3DXEA

Crystal structure of the intracellular domain of human app (t668a mutant) in complex with fe65-ptb2
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
124
structure length
124
Chain Sequence
FQVYYLGNVPVAKPVGVDVINGALESVLSSSSREQWTPSHVSVAPATLTILHQQTEAVLGECRVRFLSFLAVGRDVHTFAFIMAAGPASFCCHMFWCEPNAASLSEAVQAACMLRYQKCLDARS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the intracellular domain of the amyloid precursor protein in complex with Fe65-PTB2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Amyloid beta A4 protein-binding family B member 1
total genus 36
structure length 124
sequence length 124
chains with identical sequence C
ec nomenclature
pdb deposition date 2008-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00640 PID Phosphotyrosine interaction domain (PTB/PID)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3dxeA00
3KY9A 4A6HA 2YRYA 2XQNM 2I5FA 4HAVB 1U2BA 3SUZA 4GMXB 2X18A 1U5DA 2RVBB 2Z0QA 2D9XA 3PEGA 4A6FA 5HE0A 3F5RA 2YSZA 4HB3B 2YT0A 5C5BA 2IYBA 1H10A 2OQBA 1FHOA 2DHKA 1NI2A 2K2UA 4IOYX 1MK9B 1W1HA 2EMSA 2OTXA 3FM8C 1DDMA 1UNQA 2DYNA 4A5KA 1XKEA 2CY4A 1ISNA 1M7RA 1AQCA 2Z0PA 1UNRA 1QQGA 2LOZA 1E5WA 5JLJB 1X05A 3F0WA 3PVWA 2J0JA 4PNKA 4WJ7A 3QWMA 1UPRA 1I7AA 4H8SA 2RUKB 4GPTB 2DLWA 3SO6A 2MWNB 1ZM0A 1DYNA 1MKEA 1UPQA 2EMTA 4GXBA 1XCGA 1TJ6A 1V61A 1KZ7A 2KGXB 2MDXA 1FHXA 3MPXA 2D9YA 2ELAA 1TQZA 2RGNB 4DXAB 2YF0A 1SHCA 3ULBA 2EJ8A 2W2WA 1UEFA 4WVFB 3HK0A 2YVCA 1H4RA 1EF1A 1WVHA 2Z0OA 3NSUA 3PG7A 1X86A 3BINA 4C0AA 1Q67A 2M14A 2DHJA 3MDBC 1M7EA 3A8PA 1N3HA 4KHBB 2P0FA 1GG3A 4GZUA 5D3VA 5FI0A 3G9WA 1WI1A 1U5EA 1NTVA 2UVMA 5J3QA 1OMWA 5FI1A 2LULA 3V5WA 3VIAA 1BTKA 3ODWA 2Y7BA 1DROA 2H7DA 3AJ4A 4Z2NA 1KI1B 2P0HA 4K81A 5DIFB 2ROVA 5JHHA 2J0MA 4P7IA 1BTNA 4BBKA 1OY2A 2CAYA 1MIXA 1FHWA 1XD4A 5LOPB 3ODXA 4HDOA 4HHVA 2Q13A 1WJ1A 5D27A 5DHAB 2YT1A 2DN6A 3CXBB 4HAYB 1FOEA 5DHFB 2R0DA 3AU4A 5D3WA 4HDQA 1ZC4B 2ZPYA 5HE2A 3PSCA 2V76A 2COFA 2GCLA 1EAZA 1NTYA 5D3YA 2P0DA 1V5PA 5KQ4A 1V5UA 2L2IA 3TVVA 5C79A 3QIJA 3U8ZA 4HAUB 3O96A 5EFXA 5L81A 4A6KA 2D11A 4DX90 1P5TA 2ADZA 4L6EA 1MAIA 2COAA 2CY5A 4NY0A 1DBHA 1SGHA 1P6SA 3T06A 2DX1A 2VRWB 2J0KA 4YL8A 4KHAA 1K5DB 3KZ1A 2QKMA 1DDVA 1MIZB 2DFKA 3ZDTA 1NU2A 1PLSA 3PVLA 5KQ1A 4IAPA 3FEHA 4HB0B 4GN1A 2EC1A 1WG7A 2CODA 3GYOA 4B6HA 2KCJA 3RCPA 3N7CA 1W1DA 5D3XA 2HE7A 3P6AA 2AEHA 3U7DA 3DXCA 2IFSA 1WGQA 2DYQA 3SNHA 2M38A 1IRSA 4F7GA 4MT7A 4D0NB 5LONB 3TO1A 1DDWA 3SV1A 2DTCA 5J3TA 4K2PA 4IFSA 1FB8A 2JP2A 4KVGB 2UZSA 4DX8A 2D9ZA 1X1GA 2DX5A 2YS5A 3A8QA 2YS1A 4HATB 2UZRA 3ML4A 4EMOA 1B55A 2YS3A 3TFMA 2J59M 2RSGA 1U5GA 5GOWB 2GJYA 1K5GB 4CHMA 1J0WA 3D8DA 2Y8GA 2D9VA 4K2OA 3D8EA 2I1JA 4Z2MB 3A98B 2DA0A 3AU5A 2LG1A 1RJ2A 3HW2B 2E2XA 2RLOA 2DHIA 1EVHA 4F7UP 3TW1A 5CLQB 3KRWA 2QKLA 2D4QA 2VSZA 4HAXB 3PP2A 1WGUA 2GS0A 5DH9B 1XX0A 1PMSA 1EGXA 4MY6A 1QC6A 2FJLA 3CIKA 2NMBA 4WSFA 2RNRB 1P3RA 1V5MA 1FGZA 4YONA 4ZRIA 3FSSA 1PFJA 