;  3PG7 A;  2DKQ A;  2X18 A;  4HDQ A;  1U5F A;  2PZ1 A;  2AEH A;  1V5U A;  2MDX A;  2LOX A;  4EJN A;  1P6S A;  2ADZ A;  5DIF B;  4C0A A;  3A8P A;  3A98 B;  5EFX A;  2BCJ A;  3PVW A;  4GZU A;  1GG3 A;  1M7E A;  4CYE A;  4YL8 A;  2YT0 A;  4A6F B;  4ZRK A;  3HW2 B;  4WJ7 A;  1WVH A;  4ZRJ A;  2K2J A;  4DX8 A;  2H7E A;  2COF A;  3G9W A;  1U27 A;  4DX9 0;  3DXC A;  2N23 A;  2Z0O A;  4NY0 A;  3TW1 A;  1NU2 A;  2QKM A;  4WSF A;  3D8F A;  1AWE A;  1X1G A;  3AU5 A;  1XKE A;  3SUZ A;  2UVM A;  4Z2N A;  2D4Q A;  1Y5O A;  3UZT A;  1RJ2 A;  1AQC A;  1MKE A;  4XWX A;  2GCL A;  4GXB A;  1OY2 A;  1MIX A;  3FM8 C;  3QIJ A;  3NSU A;  1NTV A;  2P0F A;  5D3X A;  5KCV A;  1W1D A;  5J3T A;  3QBV B;  1FGZ A;  4Z2M B;  2P0D A;  1LB1 A;  4K17 A;  3SV1 A;  3DXE A;  1K5G B;  3GYP A;  2DHK A;  1FHO A;  4D0N B;  4PQ0 A;  3IVF A;  1TXD A;  3ODW A;  1WJ1 A;  2RUK B;  1ZVR A;  2HE7 A;  3ZDT A;  2OQB A;  3U7D A;  2YS5 A;  2I1J A;  1DRO A;  2COA A;  3KY9 A;  3M1I B;  1H4R A;  3P7Z A;  4TKN A;  1ZC3 B;  2ROV A;  1BWN A;  1FHW A;  3HK0 A;  1BAK A;  2EMS A;  2DKP A;  4MT7 A;  1UNP A;  4DBB A;  4F7H A;  5D3W A;  5JHH A;  2VSZ A;  2EMT A;  3D8E A;  1XCG A;  1K5D B;  1MPH A;  2YS3 A;  3O96 A;  2W2W A;  2M14 A;  1LW3 A;  1U5G A;  4IOY X;  2FJL A;  2K2U A;  3MDB C;  1B55 A;  4NSW A;  1V88 A;  4IAP A;  5KQ4 A;  1XD4 A;  3WYF B;  1I7A A;  2UZR A;  3FEH A;  2I5F A;  5LOP B;  3DXD A;  3ZVR A;  1ZC4 B;  3TVV A;  3OAN A;  2J0M A;  3KRX A;  4L6E A;  3RCP A;  1V5M A;  1H10 A;  2DYQ A;  2YF0 A;  4HB3 B;  3PZD A;  1NTY A;  1P5T A;  1FB8 A;  1KZ7 A;  2R09 A;  4HB2 B;  4HB0 B;  4A6K A;  2YS1 A;  4HB4 B;  2CY4 A;  1WGU A;  4HAX B;  1X05 A;  1Z87 A;  5HE3 A;  2Z0P A;  3TO1 A;  5DI9 B;  1W1H A;  2HTH B;  2DHI A;  1UNR A;  4HAW B;  2COC A;  4KHA A;  4K2O A;  1FAO A;  1MK9 B;  2EC1 A;  1I2H A;  5JP4 A;  1XX0 A;  1DDV A;  2RVB B;  4HAU B;  2DX1 A;  2UZS A;  1XR0 B;  2Y8F A;  1V89 A;  2GCJ A;  2IFS A;  1Y19 B;  4H8S A;  3A8Q A;  5C16 A;  1GC6 A;  1DDM A;  4F7G A;  3N7C A;  1EVH A;  2KGX B;  4EMO A;  2H7D A;  2AL6 A;  2VRW B;  2J59 M;  5FI0 A;  1UEF A;  