2LYDA

The solution structure of the dm dcp1 evh1 domain in complex with the xrn1 dbm peptide
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
134
structure length
134
Chain Sequence
GPHMADLMADESITRMNLAAIKKIDPYAKEIVDSSSHVAFYTFNSSQNEWEKTDVEGAFFIYHRNAEPFHSIFINNRLNTTSFVEPITGSLELQSQPPFLLYRNERSRIRGFWFYNSEECDRISGLVNGLLKSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A direct interaction between DCP1 and XRN1 couples mRNA decapping to 5' exonucleolytic degradation.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transcription/protein binding
molecule keywords Decapping protein 1
total genus 23
structure length 134
sequence length 134
ec nomenclature
pdb deposition date 2012-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06058 DCP1 Dcp1-like decapping family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2lydA00
4IOYX 4Z2NA 2YRYA 2DTCA 1PFJA 1QQGA 2DYNA 2VSZA 2BCJA 1AWEA 5JLJB 2DHIA 1K5DB 2YS3A 1V89A 3RCPA 3SNHA 1ZSQA 2MDXA 2OTXA 2MWNB 5D3WA 1WJ1A 1EAZA 2ADZA 3VOQA 4HHVA 2V76A 1NI2A 4MK0A 2J0JA 4GMVA 2D9XA 2K2JA 4XWXA 1DROA 3PZDA 4F7HA 2DLWA 2IFSA 1GC6A 3TW1A 1MK9B 2EMTA 1PMSA 1U5FA 2UZRA 1V88A 4TYZA 2CY5A 1U5EA 2DKPA 3VIAA 1EGXA 4B6HA 1DBHA 3KY9A 2COCA 1FGYA 2H7EA 2YT1A 4A6KA 1GG3A 3MDBC 3ZVRA 1V5UA 2MFQA 5J3TA 3D8FA 2HE7A 3ML4A 4PQ0A 4HDOA 3SV1A 1Y5OA 2GJYA 2P0DA 4CHJA 3P7ZA 1KZGA 3AU4A 5D3VA 1RRPB 4MT7A 1MAIA 5C6RA 3QIJA 1OQNA 1V61A 3NSUA 3ULCA 4KHBB 1LW3A 2RNRB 1UNRA 3BINA 1AQCA 3A8PA 1ZVRA 3KZ1A 4GZUA 1NTYA 2RGNB 4HDQA 1SGHA 3TVVA 5LONB 3ODWA 1NU2A 3SYXA 5HE3A 3FSSA 2J0KA 1FOEA 5D3XA 2D9YA 3KSYA 4WVFB 1UNPA 3TCAA 3G9WA 5DI9B 4ZRIA 3F5RA 1W1DA 1BAKA 2CODA 5EFXA 1WVHA 2N0YA 3AU5A 3CXBB 1XKEA 1MIXA 3GYOA 3OANA 4YL8A 4Z2MB 1RJ2A 2JP2A 4TKNA 2PZ1A 1I2HA 2UZSA 2YF0A 1ZC4B 5LOPB 3PSCA 3QWMA 2FJLA 2GCJA 4GMXB 3P6AA 3M1IB 1P3RA 3D8DA 3UZTA 2GCLA 4HAYB 5D3YA 4HB2B 1XX0A 4Y94A 4MY6A 5KCVA 3T06A 2D4QA 2M38A 2DN6A 1X1GA 5L81A 1DDMA 3WYFB 1WGUA 2LYDA 2D2QA 1X11A 5C5BA 2DFKA 4ZRKA 2RUKB 2Z0OA 2DYQA 2Q13A 2UVMA 2K2UA 2RSGA 2N23A 2W2XC 1QC6A 2XQNM 1UEFA 4GPTB 1KZ7A 4IAPA 4L6EA 1WG7A 2LOXA 3PP2A 2R0DA 4A6FB 2OQBA 3KRXA 2CY4A 4KVGB 3A8QA 1BWNA 3F0WA 2CAYA 1I7AA 1XR0B 3TO1A 2YT0A 1DDWA 3KRWA 2KUPA 5J3YA 2ROZB 1W1HA 3X23A 4CYEA 4YONA 3BJIA 1E5WA 1TXDA 2W2WA 2I5FA 3V5WA 1X1FA 2D9ZA 4K2PA 2QKMA 2YVCA 2YS5A 2HTHB 3U7DA 2X18A 4EKUA 1MPHA 5KQ1A 1XCGA 4K2OA 4HAUB 1FHWA 3HW2B 1DYNA 3MPXA 1TQZA 1UPQA 2RLOA 5DIFB 2AL6A 4K17A 1OY2A 3O96A 1ISNA 5GOWB 3DXDA 3SUZA 1NTVA 4A6FA 4EMOA 4GXBA 4HAWB 2G35A 5CLQB 2J59M 4KHAA 1XD4A 5FI1A 1EF1A 2RVBB 1H4RA 2M14A 3WA0A 2I1JA 2NZ8B 4WSFA 1Y19B 1FGZA 4P7IA 2H7DA 1H10A 3N7CA 5C5BB 3FM8C 2D11A 2L2IA 4D0NB 4NY0A 2MKRA 4HAXB 2YSZA 3HQCA 4DX8A 1X86A 1Z87A 2E2XA 5DHFB 4DXAB 4ZRJA 1EVHA 3DXCA 1SHCA 3ULBA 5HE2A 3ZDTA 2DHKA 1WGQA 3GYPA 2GS0A 1XODA 1P5TA 2I5CA 2DA0A 2Y7BA 5HE1A 4HAZB 5JP4A 1KI1B 1MK7B 1PLSA 1BTNA 1OMWA 3HK0A 4HB4B 1M7EA 3A98B 1J0WA 3D8EA 