1KZGA 1RRPB 5DI9B 2LOXA 1XODA 2DKQA 5KCVA 1XR0B 2MKRA 1LB1A 3X23A 2NZ8B 3TCAA 1LW3A 2LYDA 1BWNA 2R09A 1J19A 1ZC3B 2GCJA 4CHJA 2LKOA 3ZVRA 4EJNA 3ULCA 2BCJA 2N23A 2ELBA 2D2QA 5HE1A 2ROZB 5HE3A 1U29A 1X11A 1ZVRA 1U27A 4DBBA 4HB2B 1U5FA 3KSYA 2CRFA 3BJIA 3VOQA 5J3YA 5JP4A 2AL6A 3DXEA 5JHGA 3DXDA 3M1IB 4K17A 3LJUX 1ZSQA 2COCA 2G35A 1I2HA 2I1KA 4PQ0A 4KHOA 2D9WA 3QBVB 4ZRJA 4A6FB 3WA0A 2I5CA 2K2JA 4MK0A 2Y8FA 3SYXA 1Y19B 2P8VA 2L1CA 2DKPA 4TKNA 1TXDA 4TYZA 3WYFB 4KAXB 1UNPA 1FAOA 3OANA 4CYEA 1OQNA 2PZ1A 2HTHB 4HAWB 1V88A 3D8FA 1MPHA 1W1GA 5CLLB 2K00A 3PVUA 1MK7B 3PZDA 3KRXA 3P7ZA 3IVFA 2KUPA 2VKIA 2W2XC 1GC6A 1FGYA 2MFQA 5C16A 2H7EA 4NSWA 5C6RA 4HB4B 4EKUA 3ODOA 4F7HA 1Z87A 4XWXA 1BAKA 3UZTA 1X1FA 1V89A 4HAZB 1AWEA 2W2XD 1GC7A 2D10A 1Y5OA 5C5BB 2N0YA 3GYPA 4ZRKA 4Y94A 1WJMA 3HQCA 4GMVA
chains in the Genus database with same CATH superfamily
3KY9A 4A6HA 2YRYA 2XQNM 2I5FA 3A58A 4HAVB 1U2BA 3SUZA 4GMXB 2X18A 1U5DA 2RVBB 2Z0QA 2D9XA 3PEGA 4A6FA 5HE0A 3F5RA 2YSZA 4HB3B 2YT0A 5C5BA 2IYBA 1H10A 2ZKMX 2OQBA 1FHOA 2DHKA 1NI2A 2K8EA 2K2UA 4IOYX 1MK9B 1W1HA 2EMSA 2OTXA 3FM8C 1DDMA 1UNQA 2DYNA 4A5KA 1XKEA 2CY4A 1ISNA 1M7RA 5IRSA 1AQCA 2Z0PA 1UNRA 1QQGA 4HSIA 2LOZA 5I2MA 1E5WA 5JLJB 1X05A 3F0WA 3PVWA 2J0JA 4PNKA 4WJ7A 3QWMA 1UPRA 1I7AA 4H8SA 2RUKB 4GPTB 2DLWA 3SO6A 2MWNB 1ZM0A 1DYNA 4GOUA 4GNKB 1MKEA 1UPQA 2EMTA 4GXBA 1XCGA 1TJ6A 1V61A 1KZ7A 2KGXB 2MDXA 1FHXA 1MI1A 3MPXA 2D9YA 2ELAA 1TQZA 2RGNB 4DXAB 2YF0A 1SHCA 2GUMA 3ULBA 2EJ8A 2W2WA 1UEFA 4WVFB 3HK0A 2YVCA 1H4RA 2KUQA 1EF1A 1WVHA 2Z0OA 3NSUA 3PG7A 1X86A 2KIGA 3BINA 4C0AA 1Q67A 2M14A 2DHJA 2K49A 3MDBC 1M7EA 3A8PA 1N3HA 4KHBB 2P0FA 1GG3A 4GZUA 5D3VA 5FI0A 3G9WA 1WI1A 1U5EA 1NTVA 2UVMA 5J3QA 1OMWA 5FI1A 2LULA 3V5WA 3VIAA 1BTKA 3ODWA 2Y7BA 1DROA 2H7DA 3AJ4A 4Z2NA 4L1RA 1KI1B 2P0HA 4K81A 5DIFB 2ROVA 5JHHA 2J0MA 4P7IA 1BTNA 3NWFA 4BBKA 1OY2A 3NW8A 2CAYA 1MIXA 1FHWA 1XD4A 5LOPB 3ODXA 4HDOA 4HHVA 2Q13A 1WJ1A 3B77A 5D27A 5DHAB 2YT1A 2YT2A 2DN6A 3CXBB 4HAYB 1FOEA 5DHFB 2R0DA 4OSNA 3AU4A 5D3WA 4HDQA 1ZC4B 2ZPYA 5HE2A 3PSCA 2V76A 2COFA 3U12A 3HSAA 2GCLA 1EAZA 1NTYA 5D3YA 2P0DA 1V5PA 5KQ4A 1V5UA 2L2IA 3TVVA 5C79A 3QIJA 3U8ZA 2Z4DA 4HAUB 3O96A 5EFXA 5L81A 4A6KA 2D11A 4DX90 1P5TA 2ADZA 4L6EA 1MAIA 2COAA 2CY5A 4NY0A 4CSQA 1DBHA 1SGHA 1P6SA 3T06A 2DX1A 2VRWB 2J0KA 4YL8A 4KHAA 1K5DB 3KZ1A 2QKMA 1DDVA 1MIZB 2DFKA 3ZDTA 1NU2A 1PLSA 3PVLA 5KQ1A 4IAPA 3FEHA 4HB0B 1ZYIA 4GN1A 2EC1A 1WG7A 2CODA 3GYOA 4B6HA 2KCJA 4QJ3B 3RCPA 3N7CA 1W1DA 5D3XA 2HE7A 3P6AA 2AEHA 3U7DA 3DXCA 2IFSA 1WGQA 2DYQA 3SNHA 2M38A 3FVCA 1IRSA 4F7GA 4MT7A 4D0NB 5LONB 3DCXA 3NWAA 5LG4B 3TO1A 1DDWA 3SV1A 2DTCA 5J3TA 4K2PA 4IFSA 1FB8A 2JP2A 4KVGB 2UZSA 4DX8A 2D9ZA 1X1GA 2DX5A 2YS5A 3A8QA 2RRFA 2YS1A 4HATB 2UZRA 3ML4A 4EMOA 1B55A 2YS3A 3TFMA 2J59M 2RSGA 1U5GA 5GOWB 2GJYA 2KIEA 1K5GB 4QXAB 4OT1A 4CHMA 1J0WA 3D8DA 2Y8GA 2D9VA 4K2OA 5M4YB 3D8EA 2I1JA 4Z2MB 2R2YA 3A98B 2DA0A 3AU5A 2LG1A 1RJ2A 3HW2B 2E2XA 