2GJY A;  3KRW A;  4MK0 A;  1W1G A;  1WI1 A;  1RRP B;  2LOZ A;  1V61 A;  3WA0 A;  1OMW A;  1PFJ A;  3PVU A;  2KUP A;  2LKO A;  2KCJ A;  2ZPY A;  2D2Q A;  1QQG A;  2P0H A;  4P7I A;  1GC7 A;  3SYX A;  3FSS A;  2M38 A;  1KZG A;  5DHA B;  4CHM A;  1PLS A;  4ZRI A;  1U29 A;  3KZ1 A;  4KVG B;  3V5W A;  3QWM A;  2LG1 A;  1KI1 B;  2W2X D;  3CXB B;  1EAZ A;  5C5B B;  4KHB B;  3LJU X;  4A5K A;  1QC6 A;  4K2P A;  2D11 A;  3PP2 A;  3X23 A;  5LON B;  2JP2 A;  4A6F A;  1OQN A;  4GMV A;  2Y8G A;  5GOW B;  2NZ8 B;  1Q67 A;  5DH9 B;  3GYO A;  3SNH A;  4A6H A;  1EF1 A;  1DYN A;  1SGH A;  2P8V A;  4TYZ A;  5D3Y A;  4K81 A;  1P3R A;  5HE1 A;  2J0K A;  4B6H A;  4DXA B;  1M7R A;  5DHF B;  1FHX A;  4YON A;  2LYD A;  3D8D A;  2ELB A;  4HDO A;  2G35 A;  2DA0 A;  1U5D A;  1V5P A;  2QKL A;  2RGN B;  1WG7 A;  1NI2 A;  1J19 A;  4GN1 A;  1J0W A;  2DTC A;  1UPR A;  2LUL A;  2YSZ A;  3CIK A;  3KSY A;  1U5E A;  5C79 A;  2R0D A;  3ML4 A;  2GS0 A;  1XOD A;  2MFQ A;  2RNR B;  2CAY A;  2RSG A;  2IYB A;  1WJM A;  2MKR A;  3MPX A;  3ULB A;  4EKU A;  4WVF B;  3VOQ A;  3VIA A;  3PEG A;  1X1F A;  4GPT B;  5HE2 A;  2RLO A;  4GMX B;  1U2B A;  2VKI A;  2I1K A;  5JHG A;  3AU4 A;  3BIN A;  1TJ6 A;  2D10 A;  5D27 A;  3ULC A;  3U8Z A;  4HHV A;  4CHJ A;  3TCA A;  2EJ8 A;  2D9X A;  2Y7B A; 
#chains in the Genus database with same CATH topology
 1DDW A;  5J3Y A;  1ZSQ A;  2YRY A;  2V76 A;  1MK7 B;  1TQZ A;  2OTX A;  4MY6 A;  5FI1 A;  1MIZ B;  2CRF A;  3TFM A;  5KQ1 A;  4HAV B;  1WGQ A;  2Q13 A;  4Y94 A;  5C5B A;  4KHB A;  4F7U P;  1DBH A;  4KHO A;  3BJI A;  3AJ4 A;  1BTK A;  5HE0 A;  5L81 A;  4D6W A;  2CY5 A;  2R2Y A;  5CLQ B;  3T06 A;  2XQN M;  5D3V A;  2DYN A;  3HQC A;  2Z4D A;  5C6R A;  4PNK A;  2D9Y A;  1IRS A;  1E5W A;  5CLL B;  1N3H A;  1SHC A;  1ISN A;  2KIG A;  2NMB A;  4HAZ B;  2I5C A;  4IFS A;  2N0Y A;  2E2X A;  2YT1 A;  2L1C A;  2MWN B;  5JLJ B;  1MAI A;  3ODX A;  1UNQ A;  2ZKM X;  2DN6 A;  3SO6 A;  2YVC A;  3PVL A;  1PMS A;  2K00 A;  1X11 A;  2J0J A;  4KAX B;  2W2X C;  1FGY A;  3F0W A;  2L2I A;  3NWA A;  3ODO A;  5J3Q A;  1ZM0 A;  3PSC