3PVLA 3AJ4A 2P0FA 2EC1A 4IFSA 2ELBA 1WJMA 5C16A 1LB1A 4KAXB 2DKQA 1U5DA 2W2XD 1FHXA 1GC7A 4H8SA 4WJ7A 5HE0A 4F7UP 4HB0B 1W1GA 1UPRA 2J0MA 1ZM0A 5D27A 1U27A 1BTKA 4PNKA 3PVWA 3U8ZA 1B55A 5DHAB 1WI1A 2P8VA 4F7GA 2LG1A 5DH9B 3QBVB 2IYBA 3IVFA 1P6SA 2DHJA 1TJ6A 2P0HA 4K81A 4GN1A 2D9VA 2KCJA 1FAOA 1FHOA 2QKLA 2COFA 1U29A 4EJNA 5C79A 1J19A 3DXEA 1U2BA 1U5GA 1MKEA 4CHMA 3CIKA 3ODOA 2CRFA 3PEGA 3LJUX 1DDVA 2AEHA 2LOZA 5KQ4A 2Y8GA 1ZC3B 1N3HA 2EMSA 3SO6A 3PVUA 4BBKA 1K5GB 2DX1A 1V5MA 3FEHA 2L1CA 1FB8A 1Q67A 1V5PA 4HATB 4HB3B 2ROVA 4DX90 2D9WA 5J3QA 2YS1A 3PG7A 2Z0PA 2R09A 2COAA 2ELAA 2KGXB 5JHGA 2ZPYA 3ODXA 4A5KA 5FI0A 2D10A 2LULA 1IRSA 2VKIA 1UNQA 4NSWA 2I1KA 3TFMA 1MIZB 4KHOA 2Z0QA 2K00A 1M7RA 2VRWB 5CLLB 5JHHA 4C0AA 2NMBA 2Y8FA 4DBBA 2DX5A 4HAVB 2EJ8A 1X05A 4A6HA 2LKOA
chains in the Genus database with same CATH superfamily
4OSNA 4IOYX 4Z2NA 2YRYA 2DTCA 1PFJA 1QQGA 2DYNA 2VSZA 2BCJA 1AWEA 5JLJB 2DHIA 2R2YA 1K5DB 2YS3A 1V89A 3RCPA 3SNHA 1ZSQA 2KR0A 2MDXA 2OTXA 2MWNB 5D3WA 1WJ1A 1EAZA 2ADZA 3VOQA 4HHVA 2V76A 1NI2A 4MK0A 2J0JA 4GMVA 2D9XA 2K2JA 4XWXA 1DROA 3PZDA 4F7HA 2DLWA 2IFSA 3U12A 1GC6A 3TW1A 2Z4DA 1MK9B 2EMTA 1PMSA 1U5FA 2UZRA 1V88A 4TYZA 2CY5A 1U5EA 2DKPA 3VIAA 4D6WA 1EGXA 4B6HA 1DBHA 3KY9A 2COCA 1FGYA 2H7EA 2YT1A 4A6KA 1GG3A 3MDBC 3ZVRA 1V5UA 2MFQA 5J3TA 3D8FA 2HE7A 3ML4A 4PQ0A 4HDOA 3SV1A 2K49A 1Y5OA 2GJYA 1ZYIA 2P0DA 4CHJA 3P7ZA 1KZGA 3AU4A 5D3VA 1RRPB 4MT7A 1MAIA 5C6RA 3QIJA 1OQNA 1V61A 3NSUA 3ULCA 3FVCA 4KHBB 1LW3A 2RNRB 2FJUB 2Z14A 3OHMB 1UNRA 3BINA 1AQCA 3A8PA 1ZVRA 3KZ1A 4GZUA 1NTYA 2RGNB 4HDQA 1SGHA 3TVVA 5LONB 3ODWA 1NU2A 3SYXA 5HE3A 5LG4B 3FSSA 2J0KA 1FOEA 5D3XA 2D9YA 3KSYA 4WVFB 1UNPA 3TCAA 3G9WA 5DI9B 4ZRIA 3F5RA 1W1DA 1BAKA 2CODA 5EFXA 1WVHA 2N0YA 4QXAB 3AU5A 3CXBB 1XKEA 1MIXA 3GYOA 3OANA 4YL8A 4Z2MB 1RJ2A 2JP2A 4TKNA 2PZ1A 1I2HA 2UZSA 2YF0A 1ZC4B 5LOPB 3PSCA 3QWMA 2FJLA 2GCJA 4GMXB 3P6AA 3M1IB 1P3RA 3D8DA 3UZTA 2GCLA 4HAYB 2KUQA 5D3YA 4HB2B 1XX0A 4Y94A 4MY6A 5KCVA 3T06A 2D4QA 2M38A 2DN6A 4L1RA 1X1GA 4HSIA 5L81A 1DDMA 3WYFB 1WGUA 2LYDA 2D2QA 1X11A 5C5BA 2DFKA 4ZRKA 2RUKB 2Z0OA 2DYQA 4OT1A 2Q13A 2UVMA 2K2UA 2RSGA 2N23A 2W2XC 1QC6A 2XQNM 1UEFA 1MI1A 4GPTB 1KZ7A 4IAPA 4L6EA 1WG7A 2LOXA 3PP2A 4CSQA 2KIEA 2R0DA 4A6FB 2OQBA 3KRXA 2CY4A 4KVGB 3A8QA 1BWNA 3F0WA 2CAYA 1I7AA 1XR0B 3TO1A 2YT0A 1DDWA 3NW8A 5IRSA 3KRWA 2KUPA 5J3YA 2ROZB 2RRFA 1W1HA 3X23A 4CYEA 4YONA 3BJIA 1E5WA 1TXDA 2W2WA 2I5FA 3V5WA 1X1FA 2D9ZA 4K2PA 2QKMA 2YVCA 2YS5A 2HTHB 3U7DA 2X18A 4EKUA 1MPHA 5KQ1A 1XCGA 4HAUB 4K2OA 1FHWA 3HW2B 1DYNA 3MPXA 1TQZA 1UPQA 2RLOA 5DIFB 2AL6A 4K17A 1OY2A 3O96A 1ISNA 5GOWB 3DXDA 3SUZA 1NTVA 4A6FA 4EMOA 4GXBA 4HAWB 2G35A 5CLQB 2J59M 4KHAA 1XD4A 5FI1A 1EF1A 2RVBB 4DIXA 1H4RA 2M14A 3WA0A 2I1JA 2NZ8B 4WSFA 1Y19B 1FGZA 4QJ3B 4P7IA 2H7DA 4GOUA 1H10A 3NWAA 3N7CA 5C5BB 3FM8C 2D11A 2L2IA 4D0NB 4NY0A 2MKRA 4HAXB 2YSZA 3HQCA 4DX8A 1X86A 1Z87A 2E2XA 5DHFB 4DXAB 4ZRJA 1EVHA 3DXCA 1SHCA 