2LYDA

The solution structure of the dm dcp1 evh1 domain in complex with the xrn1 dbm peptide
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
134
structure length
134
Chain Sequence
GPHMADLMADESITRMNLAAIKKIDPYAKEIVDSSSHVAFYTFNSSQNEWEKTDVEGAFFIYHRNAEPFHSIFINNRLNTTSFVEPITGSLELQSQPPFLLYRNERSRIRGFWFYNSEECDRISGLVNGLLKSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Decapping protein 1
publication title A direct interaction between DCP1 and XRN1 couples mRNA decapping to 5' exonucleolytic degradation.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transcription/protein binding
total genus 23
structure length 134
sequence length 134
ec nomenclature
pdb deposition date 2012-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06058 DCP1 Dcp1-like decapping family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2lydA00
2D9XA 2G35A 3F0WA 1I2HA 3FSSA 4TKNA 2V76A 1QQGA 1EGXA 1GC6A 2P8VA 4D0NB 3D8EA 2D4QA 3QWMA 1BWNA 2I5CA 2ROVA 3AU4A 2D9ZA 4F7HA 4KAXB 3U7DA 5KCVA 1RRPB 4IAPA 1EVHA 1NI2A 2DX1A 1WG7A 4XWXA 4HDOA 4BBKA 2CODA 2Y8GA 2DHJA 2N0YA 1K5DB 1MIXA 3MDBC 2DFKA 2AL6A 5HE0A 2EJ8A 2EMSA 3TVVA 1DDMA 2ELBA 2UVMA 3SUZA 3AJ4A 1Y5OA 5C6RA 2Y8FA 1K5GB 2CY4A 2LOZA 3M1IB 1X1FA 1UNPA 1P3RA 2NMBA 3PVUA 4HB4B 1P5TA 2DKPA 1KZGA 2L1CA 2P0DA 5HE3A 4DX90 2GS0A 1X05A 2MWNB 4KHBB 2Z0OA 2PZ1A 2DA0A 4HAYB 1MK7B 2W2WA 2UZSA 3D8FA 1XCGA 5DH9B 1NTVA 3DXDA 4K2PA 1U5DA 3PZDA 3WA0A 2K2UA 2H7DA 2NZ8B 4CYEA 1ZC4B 2YF0A 1WGQA 2D2QA 5FI1A 3N7CA 2K00A 4MK0A 2JP2A 1WJMA 4HAWB 3KZ1A 2Y7BA 3P6AA 3QIJA 1MKEA 2QKLA 1X11A 2P0HA 4KVGB 4MY6A 3T06A 2ELAA 3V5WA 1V5UA 1W1DA 2CY5A 4A5KA 1V88A 1LB1A 1BTNA 1SGHA 3OANA 2J0MA 2I1KA 2YS1A 1MAIA 4GZUA 1AQCA 4EKUA 4H8SA 3A98B 2I1JA 1WJ1A 2YT0A 3SO6A 2L2IA 4NSWA 3UZTA 2W2XC 3HW2B 3ODWA 3PSCA 2DYQA 3GYPA 1EF1A 4EJNA 3G9WA 4A6KA 1WGUA 1OQNA 1U5EA 1U29A 2IYBA 1Q67A 5KQ1A 2IFSA 2W2XD 1U2BA 4WJ7A 4YONA 1TQZA 1M7EA 2VSZA 2FJLA 3TO1A 4ZRIA 3BJIA 5JLJB 4A6HA 4F7GA 2RSGA 3ODXA 5C79A 2D10A 4TYZA 3AU5A 4KHAA 5C16A 2N23A 2D11A 1Z87A 2J0JA 3PP2A 1MK9B 4WVFB 3TFMA 4HAUB 4HAZB 2AEHA 1E5WA 2R09A 1H10A 1W1GA 1ZSQA 2K2JA 4DX8A 2CAYA 1XKEA 1GG3A 1TXDA 5L81A 1DDWA 1W1HA 2J0KA 3NSUA 1X86A 3PEGA 1MPHA 2RVBB 5D27A 5D3YA 1AWEA 5LONB 4GMVA 5HE1A 1Y19B 2M14A 3ODOA 1EAZA 1BAKA 2RUKB 3PVWA 5J3QA 4DXAB 2R0DA 1KI1B 2XQNM 4IOYX 4B6HA 4P7IA 2M38A 5EFXA 1PMSA 2UZRA 3GYOA 1DROA 2GCJA 1LW3A 2DYNA 3DXCA 2YT1A 4Y94A 5GOWB 2GCLA 2Q13A 2COCA 2D9WA 3FEHA 3SNHA 2QKMA 1XX0A 1I7AA 4ZRKA 3ZVRA 1V89A 2EMTA 5D3VA 1FHXA 4HATB 4CHJA 2KUPA 1ZVRA 5C5BB 2P0FA 5DIFB 3RCPA 3VOQA 2Z0PA 2MDXA 3ZDTA 1B55A 4HDQA 2ZPYA 5LOPB 1KZ7A 2I5FA 4GMXB 1WI1A 5DHAB 5CLQB 2YRYA 2DX5A 3KY9A 3P7ZA 1DYNA 4GN1A 2ADZA 5HE2A 1V5MA 1XD4A 4GPTB 4F7UP 3A8PA 3PG7A 3TW1A 3MPXA 2DTCA 1FB8A 1ZC3B 5JP4A 5D3XA 3DXEA 2CRFA 3CXBB 2DN6A 1PFJA 5DHFB 1FAOA 2RNRB 1PLSA 4K81A 2DKQA 2COFA 3ULBA 1V61A 2D9YA 4K2OA 1OY2A 4A6FB 5C5BA 2LKOA 4KHOA 2DLWA 1OMWA 