3HIEA 2RLOA 2DHIA 1EVHA 4F7UP 3TW1A 5CLQB 3KRWA 2QKLA 2D4QA 2VSZA 2Z14A 4HAXB 3PP2A 1WGUA 2GS0A 5DH9B 1XX0A 1PMSA 1EGXA 4MY6A 1QC6A 2FJLA 3CIKA 2NMBA 2Z59A 4WSFA 2RNRB 1P3RA 1V5MA 1FGZA 4YONA 4ZRIA 3FSSA 1PFJA 1KZGA 1RRPB 5DI9B 2LOXA 1XODA 2DKQA 5KCVA 1XR0B 2MKRA 4QJ5B 1LB1A 3X23A 2NZ8B 2KR0A 3TCAA 1LW3A 2LYDA 1BWNA 2R09A 1J19A 1ZC3B 1T77A 2GCJA 4CHJA 2LKOA 3ZVRA 4EJNA 3ULCA 2BCJA 2N23A 2ELBA 2D2QA 5HE1A 4KHBA 2ROZB 5HE3A 1U29A 1X11A 1ZVRA 1U27A 2Z13A 4DBBA 4HB2B 1U5FA 3KSYA 2CRFA 3BJIA 3VOQA 5J3YA 5JP4A 2AL6A 3DXEA 4DIXA 5JHGA 3DXDA 3M1IB 4D6WA 4K17A 3LJUX 2FJUB 1ZSQA 2COCA 2G35A 3NWDA 2NBVA 1I2HA 2I1KA 4PQ0A 4KHOA 2D9WA 3QBVB 4ZRJA 4A6FB 3WA0A 2I5CA 2K2JA 4MK0A 2Y8FA 3SYXA 1Y19B 2P8VA 3OHMB 2L1CA 2DKPA 4TKNA 1TXDA 4TYZA 3WYFB 4KAXB 1UNPA 1FAOA 3OANA 4CYEA 1OQNA 2PZ1A 2HTHB 5I2SA 4HAWB 1V88A 3D8FA 1MPHA 1W1GA 5CLLB 2K00A 3PVUA 1MK7B 3PZDA 3KRXA 3P7ZA 3IVFA 4QJ4B 2KUPA 2VKIA 2W2XC 1GC6A 1FGYA 2MFQA 5C16A 2H7EA 4NSWA 5C6RA 4HB4B 4EKUA 3ODOA 4F7HA 1Z87A 4XWXA 1BAKA 3UZTA 1X1FA 1V89A 4HAZB 1AWEA 2W2XD 1GC7A 2D10A 1Y5OA 5C5BB 2N0YA 3GYPA 4ZRKA 4Y94A 1WJMA 3HQCA 4GMVA
chains in the Genus database with same CATH topology
3KY9A 4A6HA 2YRYA 2XQNM 2I5FA 4HAVB 1U2BA 3SUZA 4GMXB 2X18A 1U5DA 2RVBB 2Z0QA 2D9XA 3PEGA 4A6FA 5HE0A 3F5RA 2YSZA 4HB3B 2YT0A 5C5BA 2IYBA 1H10A 2OQBA 1FHOA 2DHKA 1NI2A 2K2UA 4IOYX 1MK9B 1W1HA 2EMSA 2OTXA 3FM8C 1DDMA 1UNQA 2DYNA 4A5KA 1XKEA 2CY4A 1ISNA 1M7RA 1AQCA 2Z0PA 1UNRA 1QQGA 2LOZA 1E5WA 5JLJB 1X05A 3F0WA 3PVWA 2J0JA 4PNKA 4WJ7A 3QWMA 1UPRA 1I7AA 4H8SA 2RUKB 4GPTB 2DLWA 3SO6A 2MWNB 1ZM0A 1DYNA 1MKEA 1UPQA 2EMTA 4GXBA 1XCGA 1TJ6A 1V61A 1KZ7A 2KGXB 2MDXA 1FHXA 3MPXA 2D9YA 2ELAA 1TQZA 2RGNB 4DXAB 2YF0A 1SHCA 3ULBA 2EJ8A 2W2WA 1UEFA 4WVFB 3HK0A 2YVCA 1H4RA 1EF1A 1WVHA 2Z0OA 3NSUA 3PG7A 1X86A 3BINA 4C0AA 1Q67A 2M14A 2DHJA 3MDBC 1M7EA 3A8PA 1N3HA 4KHBB 2P0FA 1GG3A 4GZUA 5D3VA 5FI0A 3G9WA 1WI1A 1U5EA 1NTVA 2UVMA 5J3QA 1OMWA 5FI1A 2LULA 3V5WA 3VIAA 1BTKA 3ODWA 2Y7BA 1DROA 2H7DA 3AJ4A 4Z2NA 1KI1B 2P0HA 4K81A 5DIFB 2ROVA 5JHHA 2J0MA 4P7IA 1BTNA 4BBKA 1OY2A 2CAYA 1MIXA 1FHWA 1XD4A 5LOPB 3ODXA 4HDOA 4HHVA 2Q13A 1WJ1A 5D27A 5DHAB 2YT1A 2DN6A 3CXBB 4HAYB 1FOEA 5DHFB 2R0DA 3AU4A 5D3WA 4HDQA 1ZC4B 2ZPYA 5HE2A 3PSCA 2V76A 2COFA 2GCLA 1EAZA 1NTYA 5D3YA 2P0DA 1V5PA 5KQ4A 1V5UA 2L2IA 3TVVA 5C79A 3QIJA 3U8ZA 4HAUB 3O96A 5EFXA 5L81A 4A6KA 2D11A 4DX90 1P5TA 2ADZA 4L6EA 1MAIA 2COAA 2CY5A 4NY0A 1DBHA 1SGHA 1P6SA 3T06A 2DX1A 2VRWB 2J0KA 4YL8A 4KHAA 1K5DB 3KZ1A 2QKMA 1DDVA 1MIZB 2DFKA 3ZDTA 1NU2A 1PLSA 3PVLA 5KQ1A 4IAPA 3FEHA 4HB0B 4GN1A 2EC1A 1WG7A 2CODA 3GYOA 4B6HA 2KCJA 3RCPA 3N7CA 1W1DA 5D3XA 2HE7A 3P6AA 2AEHA 3U7DA 3DXCA 2IFSA 1WGQA 2DYQA 3SNHA 2M38A 1IRSA 4F7GA 4MT7A 4D0NB 5LONB 3TO1A 1DDWA 3SV1A 2DTCA 5J3TA 4K2PA 4IFSA 1FB8A 2JP2A 4KVGB 2UZSA 4DX8A 2D9ZA 1X1GA 2DX5A 2YS5A 3A8QA 2YS1A 4HATB 2UZRA 3ML4A 4EMOA 1B55A 2YS3A 3TFMA 2J59M 2RSGA 1U5GA 5GOWB 2GJYA 1K5GB 4CHMA 1J0WA 3D8DA 