A;  2DX5 A;  2ELA A;  3B77 A;  2COD A;  3F5R A;  2DHJ A;  5LG4 B;  1X86 A;  2D9V A;  1UPQ A;  2DFK A;  2D9W A;  4BBK A;  4HAT B;  4HAY B;  2DLW A;  2D9Z A;  1FOE A;  2Z0Q A;  1EGX A;  1BTN A;  2ROZ B;  2DKQ A;  2X18 A;  3P6A A;  3PG7 A;  4HDQ A;  1U5F A;  2PZ1 A;  2AEH A;  1V5U A;  2MDX A;  2LOX A;  4EJN A;  1P6S A;  2ADZ A;  5DIF B;  4C0A A;  3A8P A;  3A98 B;  3NW8 A;  5EFX A;  2NBV A;  2BCJ A;  4QJ5 B;  3PVW A;  4GZU A;  1GG3 A;  4GOU A;  1M7E A;  4CYE A;  4YL8 A;  2YT0 A;  4A6F B;  4ZRK A;  3HW2 B;  4WJ7 A;  1WVH A;  4ZRJ A;  2K2J A;  4DX8 A;  2H7E A;  2COF A;  3G9W A;  1U27 A;  4DX9 0;  3DXC A;  2N23 A;  2Z0O A;  4NY0 A;  3TW1 A;  1NU2 A;  2QKM A;  4WSF A;  1MI1 A;  3D8F A;  1AWE A;  1X1G A;  3AU5 A;  1XKE A;  2Z13 A;  3SUZ A;  2UVM A;  4Z2N A;  2D4Q A;  1Y5O A;  5IRS A;  3UZT A;  1RJ2 A;  1AQC A;  1MKE A;  5I2S A;  4XWX A;  2GCL A;  4GXB A;  1OY2 A;  1MIX A;  3FM8 C;  3QIJ A;  3NSU A;  1NTV A;  2P0F A;  5D3X A;  5KCV A;  1W1D A;  5J3T A;  3QBV B;  1FGZ A;  4Z2M B;  2P0D A;  1LB1 A;  4K17 A;  3SV1 A;  3DXE A;  1K5G B;  3GYP A;  2DHK A;  1FHO A;  2KR0 A;  4D0N B;  4PQ0 A;  2Z14 A;  3IVF A;  1TXD A;  3ODW A;  1WJ1 A;  2RUK B;  1ZVR A;  2HE7 A;  3ZDT A;  2OQB A;  3U7D A;  3OHM B;  2YS5 A;  2I1J A;  1DRO A;  2COA A;  3KY9 A;  3M1I B;  1H4R A;  3P7Z A;  4TKN A;  1ZC3 B;  2ROV A;  1BWN A;  3HK0 A;  1FHW A;  1BAK A;  2EMS A;  2DKP A;  4MT7 A;  1UNP A;  5I2M A;  4DBB A;  3HSA A;  4F7H A;  5D3W A;  5JHH A;  2VSZ A;  2EMT A;  3D8E A;  1XCG A;  1K5D B;  1MPH A;  2YS3 A;  3O96 A;  2W2W A;  2M14 A;  1LW3 A;  1U5G A;  4IOY X;  5M4Y B;  2FJL A;  2K2U A;  2KIE A;  4QJ3 B;  2YT2 A;  3MDB C;  1B55 A;  4NSW A;  1V88 A;  4IAP A;  5KQ4 A;  1XD4 A;  3WYF B;  1I7A A;  2UZR A;  3FEH A;  2I5F A;  5LOP B;  3DXD A;  3ZVR A;  1ZC4 B;  3TVV A;  2KUQ A;  3OAN A;  2J0M A;  3KRX A;  4L6E A;  3RCP A;  1V5M A;  1H10 A;  2DYQ A;  2YF0 A;  4HB3 B;  3PZD A;  1NTY A;  1P5T A;  1FB8 A;  1KZ7 A;  2R09 A;  2K8E A;  4HB2 B;  4HB0 B;  3DCX A;  4OT1 A;  4A6K A;  2YS1 A;  4HB4 B;  2CY4 A;  1WGU A;  4HAX B;  1X05 A;  1Z87 A;  5HE3 