2YVCA 4YL8A 2OTXA 3WYFB 2VRWB 4Z2MB 1UNRA 4C0AA 2LOXA 5CLLB 4HHVA 4IFSA 3U8ZA 4NY0A 1J0WA 2HE7A 2D9VA 1FGZA 1UEFA 3O96A 3LJUX 1UPRA 3X23A 1ISNA 2OQBA 1NTYA 1XR0B 4PNKA 1IRSA 5JHHA 3ULCA 2H7EA 4K17A 1M7RA 4EMOA 3PVLA 3CIKA 1V5PA 2COAA 1FOEA 1DBHA 2MFQA 1GC7A 1FGYA 1QC6A 1SHCA 1FHWA 4HB3B 3QBVB 3VIAA 2VKIA 4HAVB 1J19A 5J3TA 2LG1A 1FHOA 4A6FA 2DHKA 2X18A 1UPQA 3BINA 2YSZA 1MIZB 4HAXB 3HK0A 2KGXB 2HTHB 3D8DA 4GXBA 3SYXA 1DDVA 2RLOA 1U27A 5J3YA 3KSYA 2J59M 5D3WA 3HQCA 5JHGA 2YS5A 2RGNB 4ZRJA 5FI0A 4L6EA 1BTKA 1X1GA 3KRXA 3A8QA 1H4RA 4DBBA 5DI9B 3KRWA 1U5FA 2MKRA 1U5GA 2Z0QA 3TCAA 2LULA 2ROZB 1P6SA 4HB0B 3IVFA 4Z2NA 1NU2A 2LYDA 1N3HA 2BCJA 3SV1A 2GJYA 4MT7A 4PQ0A 4HB2B 4CHMA 1XODA 1TJ6A 2E2XA 3F5RA 4WSFA 2KCJA 3ML4A 1RJ2A 3FM8C 2YS3A 2EC1A 5KQ4A 1ZM0A 2DHIA 1UNQA 1WVHA
chains in the Genus database with same CATH superfamily
2D9XA 2G35A 3F0WA 1I2HA 4OT1A 2KIGA 3FSSA 4TKNA 2V76A 1QQGA 1EGXA 1GC6A 2P8VA 4D0NB 3D8EA 4L1RA 2K8EA 2D4QA 3QWMA 1BWNA 2I5CA 2ROVA 3AU4A 2D9ZA 4F7HA 4KAXB 3U7DA 5KCVA 1RRPB 4IAPA 1EVHA 1NI2A 3U12A 2DX1A 1WG7A 4XWXA 4HDOA 4BBKA 2CODA 2Y8GA 2DHJA 2N0YA 1K5DB 1MIXA 3MDBC 4HSIA 2DFKA 2KUQA 2AL6A 5HE0A 3FVCA 2EJ8A 2EMSA 3OHMB 3TVVA 1DDMA 2ELBA 2UVMA 3SUZA 3AJ4A 1Y5OA 5C6RA 2YT2A 2Y8FA 1K5GB 2CY4A 2LOZA 3M1IB 1X1FA 1UNPA 1P3RA 2NMBA 3PVUA 4HB4B 1P5TA 2DKPA 1ZYIA 1KZGA 4QJ5B 2L1CA 2P0DA 3DCXA 5HE3A 4DX90 2GS0A 1X05A 2MWNB 4KHBB 2Z0OA 2PZ1A 2DA0A 4HAYB 1MK7B 2W2WA 2UZSA 3D8FA 1T77A 1XCGA 5DH9B 1NTVA 2GUMA 3DXDA 4K2PA 1U5DA 3NWDA 3PZDA 3WA0A 2K2UA 2H7DA 2NZ8B 4CYEA 1ZC4B 2YF0A 1WGQA 2K49A 2D2QA 5FI1A 3N7CA 2K00A 4MK0A 2JP2A 1WJMA 4HAWB 3KZ1A 2Y7BA 3P6AA 3QIJA 1MKEA 2QKLA 1X11A 2P0HA 4KVGB 4MY6A 3T06A 2ELAA 3V5WA 1V5UA 1W1DA 2CY5A 4A5KA 1V88A 1LB1A 1BTNA 1SGHA 3OANA 2J0MA 2I1KA 2YS1A 1MAIA 2FJUB 4GZUA 1AQCA 4EKUA 4H8SA 3A98B 2I1JA 1WJ1A 2YT0A 3SO6A 2L2IA 4NSWA 3UZTA 2W2XC 3HW2B 3ODWA 3PSCA 2DYQA 3GYPA 1EF1A 4EJNA 3G9WA 4A6KA 1WGUA 1OQNA 3A58A 1U5EA 1U29A 2IYBA 3B77A 2Z13A 1Q67A 5KQ1A 2IFSA 2W2XD 1U2BA 2NBVA 4WJ7A 4YONA 1TQZA 1M7EA 2Z59A 2VSZA 2FJLA 3TO1A 4ZRIA 3BJIA 5I2SA 5JLJB 4A6HA 4F7GA 2RSGA 3ODXA 5C79A 2D10A 4TYZA 3AU5A 4KHAA 5C16A 2N23A 2D11A 5LG4B 1Z87A 2J0JA 2RRFA 3PP2A 4QJ4B 1MK9B 4WVFB 3TFMA 4HAUB 4HAZB 2AEHA 1E5WA 2R09A 1H10A 1W1GA 1ZSQA 2K2JA 4DX8A 2CAYA 4QXAB 1XKEA 1GG3A 4CSQA 1TXDA 5L81A 1DDWA 1W1HA 2J0KA 3NSUA 1X86A 3PEGA 1MPHA 2RVBB 5D27A 5D3YA 1AWEA 2KIEA 5LONB 2KR0A 4GMVA 5HE1A 1Y19B 2M14A 5M4YB 3ODOA 4DIXA 1EAZA 1BAKA 2RUKB 3PVWA 5J3QA 4DXAB 2R0DA 1KI1B 2XQNM 4IOYX 4B6HA 4P7IA 2M38A 5EFXA 1PMSA 2UZRA 3GYOA 1DROA 2Z14A 2GCJA 1LW3A 2DYNA 5IRSA 3DXCA 2YT1A 4Y94A 5GOWB 4D6WA 2GCLA 2Q13A 2COCA 2D9WA 3FEHA 3SNHA 2QKMA 1XX0A 1I7AA 4ZRKA 3ZVRA 1V89A 2EMTA 5D3VA 1FHXA 4HATB 4CHJA 2KUPA 1ZVRA 3HSAA 5C5BB 2P0FA 5DIFB 3RCPA 3VOQA 2Z0PA 2MDXA 3ZDTA 1B55A 4HDQA 2ZPYA 5LOPB 1KZ7A 2I5FA 4GMXB 1WI1A 5DHAB 5CLQB 2YRYA 2DX5A 3KY9A 3P7ZA 1DYNA 4GN1A 2ADZA 5HE2A 1V5MA 