2Y8GA 2D9VA 4K2OA 3D8EA 2I1JA 4Z2MB 3A98B 2DA0A 3AU5A 2LG1A 1RJ2A 3HW2B 2E2XA 2RLOA 2DHIA 1EVHA 4F7UP 3TW1A 5CLQB 3KRWA 2QKLA 2D4QA 2VSZA 4HAXB 3PP2A 1WGUA 2GS0A 5DH9B 1XX0A 1PMSA 1EGXA 4MY6A 1QC6A 2FJLA 3CIKA 2NMBA 4WSFA 2RNRB 1P3RA 1V5MA 1FGZA 4YONA 4ZRIA 3FSSA 1PFJA 1KZGA 1RRPB 5DI9B 2LOXA 1XODA 2DKQA 5KCVA 1XR0B 2MKRA 1LB1A 3X23A 2NZ8B 3TCAA 1LW3A 2LYDA 1BWNA 2R09A 1J19A 1ZC3B 2GCJA 4CHJA 2LKOA 3ZVRA 4EJNA 3ULCA 2BCJA 2N23A 2ELBA 2D2QA 5HE1A 2ROZB 5HE3A 1U29A 1X11A 1ZVRA 1U27A 4DBBA 4HB2B 1U5FA 3KSYA 2CRFA 3BJIA 3VOQA 5J3YA 5JP4A 2AL6A 3DXEA 5JHGA 3DXDA 3M1IB 4K17A 3LJUX 1ZSQA 2COCA 2G35A 1I2HA 2I1KA 4PQ0A 4KHOA 2D9WA 3QBVB 4ZRJA 4A6FB 3WA0A 2I5CA 2K2JA 4MK0A 2Y8FA 3SYXA 1Y19B 2P8VA 2L1CA 2DKPA 4TKNA 1TXDA 4TYZA 3WYFB 4KAXB 1UNPA 1FAOA 3OANA 4CYEA 1OQNA 2PZ1A 2HTHB 4HAWB 1V88A 3D8FA 1MPHA 1W1GA 5CLLB 2K00A 3PVUA 1MK7B 3PZDA 3KRXA 3P7ZA 3IVFA 2KUPA 2VKIA 2W2XC 1GC6A 1FGYA 2MFQA 5C16A 2H7EA 4NSWA 5C6RA 4HB4B 4EKUA 3ODOA 4F7HA 1Z87A 4XWXA 1BAKA 3UZTA 1X1FA 1V89A 4HAZB 1AWEA 2W2XD 1GC7A 2D10A 1Y5OA 5C5BB 2N0YA 3GYPA 4ZRKA 4Y94A 1WJMA 3HQCA 4GMVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KY9 A;  4A6H A;  2YRY A;  2XQN M;  2I5F A;  4HAV B;  1U2B A;  3SUZ A;  4GMX B;  2X18 A;  1U5D A;  2RVB B;  2Z0Q A;  2D9X A;  3PEG A;  4A6F A;  5HE0 A;  3F5R A;  2YSZ A;  4HB3 B;  2YT0 A;  5C5B A;  2IYB A;  1H10 A;  2OQB A;  1FHO A;  2DHK A;  1NI2 A;  2K2U A;  4IOY X;  1MK9 B;  1W1H A;  2EMS A;  2OTX A;  3FM8 C;  1DDM A;  1UNQ A;  2DYN A;  4A5K A;  1XKE A;  2CY4 A;  1ISN A;  1M7R A;  1AQC A;  2Z0P A;  1UNR A;  1QQG A;  2LOZ A;  1E5W A;  5JLJ B;  1X05 A;  3F0W A;  3PVW A;  2J0J A;  4PNK A;  4WJ7 A;  3QWM A;  1UPR A;  1I7A A;  4H8S A;  2RUK B;  4GPT B;  2DLW A;  3SO6 A;  2MWN B;  1ZM0 A;  1DYN A;  1MKE A;  1UPQ A;  2EMT A;  4GXB A;  1XCG A;  1TJ6 A;  1V61 A;  1KZ7 A;  2KGX B;  2MDX A;  1FHX A;  3MPX A;  2D9Y A;  2ELA A;  1TQZ A;  2RGN B;  4DXA B;  2YF0 A;  1SHC A;  3ULB A;  2EJ8 A;  2W2W A;  1UEF A;  4WVF B;  3HK0 A;  2YVC A;  1H4R A;  1EF1 A;  1WVH A;  2Z0O A;  3NSU A;  3PG7 A;  1X86 A;  3BIN A;  4C0A A;  1Q67 A;  2M14 A;  2DHJ A;  3MDB C;  1M7E A;  3A8P A;  1N3H A;  4KHB B;  2P0F A;  1GG3 A;  4GZU A;  5D3V A;  5FI0 A;  3G9W A;  1WI1 A;  1U5E A;  1NTV A;  2UVM A;  5J3Q A;  1OMW A;  5FI1 A;  2LUL A;  3V5W A;  3VIA A;  1BTK A;  3ODW A;  2Y7B A;  1DRO A;  2H7D A;  3AJ4 A;  4Z2N A;  1KI1 B;  2P0H A;  4K81 A;  5DIF B;  2ROV A;  5JHH A;  2J0M A;  4P7I A;  1BTN A;  4BBK A;  1OY2 A;  2CAY A;  1MIX A;  1FHW A;  1XD4 A;  5LOP B;  3ODX A;  4HDO A;  4HHV A;  2Q13 A;  1WJ1 A;  5D27 A;  5DHA B;  2YT1 A;  2DN6 A;  3CXB B;  4HAY B;  1FOE A;  5DHF B;  2R0D A;  3AU4 A;  5D3W A;  4HDQ A;  1ZC4 B;  2ZPY A;  5HE2 A;  3PSC A;  2V76 A;  2COF A;  2GCL A;  1EAZ A;  1NTY A;  5D3Y A;  2P0D A;  1V5P A;  5KQ4 A;  1V5U A;  2L2I A;  3TVV A;  5C79 A;  3QIJ A;  3U8Z A;  4HAU B;  3O96 A;  5EFX A;  5L81 A;  4A6K A;  