A;  2Z0P A;  3TO1 A;  5DI9 B;  1W1H A;  2HTH B;  2DHI A;  1UNR A;  4HAW B;  2COC A;  4KHA A;  4K2O A;  1FAO A;  1MK9 B;  2EC1 A;  1I2H A;  5JP4 A;  1XX0 A;  1DDV A;  2RVB B;  1ZYI A;  4HAU B;  2DX1 A;  2UZS A;  1XR0 B;  2Y8F A;  1V89 A;  2GCJ A;  2IFS A;  1Y19 B;  4H8S A;  3A8Q A;  5C16 A;  1GC6 A;  1DDM A;  4F7G A;  3N7C A;  1EVH A;  2KGX B;  4EMO A;  2H7D A;  4DIX A;  2RRF A;  2AL6 A;  3A58 A;  2VRW B;  2J59 M;  5FI0 A;  1UEF A;  2GJY A;  3KRW A;  4MK0 A;  1W1G A;  1WI1 A;  1RRP B;  2LOZ A;  1V61 A;  3WA0 A;  1OMW A;  1PFJ A;  3PVU A;  2KUP A;  2LKO A;  2KCJ A;  2ZPY A;  2D2Q A;  1QQG A;  2P0H A;  4P7I A;  1GC7 A;  3SYX A;  3FVC A;  3FSS A;  2M38 A;  1KZG A;  5DHA B;  4CHM A;  1PLS A;  4ZRI A;  1U29 A;  4OSN A;  3KZ1 A;  4KVG B;  3V5W A;  3QWM A;  2LG1 A;  3NWF A;  1KI1 B;  3HIE A;  2W2X D;  3CXB B;  4HSI A;  1EAZ A;  5C5B B;  4KHB B;  3LJU X;  4A5K A;  3NWD A;  1QC6 A;  4K2P A;  2D11 A;  3PP2 A;  3X23 A;  5LON B;  2JP2 A;  4A6F A;  2GUM A;  1OQN A;  4GMV A;  2Y8G A;  5GOW B;  2NZ8 B;  1Q67 A;  5DH9 B;  3GYO A;  3SNH A;  4A6H A;  1EF1 A;  1DYN A;  1SGH A;  2P8V A;  4TYZ A;  5D3Y A;  4K81 A;  1P3R A;  5HE1 A;  2J0K A;  4B6H A;  4GNK B;  4DXA B;  1M7R A;  5DHF B;  1FHX A;  4YON A;  2LYD A;  3D8D A;  2ELB A;  4HDO A;  2K49 A;  3U12 A;  2G35 A;  2DA0 A;  1U5D A;  1V5P A;  2QKL A;  2RGN B;  1WG7 A;  1NI2 A;  1J19 A;  4GN1 A;  1J0W A;  4QXA B;  2DTC A;  2FJU B;  1UPR A;  2LUL A;  2YSZ A;  3CIK A;  3KSY A;  1U5E A;  5C79 A;  2R0D A;  3ML4 A;  2GS0 A;  1XOD A;  2MFQ A;  2RNR B;  2CAY A;  2RSG A;  2IYB A;  1WJM A;  2MKR A;  3MPX A;  3ULB A;  4CSQ A;  4EKU A;  4WVF B;  3VOQ A;  3VIA A;  3PEG A;  1T77 A;  1X1F A;  4GPT B;  2Z59 A;  5HE2 A;  4QJ4 B;  2RLO A;  4GMX B;  1U2B A;  2VKI A;  2I1K A;  5JHG A;  3AU4 A;  3BIN A;  1TJ6 A;  2D10 A;  5D27 A;  3ULC A;  3U8Z A;  4HHV A;  4CHJ A;  3TCA A;  4L1R A;  2EJ8 A;  2D9X A;  2Y7B A; 
#chains in the Genus database with same CATH homology