1XD4A 4GPTB 4F7UP 3A8PA 3PG7A 1MI1A 3TW1A 3MPXA 2DTCA 1FB8A 1ZC3B 2R2YA 5JP4A 5D3XA 3DXEA 2CRFA 3CXBB 4OSNA 2DN6A 1PFJA 5DHFB 1FAOA 2RNRB 1PLSA 4K81A 2DKQA 2COFA 3ULBA 1V61A 2D9YA 4K2OA 1OY2A 4A6FB 5C5BA 4GOUA 2LKOA 4KHOA 2DLWA 1OMWA 2YVCA 4YL8A 2OTXA 3WYFB 2VRWB 4Z2MB 1UNRA 4C0AA 2LOXA 5CLLB 4HHVA 4IFSA 3U8ZA 4NY0A 1J0WA 2HE7A 2D9VA 1FGZA 1UEFA 3O96A 3LJUX 1UPRA 3X23A 1ISNA 2OQBA 1NTYA 1XR0B 4PNKA 1IRSA 5JHHA 3ULCA 2H7EA 4K17A 1M7RA 4EMOA 3PVLA 3CIKA 1V5PA 2COAA 1FOEA 1DBHA 2MFQA 1GC7A 1FGYA 1QC6A 5I2MA 1SHCA 1FHWA 4HB3B 3QBVB 3VIAA 2VKIA 4HAVB 1J19A 5J3TA 2LG1A 2Z4DA 1FHOA 4A6FA 2DHKA 2X18A 1UPQA 3BINA 2YSZA 1MIZB 4HAXB 3HK0A 2KGXB 2HTHB 3D8DA 4GXBA 3SYXA 1DDVA 2RLOA 3NWFA 1U27A 5J3YA 3KSYA 3NW8A 2J59M 5D3WA 3HQCA 5JHGA 2YS5A 2RGNB 4ZRJA 5FI0A 4L6EA 1BTKA 1X1GA 3KRXA 3A8QA 1H4RA 4DBBA 5DI9B 3KRWA 1U5FA 3HIEA 2MKRA 1U5GA 4GNKB 2Z0QA 4QJ3B 3TCAA 2LULA 2ROZB 1P6SA 4HB0B 3IVFA 4Z2NA 1NU2A 2ZKMX 2LYDA 3NWAA 1N3HA 2BCJA 3SV1A 2GJYA 4MT7A 4PQ0A 4HB2B 4CHMA 1XODA 1TJ6A 2E2XA 3F5RA 4WSFA 2KCJA 3ML4A 1RJ2A 4KHBA 3FM8C 2YS3A 2EC1A 5KQ4A 1ZM0A 2DHIA 1UNQA 1WVHA
chains in the Genus database with same CATH topology
2D9XA 2G35A 3F0WA 1I2HA 3FSSA 4TKNA 2V76A 1QQGA 1EGXA 1GC6A 2P8VA 4D0NB 3D8EA 2D4QA 3QWMA 1BWNA 2I5CA 2ROVA 3AU4A 2D9ZA 4F7HA 4KAXB 3U7DA 5KCVA 1RRPB 4IAPA 1EVHA 1NI2A 2DX1A 1WG7A 4XWXA 4HDOA 4BBKA 2CODA 2Y8GA 2DHJA 2N0YA 1K5DB 1MIXA 3MDBC 2DFKA 2AL6A 5HE0A 2EJ8A 2EMSA 3TVVA 1DDMA 2ELBA 2UVMA 3SUZA 3AJ4A 1Y5OA 5C6RA 2Y8FA 1K5GB 2CY4A 2LOZA 3M1IB 1X1FA 1UNPA 1P3RA 2NMBA 3PVUA 4HB4B 1P5TA 2DKPA 1KZGA 2L1CA 2P0DA 5HE3A 4DX90 2GS0A 1X05A 2MWNB 4KHBB 2Z0OA 2PZ1A 2DA0A 4HAYB 1MK7B 2W2WA 2UZSA 3D8FA 1XCGA 5DH9B 1NTVA 3DXDA 4K2PA 1U5DA 3PZDA 3WA0A 2K2UA 2H7DA 2NZ8B 4CYEA 1ZC4B 2YF0A 1WGQA 2D2QA 5FI1A 3N7CA 2K00A 4MK0A 2JP2A 1WJMA 4HAWB 3KZ1A 2Y7BA 3P6AA 3QIJA 1MKEA 2QKLA 1X11A 2P0HA 4KVGB 4MY6A 3T06A 2ELAA 3V5WA 1V5UA 1W1DA 2CY5A 4A5KA 1V88A 1LB1A 1BTNA 1SGHA 3OANA 2J0MA 2I1KA 2YS1A 1MAIA 4GZUA 1AQCA 4EKUA 4H8SA 3A98B 2I1JA 1WJ1A 2YT0A 3SO6A 2L2IA 4NSWA 3UZTA 2W2XC 3HW2B 3ODWA 3PSCA 2DYQA 3GYPA 1EF1A 4EJNA 3G9WA 4A6KA 1WGUA 1OQNA 1U5EA 1U29A 2IYBA 1Q67A 5KQ1A 2IFSA 2W2XD 1U2BA 4WJ7A 4YONA 1TQZA 1M7EA 2VSZA 2FJLA 3TO1A 4ZRIA 3BJIA 5JLJB 4A6HA 4F7GA 2RSGA 3ODXA 5C79A 2D10A 4TYZA 3AU5A 4KHAA 5C16A 2N23A 2D11A 1Z87A 2J0JA 3PP2A 1MK9B 4WVFB 3TFMA 4HAUB 4HAZB 2AEHA 1E5WA 2R09A 1H10A 1W1GA 1ZSQA 2K2JA 4DX8A 2CAYA 1XKEA 1GG3A 1TXDA 5L81A 1DDWA 1W1HA 2J0KA 3NSUA 1X86A 3PEGA 1MPHA 2RVBB 5D27A 5D3YA 1AWEA 5LONB 4GMVA 5HE1A 1Y19B 2M14A 3ODOA 1EAZA 1BAKA 2RUKB 3PVWA 5J3QA 4DXAB 2R0DA 1KI1B 2XQNM 4IOYX 4B6HA 4P7IA 2M38A 5EFXA 1PMSA 2UZRA 3GYOA 1DROA 2GCJA 1LW3A 2DYNA 3DXCA 2YT1A 4Y94A 5GOWB 2GCLA 2Q13A 2COCA 2D9WA 3FEHA 3SNHA 2QKMA 1XX0A 1I7AA 4ZRKA 3ZVRA 1V89A 2EMTA 5D3VA 1FHXA 4HATB 4CHJA 2KUPA 1ZVRA 5C5BB 2P0FA 5DIFB 3RCPA 3VOQA 2Z0PA 2MDXA 3ZDTA 1B55A 4HDQA 2ZPYA 5LOPB 1KZ7A 2I5FA 4GMXB 1WI1A 