3ULBA 5HE2A 2ZKMX 3ZDTA 2DHKA 1WGQA 3GYPA 2GS0A 1XODA 1P5TA 2I5CA 2DA0A 2Y7BA 5HE1A 4HAZB 5JP4A 1KI1B 1MK7B 1PLSA 1BTNA 2YT2A 1OMWA 3HK0A 4HB4B 1M7EA 3A98B 1J0WA 3D8EA 3PVLA 3AJ4A 2P0FA 2EC1A 4IFSA 2ELBA 2Z13A 1WJMA 5C16A 1LB1A 5I2MA 4QJ5B 4KAXB 2DKQA 1U5DA 2W2XD 1FHXA 1GC7A 4H8SA 4WJ7A 5HE0A 4F7UP 4HB0B 1W1GA 1UPRA 2J0MA 1ZM0A 5D27A 1U27A 1BTKA 4PNKA 3PVWA 3U8ZA 4GNKB 1B55A 5DHAB 1WI1A 2P8VA 4F7GA 2LG1A 5DH9B 3QBVB 2IYBA 3IVFA 1P6SA 2DHJA 1TJ6A 2GUMA 2P0HA 4K81A 2Z59A 4GN1A 2D9VA 2KIGA 2KCJA 1FAOA 3NWFA 1FHOA 2QKLA 2COFA 1U29A 4EJNA 5C79A 1J19A 3NWDA 3DXEA 5I2SA 1U2BA 2NBVA 5M4YB 1U5GA 1MKEA 4CHMA 3CIKA 3ODOA 2CRFA 3PEGA 3LJUX 1DDVA 2AEHA 2LOZA 5KQ4A 2Y8GA 1T77A 1N3HA 1ZC3B 2EMSA 3SO6A 3PVUA 4BBKA 1K5GB 2DX1A 1V5MA 3FEHA 2L1CA 4QJ4B 1FB8A 1Q67A 1V5PA 4HATB 4HB3B 2ROVA 4DX90 2D9WA 3A58A 5J3QA 2YS1A 3B77A 3PG7A 2Z0PA 2R09A 2COAA 2ELAA 2KGXB 5JHGA 2ZPYA 3ODXA 4A5KA 5FI0A 3DCXA 2D10A 2LULA 1IRSA 4KHBA 2VKIA 1UNQA 4NSWA 3HSAA 2I1KA 3TFMA 1MIZB 4KHOA 3HIEA 2Z0QA 2K00A 1M7RA 2VRWB 5CLLB 5JHHA 4C0AA 2NMBA 2Y8FA 4DBBA 2K8EA 2DX5A 4HAVB 2EJ8A 1X05A 4A6HA 2LKOA
chains in the Genus database with same CATH topology
4IOYX 4Z2NA 2YRYA 2DTCA 1PFJA 1QQGA 2DYNA 2VSZA 2BCJA 1AWEA 5JLJB 2DHIA 1K5DB 2YS3A 1V89A 3RCPA 3SNHA 1ZSQA 2MDXA 2OTXA 2MWNB 5D3WA 1WJ1A 1EAZA 2ADZA 3VOQA 4HHVA 2V76A 1NI2A 4MK0A 2J0JA 4GMVA 2D9XA 2K2JA 4XWXA 1DROA 3PZDA 4F7HA 2DLWA 2IFSA 1GC6A 3TW1A 1MK9B 2EMTA 1PMSA 1U5FA 2UZRA 1V88A 4TYZA 2CY5A 1U5EA 2DKPA 3VIAA 1EGXA 4B6HA 1DBHA 3KY9A 2COCA 1FGYA 2H7EA 2YT1A 4A6KA 1GG3A 3MDBC 3ZVRA 1V5UA 2MFQA 5J3TA 3D8FA 2HE7A 3ML4A 4PQ0A 4HDOA 3SV1A 1Y5OA 2GJYA 2P0DA 4CHJA 3P7ZA 1KZGA 3AU4A 5D3VA 1RRPB 4MT7A 1MAIA 5C6RA 3QIJA 1OQNA 1V61A 3NSUA 3ULCA 4KHBB 1LW3A 2RNRB 1UNRA 3BINA 1AQCA 3A8PA 1ZVRA 3KZ1A 4GZUA 1NTYA 2RGNB 4HDQA 1SGHA 3TVVA 5LONB 3ODWA 1NU2A 3SYXA 5HE3A 3FSSA 2J0KA 1FOEA 5D3XA 2D9YA 3KSYA 4WVFB 1UNPA 3TCAA 3G9WA 5DI9B 4ZRIA 3F5RA 1W1DA 1BAKA 2CODA 5EFXA 1WVHA 2N0YA 3AU5A 3CXBB 1XKEA 1MIXA 3GYOA 3OANA 4YL8A 4Z2MB 1RJ2A 2JP2A 4TKNA 2PZ1A 1I2HA 2UZSA 2YF0A 1ZC4B 5LOPB 3PSCA 3QWMA 2FJLA 2GCJA 4GMXB 3P6AA 3M1IB 1P3RA 3D8DA 3UZTA 2GCLA 4HAYB 5D3YA 4HB2B 1XX0A 4Y94A 4MY6A 5KCVA 3T06A 2D4QA 2M38A 2DN6A 1X1GA 5L81A 1DDMA 3WYFB 1WGUA 2LYDA 2D2QA 1X11A 5C5BA 2DFKA 4ZRKA 2RUKB 2Z0OA 2DYQA 2Q13A 2UVMA 2K2UA 2RSGA 2N23A 2W2XC 1QC6A 2XQNM 1UEFA 4GPTB 1KZ7A 4IAPA 4L6EA 1WG7A 2LOXA 3PP2A 2R0DA 4A6FB 2OQBA 3KRXA 2CY4A 4KVGB 3A8QA 1BWNA 3F0WA 2CAYA 1I7AA 1XR0B 3TO1A 2YT0A 1DDWA 3KRWA 2KUPA 5J3YA 2ROZB 1W1HA 3X23A 4CYEA 4YONA 3BJIA 1E5WA 1TXDA 2W2WA 2I5FA 3V5WA 1X1FA 2D9ZA 4K2PA 2QKMA 2YVCA 2YS5A 2HTHB 3U7DA 2X18A 4EKUA 1MPHA 5KQ1A 1XCGA 4K2OA 4HAUB 1FHWA 3HW2B 1DYNA 3MPXA 1TQZA 1UPQA 2RLOA 5DIFB 2AL6A 4K17A 1OY2A 3O96A 1ISNA 5GOWB 3DXDA 3SUZA 1NTVA 4A6FA 4EMOA 4GXBA 4HAWB 2G35A 5CLQB 2J59M 4KHAA 1XD4A 5FI1A 1EF1A 2RVBB 1H4RA 2M14A 3WA0A 2I1JA 2NZ8B 4WSFA 1Y19B 1FGZA 4P7IA 2H7DA 1H10A 3N7CA 