 1DDW A;  5J3Y A;  1ZSQ A;  2YRY A;  2V76 A;  1MK7 B;  1TQZ A;  2OTX A;  4MY6 A;  5FI1 A;  1MIZ B;  2CRF A;  3TFM A;  5KQ1 A;  4HAV B;  1WGQ A;  2Q13 A;  4Y94 A;  5C5B A;  4F7U P;  1DBH A;  4KHO A;  3BJI A;  3AJ4 A;  1BTK A;  5HE0 A;  5L81 A;  2CY5 A;  5CLQ B;  3T06 A;  2XQN M;  5D3V A;  2DYN A;  3HQC A;  5C6R A;  4PNK A;  2D9Y A;  1IRS A;  1E5W A;  5CLL B;  1N3H A;  1SHC A;  1ISN A;  2NMB A;  4HAZ B;  2I5C A;  4IFS A;  2N0Y A;  2E2X A;  2YT1 A;  2L1C A;  2MWN B;  5JLJ B;  1MAI A;  3ODX A;  1UNQ A;  2DN6 A;  3SO6 A;  2YVC A;  3PVL A;  1PMS A;  2K00 A;  1X11 A;  2J0J A;  4KAX B;  2W2X C;  1FGY A;  3F0W A;  2L2I A;  3ODO A;  5J3Q A;  1ZM0 A;  3PSC A;  2DX5 A;  2ELA A;  2COD A;  3F5R A;  2DHJ A;  1X86 A;  2D9V A;  1UPQ A;  2DFK A;  2D9W A;  4BBK A;  4HAT B;  4HAY B;  2DLW A;  2D9Z A;  1FOE A;  2Z0Q A;  1EGX A;  1BTN A;  2ROZ B;  3P6A A;  3PG7 A;  2DKQ A;  2X18 A;  4HDQ A;  1U5F A;  2PZ1 A;  2AEH A;  1V5U A;  2MDX A;  2LOX A;  4EJN A;  1P6S A;  2ADZ A;  5DIF B;  4C0A A;  3A8P A;  3A98 B;  5EFX A;  2BCJ A;  3PVW A;  4GZU A;  1GG3 A;  1M7E A;  4CYE A;  4YL8 A;  2YT0 A;  4A6F B;  4ZRK A;  3HW2 B;  4WJ7 A;  1WVH A;  4ZRJ A;  2K2J A;  4DX8 A;  2H7E A;  2COF A;  3G9W A;  1U27 A;  4DX9 0;  3DXC A;  2N23 A;  2Z0O A;  4NY0 A;  3TW1 A;  1NU2 A;  2QKM A;  4WSF A;  3D8F A;  1AWE A;  1X1G A;  3AU5 A;  1XKE A;  3SUZ A;  2UVM A;  4Z2N A;  2D4Q A;  1Y5O A;  3UZT A;  1RJ2 A;  1AQC A;  1MKE A;  4XWX A;  2GCL A;  4GXB A;  1OY2 A;  1MIX A;  3FM8 C;  3QIJ A;  3NSU A;  1NTV A;  2P0F A;  5D3X A;  5KCV A;  1W1D A;  5J3T A;  3QBV B;  1FGZ A;  4Z2M B;  2P0D A;  1LB1 A;  4K17 A;  3SV1 A;  3DXE A;  1K5G B;  3GYP A;  2DHK A;  1FHO A;  4D0N B;  4PQ0 A;  3IVF A;  1TXD A;  3ODW A;  1WJ1 A;  2RUK B;  1ZVR A;  2HE7 A;  3ZDT A;  2OQB A;  3U7D A;  2YS5 A;  2I1J A;  1DRO A;  2COA A;  3KY9 A;  3M1I B;  1H4R A;  3P7Z A;  4TKN A;  1ZC3 B;  2ROV A;  1BWN A;  1FHW A;  3HK0 A;  1BAK A;  2EMS A;  2DKP A;  4MT7 A;  1UNP A;  4DBB A;  4F7H A;  5D3W A;  5JHH A;  2VSZ A;  2EMT A;  3D8E A;  1XCG A;  1K5D B;  1MPH A;  2YS3 A;  3O96 A;  2W2W A;  2M14 A;  1LW3 A;  1U5G A;  4IOY X;  2FJL A;  2K2U A;  3MDB C;  1B55 A;  4NSW A;  1V88 A;  4IAP A;  5KQ4 A;  1XD4 A;  3WYF B;  1I7A