5DHAB 5CLQB 2YRYA 2DX5A 3KY9A 3P7ZA 1DYNA 4GN1A 2ADZA 5HE2A 1V5MA 1XD4A 4GPTB 4F7UP 3A8PA 3PG7A 3TW1A 3MPXA 2DTCA 1FB8A 1ZC3B 5JP4A 5D3XA 3DXEA 2CRFA 3CXBB 2DN6A 1PFJA 5DHFB 1FAOA 2RNRB 1PLSA 4K81A 2DKQA 2COFA 3ULBA 1V61A 2D9YA 4K2OA 1OY2A 4A6FB 5C5BA 2LKOA 4KHOA 2DLWA 1OMWA 2YVCA 4YL8A 2OTXA 3WYFB 2VRWB 4Z2MB 1UNRA 4C0AA 2LOXA 5CLLB 4HHVA 4IFSA 3U8ZA 4NY0A 1J0WA 2HE7A 2D9VA 1FGZA 1UEFA 3O96A 3LJUX 1UPRA 3X23A 1ISNA 2OQBA 1NTYA 1XR0B 4PNKA 1IRSA 5JHHA 3ULCA 2H7EA 4K17A 1M7RA 4EMOA 3PVLA 3CIKA 1V5PA 2COAA 1FOEA 1DBHA 2MFQA 1GC7A 1FGYA 1QC6A 1SHCA 1FHWA 4HB3B 3QBVB 3VIAA 2VKIA 4HAVB 1J19A 5J3TA 2LG1A 1FHOA 4A6FA 2DHKA 2X18A 1UPQA 3BINA 2YSZA 1MIZB 4HAXB 3HK0A 2KGXB 2HTHB 3D8DA 4GXBA 3SYXA 1DDVA 2RLOA 1U27A 5J3YA 3KSYA 2J59M 5D3WA 3HQCA 5JHGA 2YS5A 2RGNB 4ZRJA 5FI0A 4L6EA 1BTKA 1X1GA 3KRXA 3A8QA 1H4RA 4DBBA 5DI9B 3KRWA 1U5FA 2MKRA 1U5GA 2Z0QA 3TCAA 2LULA 2ROZB 1P6SA 4HB0B 3IVFA 4Z2NA 1NU2A 2LYDA 1N3HA 2BCJA 3SV1A 2GJYA 4MT7A 4PQ0A 4HB2B 4CHMA 1XODA 1TJ6A 2E2XA 3F5RA 4WSFA 2KCJA 3ML4A 1RJ2A 3FM8C 2YS3A 2EC1A 5KQ4A 1ZM0A 2DHIA 1UNQA 1WVHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D9X A;  2G35 A;  3F0W A;  1I2H A;  3FSS A;  4TKN A;  2V76 A;  1QQG A;  1EGX A;  1GC6 A;  2P8V A;  4D0N B;  3D8E A;  2D4Q A;  3QWM A;  1BWN A;  2I5C A;  2ROV A;  3AU4 A;  2D9Z A;  4F7H A;  4KAX B;  3U7D A;  5KCV A;  1RRP B;  4IAP A;  1EVH A;  1NI2 A;  2DX1 A;  1WG7 A;  4XWX A;  4HDO A;  4BBK A;  2COD A;  2Y8G A;  2DHJ A;  2N0Y A;  1K5D B;  1MIX A;  3MDB C;  2DFK A;  2AL6 A;  5HE0 A;  2EJ8 A;  2EMS A;  3TVV A;  1DDM A;  2ELB A;  2UVM A;  3SUZ A;  3AJ4 A;  1Y5O A;  5C6R A;  2Y8F A;  1K5G B;  2CY4 A;  2LOZ A;  3M1I B;  1X1F A;  1UNP A;  1P3R A;  2NMB A;  3PVU A;  4HB4 B;  1P5T A;  2DKP A;  1KZG A;  2L1C A;  2P0D A;  5HE3 A;  4DX9 0;  2GS0 A;  1X05 A;  2MWN B;  4KHB B;  2Z0O A;  2PZ1 A;  2DA0 A;  4HAY B;  1MK7 B;  2W2W A;  2UZS A;  3D8F A;  1XCG A;  5DH9 B;  1NTV A;  3DXD A;  4K2P A;  1U5D A;  3PZD A;  3WA0 A;  2K2U A;  2H7D A;  2NZ8 B;  4CYE A;  1ZC4 B;  2YF0 A;  1WGQ A;  2D2Q A;  5FI1 A;  3N7C A;  2K00 A;  4MK0 A;  2JP2 A;  1WJM A;  4HAW B;  3KZ1 A;  2Y7B A;  3P6A A;  3QIJ A;  1MKE A;  2QKL A;  1X11 A;  2P0H A;  4KVG B;  4MY6 A;  3T06 A;  2ELA A;  3V5W A;  1V5U A;  1W1D A;  2CY5 A;  4A5K A;  1V88 A;  1LB1 A;  1BTN A;  1SGH A;  3OAN A;  2J0M A;  2I1K A;  2YS1 A;  1MAI A;  4GZU A;  1AQC A;  4EKU A;  4H8S A;  3A98 B;  2I1J A;  1WJ1 A;  2YT0 A;  3SO6 A;  2L2I A;  4NSW A;  3UZT A;  2W2X C;  3HW2 B;  3ODW A;  3PSC A;  2DYQ A;  3GYP A;  1EF1 A;  4EJN A;  3G9W A;  4A6K A;  1WGU A;  1OQN A;  1U5E A;  1U29 A;  2IYB A;  1Q67 A;  5KQ1 A;  2IFS A;  2W2X D;  1U2B A;  4WJ7 A;  4YON A;  1TQZ A;  1M7E A;  2VSZ A;  2FJL A;  3TO1 A;  4ZRI A;  3BJI A;  5JLJ B;  4A6H A;  4F7G A;  2RSG A;  3ODX A;  5C79 A;  2D10 A;  4TYZ A;  3AU5 A;  4KHA A;  5C16 A;  2N23 A;  2D11 A;  1Z87 A;  2J0J A;  3PP2 A;  1MK9 B;  4WVF B;  3TFM