2D11 A;  4DX9 0;  1P5T A;  2ADZ A;  4L6E A;  1MAI A;  2COA A;  2CY5 A;  4NY0 A;  1DBH A;  1SGH A;  1P6S A;  3T06 A;  2DX1 A;  2VRW B;  2J0K A;  4YL8 A;  4KHA A;  1K5D B;  3KZ1 A;  2QKM A;  1DDV A;  1MIZ B;  2DFK A;  3ZDT A;  1NU2 A;  1PLS A;  3PVL A;  5KQ1 A;  4IAP A;  3FEH A;  4HB0 B;  4GN1 A;  2EC1 A;  1WG7 A;  2COD A;  3GYO A;  4B6H A;  2KCJ A;  3RCP A;  3N7C A;  1W1D A;  5D3X A;  2HE7 A;  3P6A A;  2AEH A;  3U7D A;  3DXC A;  2IFS A;  1WGQ A;  2DYQ A;  3SNH A;  2M38 A;  1IRS A;  4F7G A;  4MT7 A;  4D0N B;  5LON B;  3TO1 A;  1DDW A;  3SV1 A;  2DTC A;  5J3T A;  4K2P A;  4IFS A;  1FB8 A;  2JP2 A;  4KVG B;  2UZS A;  4DX8 A;  2D9Z A;  1X1G A;  2DX5 A;  2YS5 A;  3A8Q A;  2YS1 A;  4HAT B;  2UZR A;  3ML4 A;  4EMO A;  1B55 A;  2YS3 A;  3TFM A;  2J59 M;  2RSG A;  1U5G A;  5GOW B;  2GJY A;  1K5G B;  4CHM A;  1J0W A;  3D8D A;  2Y8G A;  2D9V A;  4K2O A;  3D8E A;  2I1J A;  4Z2M B;  3A98 B;  2DA0 A;  3AU5 A;  2LG1 A;  1RJ2 A;  3HW2 B;  2E2X A;  2RLO A;  2DHI A;  1EVH A;  4F7U P;  3TW1 A;  5CLQ B;  3KRW A;  2QKL A;  2D4Q A;  2VSZ A;  4HAX B;  3PP2 A;  1WGU A;  2GS0 A;  5DH9 B;  1XX0 A;  1PMS A;  1EGX A;  4MY6 A;  1QC6 A;  2FJL A;  3CIK A;  2NMB A;  4WSF A;  2RNR B;  1P3R A;  1V5M A;  1FGZ A;  4YON A;  4ZRI A;  3FSS A;  1PFJ A;  1KZG A;  1RRP B;  5DI9 B;  2LOX A;  1XOD A;  2DKQ A;  5KCV A;  1XR0 B;  2MKR A;  1LB1 A;  3X23 A;  2NZ8 B;  3TCA A;  1LW3 A;  2LYD A;  1BWN A;  2R09 A;  1J19 A;  1ZC3 B;  2GCJ A;  4CHJ A;  2LKO A;  3ZVR A;  4EJN A;  3ULC A;  2BCJ A;  2N23 A;  2ELB A;  2D2Q A;  5HE1 A;  2ROZ B;  5HE3 A;  1U29 A;  1X11 A;  1ZVR A;  1U27 A;  4DBB A;  4HB2 B;  1U5F A;  3KSY A;  2CRF A;  3BJI A;  3VOQ A;  5J3Y A;  5JP4 A;  2AL6 A;  3DXE A;  5JHG A;  3DXD A;  3M1I B;  4K17 A;  3LJU X;  1ZSQ A;  2COC A;  2G35 A;  1I2H A;  2I1K A;  4PQ0 A;  4KHO A;  2D9W A;  3QBV B;  4ZRJ A;  4A6F B;  3WA0 A;  2I5C A;  2K2J A;  4MK0 A;  2Y8F A;  3SYX A;  1Y19 B;  2P8V A;  2L1C A;  2DKP A;  4TKN A;  1TXD A;  4TYZ A;  3WYF B;  4KAX B;  1UNP A;  1FAO A;  3OAN A;  4CYE A;  1OQN A;  2PZ1 A;  2HTH B;  4HAW B;  1V88 A;  3D8F A;  1MPH A;  1W1G A;  5CLL B;  2K00 A;  3PVU A;  1MK7 B;  3PZD A;  3KRX A;  3P7Z A;  3IVF A;  2KUP A;  2VKI A;  2W2X C;  1GC6 A;  1FGY A;  2MFQ A;  5C16 A;  2H7E A;  4NSW A;  5C6R A;  4HB4 B;  4EKU A;  3ODO A;  4F7H A;  1Z87 A;  4XWX A;  1BAK A;  3UZT A;  1X1F A;  1V89 A;  4HAZ B;  1AWE A;  2W2X D;  1GC7 A;  2D10 A;  1Y5O A;  5C5B B;  2N0Y A;  3GYP A;  4ZRK A;  4Y94 A;  1WJM A;  3HQC A;  4GMV A; 
#chains in the Genus database with same CATH topology