5C5BB 3FM8C 2D11A 2L2IA 4D0NB 4NY0A 2MKRA 4HAXB 2YSZA 3HQCA 4DX8A 1X86A 1Z87A 2E2XA 5DHFB 4DXAB 4ZRJA 1EVHA 3DXCA 1SHCA 3ULBA 5HE2A 3ZDTA 2DHKA 1WGQA 3GYPA 2GS0A 1XODA 1P5TA 2I5CA 2DA0A 2Y7BA 5HE1A 4HAZB 5JP4A 1KI1B 1MK7B 1PLSA 1BTNA 1OMWA 3HK0A 4HB4B 1M7EA 3A98B 1J0WA 3D8EA 3PVLA 3AJ4A 2P0FA 2EC1A 4IFSA 2ELBA 1WJMA 5C16A 1LB1A 4KAXB 2DKQA 1U5DA 2W2XD 1FHXA 1GC7A 4H8SA 4WJ7A 5HE0A 4F7UP 4HB0B 1W1GA 1UPRA 2J0MA 1ZM0A 5D27A 1U27A 1BTKA 4PNKA 3PVWA 3U8ZA 1B55A 5DHAB 1WI1A 2P8VA 4F7GA 2LG1A 5DH9B 3QBVB 2IYBA 3IVFA 1P6SA 2DHJA 1TJ6A 2P0HA 4K81A 4GN1A 2D9VA 2KCJA 1FAOA 1FHOA 2QKLA 2COFA 1U29A 4EJNA 5C79A 1J19A 3DXEA 1U2BA 1U5GA 1MKEA 4CHMA 3CIKA 3ODOA 2CRFA 3PEGA 3LJUX 1DDVA 2AEHA 2LOZA 5KQ4A 2Y8GA 1ZC3B 1N3HA 2EMSA 3SO6A 3PVUA 4BBKA 1K5GB 2DX1A 1V5MA 3FEHA 2L1CA 1FB8A 1Q67A 1V5PA 4HATB 4HB3B 2ROVA 4DX90 2D9WA 5J3QA 2YS1A 3PG7A 2Z0PA 2R09A 2COAA 2ELAA 2KGXB 5JHGA 2ZPYA 3ODXA 4A5KA 5FI0A 2D10A 2LULA 1IRSA 2VKIA 1UNQA 4NSWA 2I1KA 3TFMA 1MIZB 4KHOA 2Z0QA 2K00A 1M7RA 2VRWB 5CLLB 5JHHA 4C0AA 2NMBA 2Y8FA 4DBBA 2DX5A 4HAVB 2EJ8A 1X05A 4A6HA 2LKOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IOY X;  4Z2N A;  2YRY A;  2DTC A;  1PFJ A;  1QQG A;  2DYN A;  2VSZ A;  2BCJ A;  1AWE A;  5JLJ B;  2DHI A;  1K5D B;  2YS3 A;  1V89 A;  3RCP A;  3SNH A;  1ZSQ A;  2MDX A;  2OTX A;  2MWN B;  5D3W A;  1WJ1 A;  1EAZ A;  2ADZ A;  3VOQ A;  4HHV A;  2V76 A;  1NI2 A;  4MK0 A;  2J0J A;  4GMV A;  2D9X A;  2K2J A;  4XWX A;  1DRO A;  3PZD A;  4F7H A;  2DLW A;  2IFS A;  1GC6 A;  3TW1 A;  1MK9 B;  2EMT A;  1PMS A;  1U5F A;  2UZR A;  1V88 A;  4TYZ A;  2CY5 A;  1U5E A;  2DKP A;  3VIA A;  1EGX A;  4B6H A;  1DBH A;  3KY9 A;  2COC A;  1FGY A;  2H7E A;  2YT1 A;  4A6K A;  1GG3 A;  3MDB C;  3ZVR A;  1V5U A;  2MFQ A;  5J3T A;  3D8F A;  2HE7 A;  3ML4 A;  4PQ0 A;  4HDO A;  3SV1 A;  1Y5O A;  2GJY A;  2P0D A;  4CHJ A;  3P7Z A;  1KZG A;  3AU4 A;  5D3V A;  1RRP B;  4MT7 A;  1MAI A;  5C6R A;  3QIJ A;  1OQN A;  1V61 A;  3NSU A;  3ULC A;  4KHB B;  1LW3 A;  2RNR B;  1UNR A;  3BIN A;  1AQC A;  3A8P A;  1ZVR A;  3KZ1 A;  4GZU A;  1NTY A;  2RGN B;  4HDQ A;  1SGH A;  3TVV A;  5LON B;  3ODW A;  1NU2 A;  3SYX A;  5HE3 A;  3FSS A;  2J0K A;  1FOE A;  5D3X A;  2D9Y A;  3KSY A;  4WVF B;  1UNP A;  3TCA A;  3G9W A;  5DI9 B;  4ZRI A;  3F5R A;  1W1D A;  1BAK A;  2COD A;  5EFX A;  1WVH A;  2N0Y A;  3AU5 A;  3CXB B;  1XKE A;  1MIX A;  3GYO A;  3OAN A;  4YL8 A;  4Z2M B;  1RJ2 A;  2JP2 A;  4TKN A;  2PZ1 A;  1I2H A;  2UZS A;  2YF0 A;  1ZC4 B;  5LOP B;  3PSC A;  3QWM A;  2FJL A;  2GCJ A;  4GMX B;  3P6A A;  3M1I B;  1P3R A;  3D8D A;  3UZT A;  2GCL A;  4HAY B;  5D3Y A;  4HB2 B;  1XX0 A;  4Y94 A;  4MY6 A;  5KCV A;  3T06 A;  2D4Q A;  2M38 A;  2DN6 A;  1X1G A;  5L81 A;  1DDM A;  3WYF B;  1WGU A;  2LYD A;  2D2Q A;  1X11 A;  5C5B A;  2DFK A;  4ZRK A;  2RUK B;  2Z0O A;  2DYQ A;  2Q13 A;  2UVM A;  2K2U A;  2RSG A;  2N23 A;  2W2X C;  1QC6 A;  2XQN M;  1UEF