A;  4HAU B;  4HAZ B;  2AEH A;  1E5W A;  2R09 A;  1H10 A;  1W1G A;  1ZSQ A;  2K2J A;  4DX8 A;  2CAY A;  1XKE A;  1GG3 A;  1TXD A;  5L81 A;  1DDW A;  1W1H A;  2J0K A;  3NSU A;  1X86 A;  3PEG A;  1MPH A;  2RVB B;  5D27 A;  5D3Y A;  1AWE A;  5LON B;  4GMV A;  5HE1 A;  1Y19 B;  2M14 A;  3ODO A;  1EAZ A;  1BAK A;  2RUK B;  3PVW A;  5J3Q A;  4DXA B;  2R0D A;  1KI1 B;  2XQN M;  4IOY X;  4B6H A;  4P7I A;  2M38 A;  5EFX A;  1PMS A;  2UZR A;  3GYO A;  1DRO A;  2GCJ A;  1LW3 A;  2DYN A;  3DXC A;  2YT1 A;  4Y94 A;  5GOW B;  2GCL A;  2Q13 A;  2COC A;  2D9W A;  3FEH A;  3SNH A;  2QKM A;  1XX0 A;  1I7A A;  4ZRK A;  3ZVR A;  1V89 A;  2EMT A;  5D3V A;  1FHX A;  4HAT B;  4CHJ A;  2KUP A;  1ZVR A;  5C5B B;  2P0F A;  5DIF B;  3RCP A;  3VOQ A;  2Z0P A;  2MDX A;  3ZDT A;  1B55 A;  4HDQ A;  2ZPY A;  5LOP B;  1KZ7 A;  2I5F A;  4GMX B;  1WI1 A;  5DHA B;  5CLQ B;  2YRY A;  2DX5 A;  3KY9 A;  3P7Z A;  1DYN A;  4GN1 A;  2ADZ A;  5HE2 A;  1V5M A;  1XD4 A;  4GPT B;  4F7U P;  3A8P A;  3PG7 A;  3TW1 A;  3MPX A;  2DTC A;  1FB8 A;  1ZC3 B;  5JP4 A;  5D3X A;  3DXE A;  2CRF A;  3CXB B;  2DN6 A;  1PFJ A;  5DHF B;  1FAO A;  2RNR B;  1PLS A;  4K81 A;  2DKQ A;  2COF A;  3ULB A;  1V61 A;  2D9Y A;  4K2O A;  1OY2 A;  4A6F B;  5C5B A;  2LKO A;  4KHO A;  2DLW A;  1OMW A;  2YVC A;  4YL8 A;  2OTX A;  3WYF B;  2VRW B;  4Z2M B;  1UNR A;  4C0A A;  2LOX A;  5CLL B;  4HHV A;  4IFS A;  3U8Z A;  4NY0 A;  1J0W A;  2HE7 A;  2D9V A;  1FGZ A;  1UEF A;  3O96 A;  3LJU X;  1UPR A;  3X23 A;  1ISN A;  2OQB A;  1NTY A;  1XR0 B;  4PNK A;  1IRS A;  5JHH A;  3ULC A;  2H7E A;  4K17 A;  1M7R A;  4EMO A;  3PVL A;  3CIK A;  1V5P A;  2COA A;  1FOE A;  1DBH A;  2MFQ A;  1GC7 A;  1FGY A;  1QC6 A;  1SHC A;  1FHW A;  4HB3 B;  3QBV B;  3VIA A;  2VKI A;  4HAV B;  1J19 A;  5J3T A;  2LG1 A;  1FHO A;  4A6F A;  2DHK A;  2X18 A;  1UPQ A;  3BIN A;  2YSZ A;  1MIZ B;  4HAX B;  3HK0 A;  2KGX B;  2HTH B;  3D8D A;  4GXB A;  3SYX A;  1DDV A;  2RLO A;  1U27 A;  5J3Y A;  3KSY A;  2J59 M;  5D3W A;  3HQC A;  5JHG A;  2YS5 A;  2RGN B;  4ZRJ A;  5FI0 A;  4L6E A;  1BTK A;  1X1G A;  3KRX A;  3A8Q A;  1H4R A;  4DBB A;  5DI9 B;  3KRW A;  1U5F A;  2MKR A;  1U5G A;  2Z0Q A;  3TCA A;  2LUL A;  2ROZ B;  1P6S A;  4HB0 B;  3IVF A;  4Z2N A;  1NU2 A;  2LYD A;  1N3H A;  2BCJ A;  3SV1 A;  2GJY A;  4MT7 A;  4PQ0 A;  4HB2 B;  4CHM A;  1XOD A;  1TJ6 A;  2E2X A;  3F5R A;  4WSF A;  2KCJ A;  3ML4 A;  1RJ2 A;  3FM8 C;  2YS3 A;  2EC1 A;  5KQ4 A;  1ZM0 A;  2DHI A;  1UNQ A;  1WVH A; 
#chains in the Genus database with same CATH topology