 3KY9 A;  4A6H A;  2YRY A;  2XQN M;  2I5F A;  3A58 A;  4HAV B;  1U2B A;  3SUZ A;  4GMX B;  2X18 A;  1U5D A;  2RVB B;  2Z0Q A;  2D9X A;  3PEG A;  4A6F A;  5HE0 A;  3F5R A;  2YSZ A;  4HB3 B;  2YT0 A;  5C5B A;  2IYB A;  1H10 A;  2ZKM X;  2OQB A;  1FHO A;  2DHK A;  1NI2 A;  2K8E A;  2K2U A;  4IOY X;  1MK9 B;  1W1H A;  2EMS A;  2OTX A;  3FM8 C;  1DDM A;  1UNQ A;  2DYN A;  4A5K A;  1XKE A;  2CY4 A;  1ISN A;  1M7R A;  5IRS A;  1AQC A;  2Z0P A;  1UNR A;  1QQG A;  4HSI A;  2LOZ A;  5I2M A;  1E5W A;  5JLJ B;  1X05 A;  3F0W A;  3PVW A;  2J0J A;  4PNK A;  4WJ7 A;  3QWM A;  1UPR A;  1I7A A;  4H8S A;  2RUK B;  4GPT B;  2DLW A;  3SO6 A;  2MWN B;  1ZM0 A;  1DYN A;  4GOU A;  4GNK B;  1MKE A;  1UPQ A;  2EMT A;  4GXB A;  1XCG A;  1TJ6 A;  1V61 A;  1KZ7 A;  2KGX B;  2MDX A;  1FHX A;  1MI1 A;  3MPX A;  2D9Y A;  2ELA A;  1TQZ A;  2RGN B;  4DXA B;  2YF0 A;  1SHC A;  2GUM A;  3ULB A;  2EJ8 A;  2W2W A;  1UEF A;  4WVF B;  3HK0 A;  2YVC A;  1H4R A;  2KUQ A;  1EF1 A;  1WVH A;  2Z0O A;  3NSU A;  3PG7 A;  1X86 A;  2KIG A;  3BIN A;  4C0A A;  1Q67 A;  2M14 A;  2DHJ A;  2K49 A;  3MDB C;  1M7E A;  3A8P A;  1N3H A;  4KHB B;  2P0F A;  1GG3 A;  4GZU A;  5D3V A;  5FI0 A;  3G9W A;  1WI1 A;  1U5E A;  1NTV A;  2UVM A;  5J3Q A;  1OMW A;  5FI1 A;  2LUL A;  3V5W A;  3VIA A;  1BTK A;  3ODW A;  2Y7B A;  1DRO A;  2H7D A;  3AJ4 A;  4Z2N A;  4L1R A;  1KI1 B;  2P0H A;  4K81 A;  5DIF B;  2ROV A;  5JHH A;  2J0M A;  4P7I A;  1BTN A;  3NWF A;  4BBK A;  1OY2 A;  3NW8 A;  2CAY A;  1MIX A;  1FHW A;  1XD4 A;  5LOP B;  3ODX A;  4HDO A;  4HHV A;  2Q13 A;  1WJ1 A;  3B77 A;  5D27 A;  5DHA B;  2YT1 A;  2YT2 A;  2DN6 A;  3CXB B;  4HAY B;  1FOE A;  5DHF B;  2R0D A;  4OSN A;  3AU4 A;  5D3W A;  4HDQ A;  1ZC4 B;  2ZPY A;  5HE2 A;  3PSC A;  2V76 A;  2COF A;  3U12 A;  3HSA A;  2GCL A;  1EAZ A;  1NTY A;  5D3Y A;  2P0D A;  1V5P A;  5KQ4 A;  1V5U A;  2L2I A;  3TVV A;  5C79 A;  3QIJ A;  3U8Z A;  2Z4D A;  4HAU B;  3O96 A;  5EFX A;  5L81 A;  4A6K A;  2D11 A;  4DX9 0;  1P5T A;  2ADZ A;  4L6E A;  1MAI A;  2COA A;  2CY5 A;  4NY0 A;  4CSQ A;  1DBH A;  1SGH A;  1P6S A;  3T06 A;  2DX1 A;  2VRW B;  2J0K A;  4YL8 A;  4KHA A;  1K5D B;  3KZ1 A;  2QKM A;  1DDV A;  1MIZ B;  2DFK A;  3ZDT A;  1NU2 A;  1PLS A;  3PVL A;  5KQ1 A;  4IAP A;  3FEH A;  4HB0 B;  1ZYI A;  4GN1 A;  2EC1 A;  1WG7 A;  2COD A;  3GYO A;  4B6H A;  2KCJ A;  4QJ3 B;  3RCP A;  3N7C A;  1W1D A;  5D3X A;  2HE7 A;  3P6A A;  2AEH A;  3U7D A;  3DXC A;  2IFS A;  1WGQ A;  2DYQ A;  3SNH A;  2M38 A;  3FVC A;  1IRS A;  4F7G A;  4MT7 A;  4D0N B;  5LON B;  3DCX A;  3NWA A;  5LG4 B;  3TO1 A;  1DDW A;  3SV1 A;  2DTC A;  5J3T A;  4K2P A;  4IFS A;  1FB8 A;  2JP2 A;  4KVG B;  2UZS A;  4DX8 A;  2D9Z A;  1X1G A;  2DX5 A;  2YS5 A;  3A8Q A;  2RRF A;  2YS1 A;  4HAT B;  2UZR A;  3ML4 A;  4EMO A;  1B55 A;  2YS3 A;  3TFM A;  2J59 M;  2RSG A;  1U5G A;  5GOW B;  2GJY A;  2KIE A;  1K5G B;  4QXA B;  4OT1 A;  4CHM A;  1J0W A;  3D8D A;  2Y8G A;  2D9V A;  4K2O A;  5M4Y B;  3D8E A;  2I1J A;  4Z2M B;  2R2Y A;  3A98 B;  2DA0 A;  3AU5 A;  2LG1 A;  1RJ2 A;  3HW2 B;  2E2X A;  3HIE A;  2RLO A;  2DHI A;  1EVH A;  4F7U P;  3TW1 A;  5CLQ B;  3KRW A;  2QKL A;  2D4Q A;  2VSZ A;  2Z14 A;  4HAX B;  3PP2 A;  1WGU A;  2GS0 A;  5DH9 B;  1XX0 A;  1PMS A;  1EGX A;  4MY6 A;  1QC6 A;  2FJL A;  