A;  4GPT B;  1KZ7 A;  4IAP A;  4L6E A;  1WG7 A;  2LOX A;  3PP2 A;  2R0D A;  4A6F B;  2OQB A;  3KRX A;  2CY4 A;  4KVG B;  3A8Q A;  1BWN A;  3F0W A;  2CAY A;  1I7A A;  1XR0 B;  3TO1 A;  2YT0 A;  1DDW A;  3KRW A;  2KUP A;  5J3Y A;  2ROZ B;  1W1H A;  3X23 A;  4CYE A;  4YON A;  3BJI A;  1E5W A;  1TXD A;  2W2W A;  2I5F A;  3V5W A;  1X1F A;  2D9Z A;  4K2P A;  2QKM A;  2YVC A;  2YS5 A;  2HTH B;  3U7D A;  2X18 A;  4EKU A;  1MPH A;  5KQ1 A;  1XCG A;  4K2O A;  4HAU B;  1FHW A;  3HW2 B;  1DYN A;  3MPX A;  1TQZ A;  1UPQ A;  2RLO A;  5DIF B;  2AL6 A;  4K17 A;  1OY2 A;  3O96 A;  1ISN A;  5GOW B;  3DXD A;  3SUZ A;  1NTV A;  4A6F A;  4EMO A;  4GXB A;  4HAW B;  2G35 A;  5CLQ B;  2J59 M;  4KHA A;  1XD4 A;  5FI1 A;  1EF1 A;  2RVB B;  1H4R A;  2M14 A;  3WA0 A;  2I1J A;  2NZ8 B;  4WSF A;  1Y19 B;  1FGZ A;  4P7I A;  2H7D A;  1H10 A;  3N7C A;  5C5B B;  3FM8 C;  2D11 A;  2L2I A;  4D0N B;  4NY0 A;  2MKR A;  4HAX B;  2YSZ A;  3HQC A;  4DX8 A;  1X86 A;  1Z87 A;  2E2X A;  5DHF B;  4DXA B;  4ZRJ A;  1EVH A;  3DXC A;  1SHC A;  3ULB A;  5HE2 A;  3ZDT A;  2DHK A;  1WGQ A;  3GYP A;  2GS0 A;  1XOD A;  1P5T A;  2I5C A;  2DA0 A;  2Y7B A;  5HE1 A;  4HAZ B;  5JP4 A;  1KI1 B;  1MK7 B;  1PLS A;  1BTN A;  1OMW A;  3HK0 A;  4HB4 B;  1M7E A;  3A98 B;  1J0W A;  3D8E A;  3PVL A;  3AJ4 A;  2P0F A;  2EC1 A;  4IFS A;  2ELB A;  1WJM A;  5C16 A;  1LB1 A;  4KAX B;  2DKQ A;  1U5D A;  2W2X D;  1FHX A;  1GC7 A;  4H8S A;  4WJ7 A;  5HE0 A;  4F7U P;  4HB0 B;  1W1G A;  1UPR A;  2J0M A;  1ZM0 A;  5D27 A;  1U27 A;  1BTK A;  4PNK A;  3PVW A;  3U8Z A;  1B55 A;  5DHA B;  1WI1 A;  2P8V A;  4F7G A;  2LG1 A;  5DH9 B;  3QBV B;  2IYB A;  3IVF A;  1P6S A;  2DHJ A;  1TJ6 A;  2P0H A;  4K81 A;  4GN1 A;  2D9V A;  2KCJ A;  1FAO A;  1FHO A;  2QKL A;  2COF A;  1U29 A;  4EJN A;  5C79 A;  1J19 A;  3DXE A;  1U2B A;  1U5G A;  1MKE A;  4CHM A;  3CIK A;  3ODO A;  2CRF A;  3PEG A;  3LJU X;  1DDV A;  2AEH A;  2LOZ A;  5KQ4 A;  2Y8G A;  1ZC3 B;  1N3H A;  2EMS A;  3SO6 A;  3PVU A;  4BBK A;  1K5G B;  2DX1 A;  1V5M A;  3FEH A;  2L1C A;  1FB8 A;  1Q67 A;  1V5P A;  4HAT B;  4HB3 B;  2ROV A;  4DX9 0;  2D9W A;  5J3Q A;  2YS1 A;  3PG7 A;  2Z0P A;  2R09 A;  2COA A;  2ELA A;  2KGX B;  5JHG A;  2ZPY A;  3ODX A;  4A5K A;  5FI0 A;  2D10 A;  2LUL A;  1IRS A;  2VKI A;  1UNQ A;  4NSW A;  2I1K A;  3TFM A;  1MIZ B;  4KHO A;  2Z0Q A;  2K00 A;  1M7R A;  2VRW B;  5CLL B;  5JHH A;  4C0A A;  2NMB A;  2Y8F A;  4DBB A;  2DX5 A;  4HAV B;  2EJ8 A;  1X05 A;  4A6H A;  2LKO A; 
#chains in the Genus database with same CATH topology