 2D9X A;  2G35 A;  3F0W A;  1I2H A;  4OT1 A;  2KIG A;  3FSS A;  4TKN A;  2V76 A;  1QQG A;  1EGX A;  1GC6 A;  2P8V A;  4D0N B;  3D8E A;  4L1R A;  2K8E A;  2D4Q A;  3QWM A;  1BWN A;  2I5C A;  2ROV A;  3AU4 A;  2D9Z A;  4F7H A;  4KAX B;  3U7D A;  5KCV A;  1RRP B;  4IAP A;  1EVH A;  1NI2 A;  3U12 A;  2DX1 A;  1WG7 A;  4XWX A;  4HDO A;  4BBK A;  2COD A;  2Y8G A;  2DHJ A;  2N0Y A;  1K5D B;  1MIX A;  3MDB C;  4HSI A;  2DFK A;  2KUQ A;  2AL6 A;  5HE0 A;  3FVC A;  2EJ8 A;  2EMS A;  3OHM B;  3TVV A;  1DDM A;  2ELB A;  2UVM A;  3SUZ A;  3AJ4 A;  1Y5O A;  5C6R A;  2YT2 A;  2Y8F A;  1K5G B;  2CY4 A;  2LOZ A;  3M1I B;  1X1F A;  1UNP A;  1P3R A;  2NMB A;  3PVU A;  4HB4 B;  1P5T A;  2DKP A;  1ZYI A;  1KZG A;  4QJ5 B;  2L1C A;  2P0D A;  3DCX A;  5HE3 A;  4DX9 0;  2GS0 A;  1X05 A;  2MWN B;  4KHB B;  2Z0O A;  2PZ1 A;  2DA0 A;  4HAY B;  1MK7 B;  2W2W A;  2UZS A;  3D8F A;  1T77 A;  1XCG A;  5DH9 B;  1NTV A;  2GUM A;  3DXD A;  4K2P A;  1U5D A;  3NWD A;  3PZD A;  3WA0 A;  2K2U A;  2H7D A;  2NZ8 B;  4CYE A;  1ZC4 B;  2YF0 A;  1WGQ A;  2K49 A;  2D2Q A;  5FI1 A;  3N7C A;  2K00 A;  4MK0 A;  2JP2 A;  1WJM A;  4HAW B;  3KZ1 A;  2Y7B A;  3P6A A;  3QIJ A;  1MKE A;  2QKL A;  1X11 A;  2P0H A;  4KVG B;  4MY6 A;  3T06 A;  2ELA A;  3V5W A;  1V5U A;  1W1D A;  2CY5 A;  4A5K A;  1V88 A;  1LB1 A;  1BTN A;  1SGH A;  3OAN A;  2J0M A;  2I1K A;  2YS1 A;  1MAI A;  2FJU B;  4GZU A;  1AQC A;  4EKU A;  4H8S A;  3A98 B;  2I1J A;  1WJ1 A;  2YT0 A;  3SO6 A;  2L2I A;  4NSW A;  3UZT A;  2W2X C;  3HW2 B;  3ODW A;  3PSC A;  2DYQ A;  3GYP A;  1EF1 A;  4EJN A;  3G9W A;  4A6K A;  1WGU A;  1OQN A;  3A58 A;  1U5E A;  1U29 A;  2IYB A;  3B77 A;  2Z13 A;  1Q67 A;  5KQ1 A;  2IFS A;  2W2X D;  1U2B A;  2NBV A;  4WJ7 A;  4YON A;  1TQZ A;  1M7E A;  2Z59 A;  2VSZ A;  2FJL A;  3TO1 A;  4ZRI A;  3BJI A;  5I2S A;  5JLJ B;  4A6H A;  4F7G A;  2RSG A;  3ODX A;  5C79 A;  2D10 A;  4TYZ A;  3AU5 A;  4KHA A;  5C16 A;  2N23 A;  2D11 A;  5LG4 B;  1Z87 A;  2J0J A;  2RRF A;  3PP2 A;  4QJ4 B;  1MK9 B;  4WVF B;  3TFM A;  4HAU B;  4HAZ B;  2AEH A;  1E5W A;  2R09 A;  1H10 A;  1W1G A;  1ZSQ A;  2K2J A;  4DX8 A;  2CAY A;  4QXA B;  1XKE A;  1GG3 A;  4CSQ A;  1TXD A;  5L81 A;  1DDW A;  1W1H A;  2J0K A;  3NSU A;  1X86 A;  3PEG A;  1MPH A;  2RVB B;  5D27 A;  5D3Y A;  1AWE A;  2KIE A;  5LON B;  2KR0 A;  4GMV A;  5HE1 A;  1Y19 B;  2M14 A;  5M4Y B;  3ODO A;  4DIX A;  1EAZ A;  1BAK A;  2RUK B;  3PVW A;  5J3Q A;  4DXA B;  2R0D A;  1KI1 B;  2XQN M;  4IOY X;  4B6H A;  4P7I A;  2M38 A;  5EFX A;  1PMS A;  2UZR A;  3GYO A;  1DRO A;  2Z14 A;  2GCJ A;  1LW3 A;  2DYN A;  5IRS A;  3DXC A;  2YT1 A;  4Y94 A;  5GOW B;  4D6W A;  2GCL A;  2Q13 A;  2COC A;  2D9W A;  3FEH A;  3SNH A;  2QKM A;  1XX0 A;  1I7A A;  4ZRK A;  3ZVR A;  1V89 A;  2EMT A;  5D3V A;  1FHX A;  4HAT B;  4CHJ A;  2KUP A;  1ZVR A;  3HSA A;  5C5B B;  2P0F A;  5DIF B;  3RCP A;  3VOQ A;  2Z0P A;  2MDX A;  3ZDT A;  1B55 A;  4HDQ A;  2ZPY A;  5LOP B;  1KZ7 A;  2I5F A;  4GMX B;  1WI1 A;  5DHA B;  5CLQ B;  2YRY A;  2DX5 A;  3KY9 A;  3P7Z A;  1DYN A;  4GN1 A;  2ADZ A;  5HE2 A;  1V5M A;  1XD4 A;  4GPT B;  4F7U P;  3A8P A;  3PG7 A;  1MI1 A;  3TW1 A;  3MPX A;  2DTC A;  1FB8 A;  1ZC3 B;  2R2Y A;  5JP4 A;  5D3X A;  3DXE A;  2CRF A;  3CXB B;  4OSN A;  2DN6 A;  1PFJ A;  5DHF B;  1FAO