3CIK A;  2NMB A;  2Z59 A;  4WSF A;  2RNR B;  1P3R A;  1V5M A;  1FGZ A;  4YON A;  4ZRI A;  3FSS A;  1PFJ A;  1KZG A;  1RRP B;  5DI9 B;  2LOX A;  1XOD A;  2DKQ A;  5KCV A;  1XR0 B;  2MKR A;  4QJ5 B;  1LB1 A;  3X23 A;  2NZ8 B;  2KR0 A;  3TCA A;  1LW3 A;  2LYD A;  1BWN A;  2R09 A;  1J19 A;  1ZC3 B;  1T77 A;  2GCJ A;  4CHJ A;  2LKO A;  3ZVR A;  4EJN A;  3ULC A;  2BCJ A;  2N23 A;  2ELB A;  2D2Q A;  5HE1 A;  4KHB A;  2ROZ B;  5HE3 A;  1U29 A;  1X11 A;  1ZVR A;  1U27 A;  2Z13 A;  4DBB A;  4HB2 B;  1U5F A;  3KSY A;  2CRF A;  3BJI A;  3VOQ A;  5J3Y A;  5JP4 A;  2AL6 A;  3DXE A;  4DIX A;  5JHG A;  3DXD A;  3M1I B;  4D6W A;  4K17 A;  3LJU X;  2FJU B;  1ZSQ A;  2COC A;  2G35 A;  3NWD A;  2NBV A;  1I2H A;  2I1K A;  4PQ0 A;  4KHO A;  2D9W A;  3QBV B;  4ZRJ A;  4A6F B;  3WA0 A;  2I5C A;  2K2J A;  4MK0 A;  2Y8F A;  3SYX A;  1Y19 B;  2P8V A;  3OHM B;  2L1C A;  2DKP A;  4TKN A;  1TXD A;  4TYZ A;  3WYF B;  4KAX B;  1UNP A;  1FAO A;  3OAN A;  4CYE A;  1OQN A;  2PZ1 A;  2HTH B;  5I2S A;  4HAW B;  1V88 A;  3D8F A;  1MPH A;  1W1G A;  5CLL B;  2K00 A;  3PVU A;  1MK7 B;  3PZD A;  3KRX A;  3P7Z A;  3IVF A;  4QJ4 B;  2KUP A;  2VKI A;  2W2X C;  1GC6 A;  1FGY A;  2MFQ A;  5C16 A;  2H7E A;  4NSW A;  5C6R A;  4HB4 B;  4EKU A;  3ODO A;  4F7H A;  1Z87 A;  4XWX A;  1BAK A;  3UZT A;  1X1F A;  1V89 A;  4HAZ B;  1AWE A;  2W2X D;  1GC7 A;  2D10 A;  1Y5O A;  5C5B B;  2N0Y A;  3GYP A;  4ZRK A;  4Y94 A;  1WJM A;  3HQC A;  4GMV A; 
#chains in the Genus database with same CATH homology
 3KY9 A;  4A6H A;  2YRY A;  2XQN M;  2I5F A;  4HAV B;  1U2B A;  3SUZ A;  4GMX B;  2X18 A;  1U5D A;  2RVB B;  2Z0Q A;  2D9X A;  3PEG A;  4A6F A;  5HE0 A;  3F5R A;  2YSZ A;  4HB3 B;  2YT0 A;  5C5B A;  2IYB A;  1H10 A;  2OQB A;  1FHO A;  2DHK A;  1NI2 A;  2K2U A;  4IOY X;  1MK9 B;  1W1H A;  2EMS A;  2OTX A;  3FM8 C;  1DDM A;  1UNQ A;  2DYN A;  4A5K A;  1XKE A;  2CY4 A;  1ISN A;  1M7R A;  1AQC A;  2Z0P A;  1UNR A;  1QQG A;  2LOZ A;  1E5W A;  5JLJ B;  1X05 A;  3F0W A;  3PVW A;  2J0J A;  4PNK A;  4WJ7 A;  3QWM A;  1UPR A;  1I7A A;  4H8S A;  2RUK B;  4GPT B;  2DLW A;  3SO6 A;  2MWN B;  1ZM0 A;  1DYN A;  1MKE A;  1UPQ A;  2EMT A;  4GXB A;  1XCG A;  1TJ6 A;  1V61 A;  1KZ7 A;  2KGX B;  2MDX A;  1FHX A;  3MPX A;  2D9Y A;  2ELA A;  1TQZ A;  2RGN B;  4DXA B;  2YF0 A;  1SHC A;  3ULB A;  2EJ8 A;  2W2W A;  1UEF A;  4WVF B;  3HK0 A;  2YVC A;  1H4R A;  1EF1 A;  1WVH A;  2Z0O A;  3NSU A;  3PG7 A;  1X86 A;  3BIN A;  4C0A A;  1Q67 A;  2M14 A;  2DHJ A;  3MDB C;  1M7E A;  3A8P A;  1N3H A;  4KHB B;  2P0F A;  1GG3 A;  4GZU A;  5D3V A;  5FI0 A;  3G9W A;  1WI1 A;  1U5E A;  1NTV A;  2UVM A;  5J3Q A;  1OMW A;  5FI1 A;  2LUL A;  3V5W A;  3VIA A;  1BTK A;  3ODW A;  2Y7B A;  1DRO A;  2H7D A;  3AJ4 A;  4Z2N A;  1KI1 B;  2P0H A;  4K81 A;  5DIF B;  2ROV A;  5JHH A;  2J0M A;  4P7I A;  1BTN A;  4BBK A;  1OY2 A;  2CAY A;  1MIX A;  1FHW A;  1XD4 A;  5LOP B;  3ODX A;  4HDO