 4OSN A;  4IOY X;  4Z2N A;  2YRY A;  2DTC A;  1PFJ A;  1QQG A;  2DYN A;  2VSZ A;  2BCJ A;  1AWE A;  5JLJ B;  2DHI A;  2R2Y A;  1K5D B;  2YS3 A;  1V89 A;  3RCP A;  3SNH A;  1ZSQ A;  2KR0 A;  2MDX A;  2OTX A;  2MWN B;  5D3W A;  1WJ1 A;  1EAZ A;  2ADZ A;  3VOQ A;  4HHV A;  2V76 A;  1NI2 A;  4MK0 A;  2J0J A;  4GMV A;  2D9X A;  2K2J A;  4XWX A;  1DRO A;  3PZD A;  4F7H A;  2DLW A;  2IFS A;  3U12 A;  1GC6 A;  3TW1 A;  2Z4D A;  1MK9 B;  2EMT A;  1PMS A;  1U5F A;  2UZR A;  1V88 A;  4TYZ A;  2CY5 A;  1U5E A;  2DKP A;  3VIA A;  4D6W A;  1EGX A;  4B6H A;  1DBH A;  3KY9 A;  2COC A;  1FGY A;  2H7E A;  2YT1 A;  4A6K A;  1GG3 A;  3MDB C;  3ZVR A;  1V5U A;  2MFQ A;  5J3T A;  3D8F A;  2HE7 A;  3ML4 A;  4PQ0 A;  4HDO A;  3SV1 A;  2K49 A;  1Y5O A;  2GJY A;  1ZYI A;  2P0D A;  4CHJ A;  3P7Z A;  1KZG A;  3AU4 A;  5D3V A;  1RRP B;  4MT7 A;  1MAI A;  5C6R A;  3QIJ A;  1OQN A;  1V61 A;  3NSU A;  3ULC A;  3FVC A;  4KHB B;  1LW3 A;  2RNR B;  2FJU B;  2Z14 A;  3OHM B;  1UNR A;  3BIN A;  1AQC A;  3A8P A;  1ZVR A;  3KZ1 A;  4GZU A;  1NTY A;  2RGN B;  4HDQ A;  1SGH A;  3TVV A;  5LON B;  3ODW A;  1NU2 A;  3SYX A;  5HE3 A;  5LG4 B;  3FSS A;  2J0K A;  1FOE A;  5D3X A;  2D9Y A;  3KSY A;  4WVF B;  1UNP A;  3TCA A;  3G9W A;  5DI9 B;  4ZRI A;  3F5R A;  1W1D A;  1BAK A;  2COD A;  5EFX A;  1WVH A;  2N0Y A;  4QXA B;  3AU5 A;  3CXB B;  1XKE A;  1MIX A;  3GYO A;  3OAN A;  4YL8 A;  4Z2M B;  1RJ2 A;  2JP2 A;  4TKN A;  2PZ1 A;  1I2H A;  2UZS A;  2YF0 A;  1ZC4 B;  5LOP B;  3PSC A;  3QWM A;  2FJL A;  2GCJ A;  4GMX B;  3P6A A;  3M1I B;  1P3R A;  3D8D A;  3UZT A;  2GCL A;  4HAY B;  2KUQ A;  5D3Y A;  4HB2 B;  1XX0 A;  4Y94 A;  4MY6 A;  5KCV A;  3T06 A;  2D4Q A;  2M38 A;  2DN6 A;  4L1R A;  1X1G A;  4HSI A;  5L81 A;  1DDM A;  3WYF B;  1WGU A;  2LYD A;  2D2Q A;  1X11 A;  5C5B A;  2DFK A;  4ZRK A;  2RUK B;  2Z0O A;  2DYQ A;  4OT1 A;  2Q13 A;  2UVM A;  2K2U A;  2RSG A;  2N23 A;  2W2X C;  1QC6 A;  2XQN M;  1UEF A;  1MI1 A;  4GPT B;  1KZ7 A;  4IAP A;  4L6E A;  1WG7 A;  2LOX A;  3PP2 A;  4CSQ A;  2KIE A;  2R0D A;  4A6F B;  2OQB A;  3KRX A;  2CY4 A;  4KVG B;  3A8Q A;  1BWN A;  3F0W A;  2CAY A;  1I7A A;  1XR0 B;  3TO1 A;  2YT0 A;  1DDW A;  3NW8 A;  5IRS A;  3KRW A;  2KUP A;  5J3Y A;  2ROZ B;  2RRF A;  1W1H A;  3X23 A;  4CYE A;  4YON A;  3BJI A;  1E5W A;  1TXD A;  2W2W A;  2I5F A;  3V5W A;  1X1F A;  2D9Z A;  4K2P A;  2QKM A;  2YVC A;  2YS5 A;  2HTH B;  3U7D A;  2X18 A;  4EKU A;  1MPH A;  5KQ1 A;  1XCG A;  4HAU B;  4K2O A;  1FHW A;  3HW2 B;  1DYN A;  3MPX A;  1TQZ A;  1UPQ A;  2RLO A;  5DIF B;  2AL6 A;  4K17 A;  1OY2 A;  3O96 A;  1ISN A;  5GOW B;  3DXD A;  3SUZ A;  1NTV A;  4A6F A;  4EMO A;  4GXB A;  4HAW B;  2G35 A;  5CLQ B;  2J59 M;  4KHA A;  1XD4 A;  5FI1 A;  1EF1 A;  2RVB B;  4DIX A;  1H4R A;  2M14 A;  3WA0 A;  2I1J A;  2NZ8 B;  4WSF A;  1Y19 B;  1FGZ A;  4QJ3 B;  4P7I A;  2H7D A;  4GOU A;  1H10 A;  3NWA A;  3N7C A;  5C5B B;  3FM8 C;  2D11 A;  2L2I A;  4D0N B;  4NY0 A;  2MKR A;  4HAX B;  2YSZ A;  3HQC A;  4DX8 A;  1X86 A;  1Z87 A;  2E2X A;  5DHF B;  4DXA B;  4ZRJ A;  1EVH A;  3DXC A;  1SHC A;  3ULB A;  5HE2 A;  2ZKM X;  3ZDT A;  2DHK A;  1WGQ A;  3GYP A;  2GS0 A;  1XOD A;  1P5T A;  2I5C A;  2DA0 A;  2Y7B A;  5HE1 A;  4HAZ B;  5JP4 A;  1KI1 B;  1MK7 B;  1PLS A;  1BTN A;  2YT2 A;  1OMW