A;  2RNR B;  1PLS A;  4K81 A;  2DKQ A;  2COF A;  3ULB A;  1V61 A;  2D9Y A;  4K2O A;  1OY2 A;  4A6F B;  5C5B A;  4GOU A;  2LKO A;  4KHO A;  2DLW A;  1OMW A;  2YVC A;  4YL8 A;  2OTX A;  3WYF B;  2VRW B;  4Z2M B;  1UNR A;  4C0A A;  2LOX A;  5CLL B;  4HHV A;  4IFS A;  3U8Z A;  4NY0 A;  1J0W A;  2HE7 A;  2D9V A;  1FGZ A;  1UEF A;  3O96 A;  3LJU X;  1UPR A;  3X23 A;  1ISN A;  2OQB A;  1NTY A;  1XR0 B;  4PNK A;  1IRS A;  5JHH A;  3ULC A;  2H7E A;  4K17 A;  1M7R A;  4EMO A;  3PVL A;  3CIK A;  1V5P A;  2COA A;  1FOE A;  1DBH A;  2MFQ A;  1GC7 A;  1FGY A;  1QC6 A;  5I2M A;  1SHC A;  1FHW A;  4HB3 B;  3QBV B;  3VIA A;  2VKI A;  4HAV B;  1J19 A;  5J3T A;  2LG1 A;  2Z4D A;  1FHO A;  4A6F A;  2DHK A;  2X18 A;  1UPQ A;  3BIN A;  2YSZ A;  1MIZ B;  4HAX B;  3HK0 A;  2KGX B;  2HTH B;  3D8D A;  4GXB A;  3SYX A;  1DDV A;  2RLO A;  3NWF A;  1U27 A;  5J3Y A;  3KSY A;  3NW8 A;  2J59 M;  5D3W A;  3HQC A;  5JHG A;  2YS5 A;  2RGN B;  4ZRJ A;  5FI0 A;  4L6E A;  1BTK A;  1X1G A;  3KRX A;  3A8Q A;  1H4R A;  4DBB A;  5DI9 B;  3KRW A;  1U5F A;  3HIE A;  2MKR A;  1U5G A;  4GNK B;  2Z0Q A;  4QJ3 B;  3TCA A;  2LUL A;  2ROZ B;  1P6S A;  4HB0 B;  3IVF A;  4Z2N A;  1NU2 A;  2ZKM X;  2LYD A;  3NWA A;  1N3H A;  2BCJ A;  3SV1 A;  2GJY A;  4MT7 A;  4PQ0 A;  4HB2 B;  4CHM A;  1XOD A;  1TJ6 A;  2E2X A;  3F5R A;  4WSF A;  2KCJ A;  3ML4 A;  1RJ2 A;  4KHB A;  3FM8 C;  2YS3 A;  2EC1 A;  5KQ4 A;  1ZM0 A;  2DHI A;  1UNQ A;  1WVH A; 
#chains in the Genus database with same CATH homology
 2D9X A;  2G35 A;  3F0W A;  1I2H A;  3FSS A;  4TKN A;  2V76 A;  1QQG A;  1EGX A;  1GC6 A;  2P8V A;  4D0N B;  3D8E A;  2D4Q A;  3QWM A;  1BWN A;  2I5C A;  2ROV A;  3AU4 A;  2D9Z A;  4F7H A;  4KAX B;  3U7D A;  5KCV A;  1RRP B;  4IAP A;  1EVH A;  1NI2 A;  2DX1 A;  1WG7 A;  4XWX A;  4HDO A;  4BBK A;  2COD A;  2Y8G A;  2DHJ A;  2N0Y A;  1K5D B;  1MIX A;  3MDB C;  2DFK A;  2AL6 A;  5HE0 A;  2EJ8 A;  2EMS A;  3TVV A;  1DDM A;  2ELB A;  2UVM A;  3SUZ A;  3AJ4 A;  1Y5O A;  5C6R A;  2Y8F A;  1K5G B;  2CY4 A;  2LOZ A;  3M1I B;  1X1F A;  1UNP A;  1P3R A;  2NMB A;  3PVU A;  4HB4 B;  1P5T A;  2DKP A;  1KZG A;  2L1C A;  2P0D A;  5HE3 A;  4DX9 0;  2GS0 A;  1X05 A;  2MWN B;  4KHB B;  2Z0O A;  2PZ1 A;  2DA0 A;  4HAY B;  1MK7 B;  2W2W A;  2UZS A;  3D8F A;  1XCG A;  5DH9 B;  1NTV A;  3DXD A;  4K2P A;  1U5D A;  3PZD A;  3WA0 A;  2K2U A;  2H7D A;  2NZ8 B;  4CYE A;  1ZC4 B;  2YF0 A;  1WGQ A;  2D2Q A;  5FI1 A;  3N7C A;  2K00 A;  4MK0 A;  2JP2 A;  1WJM A;  4HAW B;  3KZ1 A;  2Y7B A;  3P6A A;  3QIJ A;  1MKE A;  2QKL A;  1X11 A;  2P0H A;  4KVG B;  4MY6 A;  3T06 A;  2ELA A;  3V5W A;  1V5U A;  1W1D A;  2CY5 A;  4A5K A;  1V88 A;  1LB1 A;  1BTN A;  1SGH A;  3OAN A;  2J0M A;  2I1K A;  2YS1 A;  1MAI A;  4GZU A;  1AQC A;  4EKU A;  4H8S A;  3A98 B;  2I1J A;  1WJ1 A;  2YT0 A;  3SO6 A;  2L2I A;  4NSW A;  3UZT A;  2W2X C;  3HW2 B;  3ODW A;  3PSC A;  2DYQ A;  3GYP A;  1EF1 A;  