A;  4HHV A;  2Q13 A;  1WJ1 A;  5D27 A;  5DHA B;  2YT1 A;  2DN6 A;  3CXB B;  4HAY B;  1FOE A;  5DHF B;  2R0D A;  3AU4 A;  5D3W A;  4HDQ A;  1ZC4 B;  2ZPY A;  5HE2 A;  3PSC A;  2V76 A;  2COF A;  2GCL A;  1EAZ A;  1NTY A;  5D3Y A;  2P0D A;  1V5P A;  5KQ4 A;  1V5U A;  2L2I A;  3TVV A;  5C79 A;  3QIJ A;  3U8Z A;  4HAU B;  3O96 A;  5EFX A;  5L81 A;  4A6K A;  2D11 A;  4DX9 0;  1P5T A;  2ADZ A;  4L6E A;  1MAI A;  2COA A;  2CY5 A;  4NY0 A;  1DBH A;  1SGH A;  1P6S A;  3T06 A;  2DX1 A;  2VRW B;  2J0K A;  4YL8 A;  4KHA A;  1K5D B;  3KZ1 A;  2QKM A;  1DDV A;  1MIZ B;  2DFK A;  3ZDT A;  1NU2 A;  1PLS A;  3PVL A;  5KQ1 A;  4IAP A;  3FEH A;  4HB0 B;  4GN1 A;  2EC1 A;  1WG7 A;  2COD A;  3GYO A;  4B6H A;  2KCJ A;  3RCP A;  3N7C A;  1W1D A;  5D3X A;  2HE7 A;  3P6A A;  2AEH A;  3U7D A;  3DXC A;  2IFS A;  1WGQ A;  2DYQ A;  3SNH A;  2M38 A;  1IRS A;  4F7G A;  4MT7 A;  4D0N B;  5LON B;  3TO1 A;  1DDW A;  3SV1 A;  2DTC A;  5J3T A;  4K2P A;  4IFS A;  1FB8 A;  2JP2 A;  4KVG B;  2UZS A;  4DX8 A;  2D9Z A;  1X1G A;  2DX5 A;  2YS5 A;  3A8Q A;  2YS1 A;  4HAT B;  2UZR A;  3ML4 A;  4EMO A;  1B55 A;  2YS3 A;  3TFM A;  2J59 M;  2RSG A;  1U5G A;  5GOW B;  2GJY A;  1K5G B;  4CHM A;  1J0W A;  3D8D A;  2Y8G A;  2D9V A;  4K2O A;  3D8E A;  2I1J A;  4Z2M B;  3A98 B;  2DA0 A;  3AU5 A;  2LG1 A;  1RJ2 A;  3HW2 B;  2E2X A;  2RLO A;  2DHI A;  1EVH A;  4F7U P;  3TW1 A;  5CLQ B;  3KRW A;  2QKL A;  2D4Q A;  2VSZ A;  4HAX B;  3PP2 A;  1WGU A;  2GS0 A;  5DH9 B;  1XX0 A;  1PMS A;  1EGX A;  4MY6 A;  1QC6 A;  2FJL A;  3CIK A;  2NMB A;  4WSF A;  2RNR B;  1P3R A;  1V5M A;  1FGZ A;  4YON A;  4ZRI A;  3FSS A;  1PFJ A;  1KZG A;  1RRP B;  5DI9 B;  2LOX A;  1XOD A;  2DKQ A;  5KCV A;  1XR0 B;  2MKR A;  1LB1 A;  3X23 A;  2NZ8 B;  3TCA A;  1LW3 A;  2LYD A;  1BWN A;  2R09 A;  1J19 A;  1ZC3 B;  2GCJ A;  4CHJ A;  2LKO A;  3ZVR A;  4EJN A;  3ULC A;  2BCJ A;  2N23 A;  2ELB A;  2D2Q A;  5HE1 A;  2ROZ B;  5HE3 A;  1U29 A;  1X11 A;  1ZVR A;  1U27 A;  4DBB A;  4HB2 B;  1U5F A;  3KSY A;  2CRF A;  3BJI A;  3VOQ A;  5J3Y A;  5JP4 A;  2AL6 A;  3DXE A;  5JHG A;  3DXD A;  3M1I B;  4K17 A;  3LJU X;  1ZSQ A;  2COC A;  2G35 A;  1I2H A;  2I1K A;  4PQ0 A;  4KHO A;  2D9W A;  3QBV B;  4ZRJ A;  4A6F B;  3WA0 A;  2I5C A;  2K2J A;  4MK0 A;  2Y8F A;  3SYX A;  1Y19 B;  2P8V A;  2L1C A;  2DKP A;  4TKN A;  1TXD A;  4TYZ A;  3WYF B;  4KAX B;  1UNP A;  1FAO A;  3OAN A;  4CYE A;  1OQN A;  2PZ1 A;  2HTH B;  4HAW B;  1V88 A;  3D8F A;  1MPH A;  1W1G A;  5CLL B;  2K00 A;  3PVU A;  1MK7 B;  3PZD A;  3KRX A;  3P7Z A;  3IVF A;  2KUP A;  2VKI A;  2W2X C;  1GC6 A;  1FGY A;  2MFQ A;  5C16 A;  2H7E A;  4NSW A;  5C6R A;  4HB4 B;  4EKU A;  3ODO A;  4F7H A;  1Z87 A;  4XWX A;  1BAK A;  3UZT A;  1X1F A;  1V89 A;  4HAZ B;  1AWE A;  2W2X D;  1GC7 A;  2D10 A;  1Y5O A;  5C5B B;  2N0Y A;  3GYP A;  4ZRK A;  4Y94 A;  1WJM A;  3HQC A;  4GMV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...