A;  2UZR A;  3FEH A;  2I5F A;  5LOP B;  3DXD A;  3ZVR A;  1ZC4 B;  3TVV A;  3OAN A;  2J0M A;  3KRX A;  4L6E A;  3RCP A;  1V5M A;  1H10 A;  2DYQ A;  2YF0 A;  4HB3 B;  3PZD A;  1NTY A;  1P5T A;  1FB8 A;  1KZ7 A;  2R09 A;  4HB2 B;  4HB0 B;  4A6K A;  2YS1 A;  4HB4 B;  2CY4 A;  1WGU A;  4HAX B;  1X05 A;  1Z87 A;  5HE3 A;  2Z0P A;  3TO1 A;  5DI9 B;  1W1H A;  2HTH B;  2DHI A;  1UNR A;  4HAW B;  2COC A;  4KHA A;  4K2O A;  1FAO A;  1MK9 B;  2EC1 A;  1I2H A;  5JP4 A;  1XX0 A;  1DDV A;  2RVB B;  4HAU B;  2DX1 A;  2UZS A;  1XR0 B;  2Y8F A;  1V89 A;  2GCJ A;  2IFS A;  1Y19 B;  4H8S A;  3A8Q A;  5C16 A;  1GC6 A;  1DDM A;  4F7G A;  3N7C A;  1EVH A;  2KGX B;  4EMO A;  2H7D A;  2AL6 A;  2VRW B;  2J59 M;  5FI0 A;  1UEF A;  2GJY A;  3KRW A;  4MK0 A;  1W1G A;  1WI1 A;  1RRP B;  2LOZ A;  1V61 A;  3WA0 A;  1OMW A;  1PFJ A;  3PVU A;  2KUP A;  2LKO A;  2KCJ A;  2ZPY A;  2D2Q A;  1QQG A;  2P0H A;  4P7I A;  1GC7 A;  3SYX A;  3FSS A;  2M38 A;  1KZG A;  5DHA B;  4CHM A;  1PLS A;  4ZRI A;  1U29 A;  3KZ1 A;  4KVG B;  3V5W A;  3QWM A;  2LG1 A;  1KI1 B;  2W2X D;  3CXB B;  1EAZ A;  5C5B B;  4KHB B;  3LJU X;  4A5K A;  1QC6 A;  4K2P A;  2D11 A;  3PP2 A;  3X23 A;  5LON B;  2JP2 A;  4A6F A;  1OQN A;  4GMV A;  2Y8G A;  5GOW B;  2NZ8 B;  1Q67 A;  5DH9 B;  3GYO A;  3SNH A;  4A6H A;  1EF1 A;  1DYN A;  1SGH A;  2P8V A;  4TYZ A;  5D3Y A;  4K81 A;  1P3R A;  5HE1 A;  2J0K A;  4B6H A;  4DXA B;  1M7R A;  5DHF B;  1FHX A;  4YON A;  2LYD A;  3D8D A;  2ELB A;  4HDO A;  2G35 A;  2DA0 A;  1U5D A;  1V5P A;  2QKL A;  2RGN B;  1WG7 A;  1NI2 A;  1J19 A;  4GN1 A;  1J0W A;  2DTC A;  1UPR A;  2LUL A;  2YSZ A;  3CIK A;  3KSY A;  1U5E A;  5C79 A;  2R0D A;  3ML4 A;  2GS0 A;  1XOD A;  2MFQ A;  2RNR B;  2CAY A;  2RSG A;  2IYB A;  1WJM A;  2MKR A;  3MPX A;  3ULB A;  4EKU A;  4WVF B;  3VOQ A;  3VIA A;  3PEG A;  1X1F A;  4GPT B;  5HE2 A;  2RLO A;  4GMX B;  1U2B A;  2VKI A;  2I1K A;  5JHG A;  3AU4 A;  3BIN A;  1TJ6 A;  2D10 A;  5D27 A;  3ULC A;  3U8Z A;  4HHV A;  4CHJ A;  3TCA A;  2EJ8 A;  2D9X A;  2Y7B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...