4EJN A;  3G9W A;  4A6K A;  1WGU A;  1OQN A;  1U5E A;  1U29 A;  2IYB A;  1Q67 A;  5KQ1 A;  2IFS A;  2W2X D;  1U2B A;  4WJ7 A;  4YON A;  1TQZ A;  1M7E A;  2VSZ A;  2FJL A;  3TO1 A;  4ZRI A;  3BJI A;  5JLJ B;  4A6H A;  4F7G A;  2RSG A;  3ODX A;  5C79 A;  2D10 A;  4TYZ A;  3AU5 A;  4KHA A;  5C16 A;  2N23 A;  2D11 A;  1Z87 A;  2J0J A;  3PP2 A;  1MK9 B;  4WVF B;  3TFM A;  4HAU B;  4HAZ B;  2AEH A;  1E5W A;  2R09 A;  1H10 A;  1W1G A;  1ZSQ A;  2K2J A;  4DX8 A;  2CAY A;  1XKE A;  1GG3 A;  1TXD A;  5L81 A;  1DDW A;  1W1H A;  2J0K A;  3NSU A;  1X86 A;  3PEG A;  1MPH A;  2RVB B;  5D27 A;  5D3Y A;  1AWE A;  5LON B;  4GMV A;  5HE1 A;  1Y19 B;  2M14 A;  3ODO A;  1EAZ A;  1BAK A;  2RUK B;  3PVW A;  5J3Q A;  4DXA B;  2R0D A;  1KI1 B;  2XQN M;  4IOY X;  4B6H A;  4P7I A;  2M38 A;  5EFX A;  1PMS A;  2UZR A;  3GYO A;  1DRO A;  2GCJ A;  1LW3 A;  2DYN A;  3DXC A;  2YT1 A;  4Y94 A;  5GOW B;  2GCL A;  2Q13 A;  2COC A;  2D9W A;  3FEH A;  3SNH A;  2QKM A;  1XX0 A;  1I7A A;  4ZRK A;  3ZVR A;  1V89 A;  2EMT A;  5D3V A;  1FHX A;  4HAT B;  4CHJ A;  2KUP A;  1ZVR A;  5C5B B;  2P0F A;  5DIF B;  3RCP A;  3VOQ A;  2Z0P A;  2MDX A;  3ZDT A;  1B55 A;  4HDQ A;  2ZPY A;  5LOP B;  1KZ7 A;  2I5F A;  4GMX B;  1WI1 A;  5DHA B;  5CLQ B;  2YRY A;  2DX5 A;  3KY9 A;  3P7Z A;  1DYN A;  4GN1 A;  2ADZ A;  5HE2 A;  1V5M A;  1XD4 A;  4GPT B;  4F7U P;  3A8P A;  3PG7 A;  3TW1 A;  3MPX A;  2DTC A;  1FB8 A;  1ZC3 B;  5JP4 A;  5D3X A;  3DXE A;  2CRF A;  3CXB B;  2DN6 A;  1PFJ A;  5DHF B;  1FAO A;  2RNR B;  1PLS A;  4K81 A;  2DKQ A;  2COF A;  3ULB A;  1V61 A;  2D9Y A;  4K2O A;  1OY2 A;  4A6F B;  5C5B A;  2LKO A;  4KHO A;  2DLW A;  1OMW A;  2YVC A;  4YL8 A;  2OTX A;  3WYF B;  2VRW B;  4Z2M B;  1UNR A;  4C0A A;  2LOX A;  5CLL B;  4HHV A;  4IFS A;  3U8Z A;  4NY0 A;  1J0W A;  2HE7 A;  2D9V A;  1FGZ A;  1UEF A;  3O96 A;  3LJU X;  1UPR A;  3X23 A;  1ISN A;  2OQB A;  1NTY A;  1XR0 B;  4PNK A;  1IRS A;  5JHH A;  3ULC A;  2H7E A;  4K17 A;  1M7R A;  4EMO A;  3PVL A;  3CIK A;  1V5P A;  2COA A;  1FOE A;  1DBH A;  2MFQ A;  1GC7 A;  1FGY A;  1QC6 A;  1SHC A;  1FHW A;  4HB3 B;  3QBV B;  3VIA A;  2VKI A;  4HAV B;  1J19 A;  5J3T A;  2LG1 A;  1FHO A;  4A6F A;  2DHK A;  2X18 A;  1UPQ A;  3BIN A;  2YSZ A;  1MIZ B;  4HAX B;  3HK0 A;  2KGX B;  2HTH B;  3D8D A;  4GXB A;  3SYX A;  1DDV A;  2RLO A;  1U27 A;  5J3Y A;  3KSY A;  2J59 M;  5D3W A;  3HQC A;  5JHG A;  2YS5 A;  2RGN B;  4ZRJ A;  5FI0 A;  4L6E A;  1BTK A;  1X1G A;  3KRX A;  3A8Q A;  1H4R A;  4DBB A;  5DI9 B;  3KRW A;  1U5F A;  2MKR A;  1U5G A;  2Z0Q A;  3TCA A;  2LUL A;  2ROZ B;  1P6S A;  4HB0 B;  3IVF A;  4Z2N A;  1NU2 A;  2LYD A;  1N3H A;  2BCJ A;  3SV1 A;  2GJY A;  4MT7 A;  4PQ0 A;  4HB2 B;  4CHM A;  1XOD A;  1TJ6 A;  2E2X A;  3F5R A;  4WSF A;  2KCJ A;  3ML4 A;  1RJ2 A;  3FM8 C;  2YS3 A;  2EC1 A;  5KQ4 A;  1ZM0 A;  2DHI A;  1UNQ A;  1WVH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...