A;  3HK0 A;  4HB4 B;  1M7E A;  3A98 B;  1J0W A;  3D8E A;  3PVL A;  3AJ4 A;  2P0F A;  2EC1 A;  4IFS A;  2ELB A;  2Z13 A;  1WJM A;  5C16 A;  1LB1 A;  5I2M A;  4QJ5 B;  4KAX B;  2DKQ A;  1U5D A;  2W2X D;  1FHX A;  1GC7 A;  4H8S A;  4WJ7 A;  5HE0 A;  4F7U P;  4HB0 B;  1W1G A;  1UPR A;  2J0M A;  1ZM0 A;  5D27 A;  1U27 A;  1BTK A;  4PNK A;  3PVW A;  3U8Z A;  4GNK B;  1B55 A;  5DHA B;  1WI1 A;  2P8V A;  4F7G A;  2LG1 A;  5DH9 B;  3QBV B;  2IYB A;  3IVF A;  1P6S A;  2DHJ A;  1TJ6 A;  2GUM A;  2P0H A;  4K81 A;  2Z59 A;  4GN1 A;  2D9V A;  2KIG A;  2KCJ A;  1FAO A;  3NWF A;  1FHO A;  2QKL A;  2COF A;  1U29 A;  4EJN A;  5C79 A;  1J19 A;  3NWD A;  3DXE A;  5I2S A;  1U2B A;  2NBV A;  5M4Y B;  1U5G A;  1MKE A;  4CHM A;  3CIK A;  3ODO A;  2CRF A;  3PEG A;  3LJU X;  1DDV A;  2AEH A;  2LOZ A;  5KQ4 A;  2Y8G A;  1T77 A;  1N3H A;  1ZC3 B;  2EMS A;  3SO6 A;  3PVU A;  4BBK A;  1K5G B;  2DX1 A;  1V5M A;  3FEH A;  2L1C A;  4QJ4 B;  1FB8 A;  1Q67 A;  1V5P A;  4HAT B;  4HB3 B;  2ROV A;  4DX9 0;  2D9W A;  3A58 A;  5J3Q A;  2YS1 A;  3B77 A;  3PG7 A;  2Z0P A;  2R09 A;  2COA A;  2ELA A;  2KGX B;  5JHG A;  2ZPY A;  3ODX A;  4A5K A;  5FI0 A;  3DCX A;  2D10 A;  2LUL A;  1IRS A;  4KHB A;  2VKI A;  1UNQ A;  4NSW A;  3HSA A;  2I1K A;  3TFM A;  1MIZ B;  4KHO A;  3HIE A;  2Z0Q A;  2K00 A;  1M7R A;  2VRW B;  5CLL B;  5JHH A;  4C0A A;  2NMB A;  2Y8F A;  4DBB A;  2K8E A;  2DX5 A;  4HAV B;  2EJ8 A;  1X05 A;  4A6H A;  2LKO A; 
#chains in the Genus database with same CATH homology
 4IOY X;  4Z2N A;  2YRY A;  2DTC A;  1PFJ A;  1QQG A;  2DYN A;  2VSZ A;  2BCJ A;  1AWE A;  5JLJ B;  2DHI A;  1K5D B;  2YS3 A;  1V89 A;  3RCP A;  3SNH A;  1ZSQ A;  2MDX A;  2OTX A;  2MWN B;  5D3W A;  1WJ1 A;  1EAZ A;  2ADZ A;  3VOQ A;  4HHV A;  2V76 A;  1NI2 A;  4MK0 A;  2J0J A;  4GMV A;  2D9X A;  2K2J A;  4XWX A;  1DRO A;  3PZD A;  4F7H A;  2DLW A;  2IFS A;  1GC6 A;  3TW1 A;  1MK9 B;  2EMT A;  1PMS A;  1U5F A;  2UZR A;  1V88 A;  4TYZ A;  2CY5 A;  1U5E A;  2DKP A;  3VIA A;  1EGX A;  4B6H A;  1DBH A;  3KY9 A;  2COC A;  1FGY A;  2H7E A;  2YT1 A;  4A6K A;  1GG3 A;  3MDB C;  3ZVR A;  1V5U A;  2MFQ A;  5J3T A;  3D8F A;  2HE7 A;  3ML4 A;  4PQ0 A;  4HDO A;  3SV1 A;  1Y5O A;  2GJY A;  2P0D A;  4CHJ A;  3P7Z A;  1KZG A;  3AU4 A;  5D3V A;  1RRP B;  4MT7 A;  1MAI A;  5C6R A;  3QIJ A;  1OQN A;  1V61 A;  3NSU A;  3ULC A;  4KHB B;  1LW3 A;  2RNR B;  1UNR A;  3BIN A;  1AQC A;  3A8P A;  1ZVR A;  3KZ1 A;  4GZU A;  1NTY A;  2RGN B;  4HDQ A;  1SGH A;  3TVV A;  5LON B;  3ODW A;  1NU2 A;  3SYX A;  5HE3 A;  3FSS A;  2J0K A;  1FOE A;  5D3X A;  2D9Y A;  3KSY A;  4WVF B;  1UNP A;  3TCA A;  3G9W A;  5DI9 B;  4ZRI A;  3F5R A;  1W1D A;  1BAK A;  2COD A;  5EFX A;  1WVH A;  2N0Y A;  3AU5 A;  3CXB B;  1XKE A;  1MIX A;  3GYO A;  3OAN A;  4YL8 A;  4Z2M B;  1RJ2 A;  2JP2 A;  4TKN A;  2PZ1 A;  1I2H A;  2UZS A;  2YF0 A;  1ZC4 B;  5LOP B;  3PSC A;  3QWM A;  2FJL A;  2GCJ A;  4GMX B;  3P6A A;  3M1I B;  1P3R A;  3D8D A;  3UZT A;  2GCL A;  4HAY B;  5D3Y A;  4HB2 B;  1XX0 A;  4Y94 A;  4MY6 A;  5KCV A;  3T06 A;  2D4Q A;  2M38 A;  2DN6 A;  1X1G A;  5L81 A;  1DDM A;  3WYF B;  1WGU A;  2LYD A;  2D2Q A;  1X11 A;  5C5B A;  2DFK A;  4ZRK A;  2RUK B;  2Z0O A;  2DYQ A;  2Q13 A;  2UVM A;  2K2U A;  2RSG A;  2N23 A;  2W2X C;  1QC6 A;  2XQN M;  1UEF A;  4GPT B;  1KZ7 A;  4IAP A;  4L6E A;  1WG7 A;  2LOX A;  3PP2 A;  2R0D A;  4A6F B;  2OQB A;  3KRX A;  2CY4 A;  4KVG B;  3A8Q A;  1BWN A;  3F0W A;  2CAY A;  1I7A A;  1XR0 B;  3TO1 A;  2YT0 A;  1DDW A;  3KRW A;  2KUP A;  5J3Y A;  2ROZ B;  1W1H A;  3X23 A;  4CYE A;  4YON A;  3BJI A;  1E5W A;  1TXD A;  2W2W A;  2I5F A;  3V5W A;  1X1F A;  2D9Z A;  4K2P A;  2QKM A;  2YVC A;  2YS5 A;  2HTH B;  3U7D A;  2X18 A;  4EKU A;  1MPH A;  5KQ1 A;  1XCG A;  4K2O A;  4HAU B;  1FHW A;  3HW2 B;  1DYN A;  3MPX A;  1TQZ A;  1UPQ A;  2RLO A;  5DIF B;  2AL6 A;  4K17 A;  1OY2 A;  3O96 A;  1ISN A;  5GOW B;  3DXD A;  3SUZ A;  1NTV A;  4A6F A;  4EMO A;  4GXB A;  4HAW B;  2G35 A;  5CLQ B;  2J59 M;  4KHA A;  1XD4 A;  5FI1 A;  1EF1 A;  2RVB B;  1H4R A;  2M14 A;  3WA0 A;  2I1J A;  2NZ8 B;  4WSF A;  1Y19 B;  1FGZ A;  4P7I A;  2H7D A;  1H10 A;  3N7C A;  5C5B B;  3FM8 C;  2D11 A;  2L2I A;  4D0N B;  4NY0 A;  2MKR A;  4HAX B;  2YSZ A;  3HQC A;  4DX8 A;  1X86 A;  1Z87 A;  2E2X A;  5DHF B;  4DXA B;  4ZRJ A;  1EVH A;  3DXC A;  1SHC A;  3ULB A;  5HE2 A;  3ZDT A;  2DHK A;  1WGQ A;  3GYP A;  2GS0 A;  1XOD A;  1P5T A;  2I5C A;  2DA0 A;  2Y7B A;  5HE1 A;  4HAZ B;  5JP4 A;  1KI1 B;  1MK7 B;  1PLS A;  1BTN A;  1OMW A;  3HK0 A;  4HB4 B;  1M7E A;  3A98 B;  1J0W A;  3D8E A;  3PVL A;  3AJ4 A;  2P0F A;  2EC1 A;  4IFS A;  2ELB A;  1WJM A;  5C16 A;  1LB1 A;  4KAX B;  2DKQ A;  1U5D A;  2W2X D;  1FHX A;  1GC7 A;  4H8S A;  4WJ7 A;  5HE0 A;  4F7U P;  4HB0 B;  1W1G A;  1UPR A;  2J0M A;  1ZM0 A;  5D27 A;  1U27 A;  1BTK A;  4PNK A;  3PVW A;  3U8Z A;  1B55 A;  5DHA B;  1WI1 A;  2P8V A;  4F7G A;  2LG1 A;  5DH9 B;  3QBV B;  2IYB A;  3IVF A;  1P6S A;  2DHJ A;  1TJ6 A;  2P0H A;  4K81 A;  4GN1 A;  2D9V A;  2KCJ A;  1FAO A;  1FHO A;  2QKL A;  2COF A;  1U29 A;  4EJN A;  5C79 A;  1J19 A;  3DXE A;  1U2B A;  1U5G A;  1MKE A;  4CHM A;  3CIK A;  3ODO A;  2CRF A;  3PEG A;  3LJU X;  1DDV A;  2AEH A;  2LOZ A;  5KQ4 A;  2Y8G A;  1ZC3 B;  1N3H A;  2EMS A;  3SO6 A;  3PVU A;  4BBK A;  1K5G B;  2DX1 A;  1V5M A;  3FEH A;  2L1C A;  1FB8 A;  1Q67 A;  1V5P A;  4HAT B;  4HB3 B;  2ROV A;  4DX9 0;  2D9W A;  5J3Q A;  2YS1 A;  3PG7 A;  2Z0P A;  2R09 A;  2COA A;  2ELA A;  2KGX B;  5JHG A;  2ZPY A;  3ODX A;  4A5K A;  5FI0 A;  2D10 A;  2LUL A;  1IRS A;  2VKI A;  1UNQ A;  4NSW A;  2I1K A;  3TFM A;  1MIZ B;  4KHO A;  2Z0Q A;  2K00 A;  1M7R A;  2VRW B;  5CLL B;  5JHH A;  4C0A A;  2NMB A;  2Y8F A;  4DBB A;  2DX5 A;  4HAV B;  2EJ8 A;  1X05 A;  4A6H A;  2LKO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...