3DXEA

Crystal structure of the intracellular domain of human app (t668a mutant) in complex with fe65-ptb2
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
124
structure length
124
Chain Sequence
FQVYYLGNVPVAKPVGVDVINGALESVLSSSSREQWTPSHVSVAPATLTILHQQTEAVLGECRVRFLSFLAVGRDVHTFAFIMAAGPASFCCHMFWCEPNAASLSEAVQAACMLRYQKCLDARS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Amyloid beta A4 protein-binding family B member 1
publication title Structure of the intracellular domain of the amyloid precursor protein in complex with Fe65-PTB2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 36
structure length 124
sequence length 124
chains with identical sequence C
ec nomenclature
pdb deposition date 2008-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00640 PID Phosphotyrosine interaction domain (PTB/PID)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3dxeA00
5CLLB 2D11A 3AU4A 1DROA 2RNRB 2LG1A 1MIXA 5GOWB 4KAXB 2P0FA 1ZM0A 3DXEA 1BTKA 1ZVRA 2DN6A 5HE2A 1FAOA 5FI1A 1XKEA 5JLJB 1I2HA 2UZSA 2LYDA 2ELBA 1I7AA 1J19A 2W2XD 1MIZB 2KCJA 1NTVA 1WGQA 3PSCA 1DDWA 2R0DA 4A6FB 5J3TA 4PNKA 1U27A 3BJIA 2COAA 2RLOA 5J3QA 3BINA 5C79A 2DFKA 2COCA 2COFA 5FI0A 1FHOA 2PZ1A 4HB3B 4F7HA 1FGYA 3KRWA 5D3VA 3SNHA 3F0WA 1W1HA 3FEHA 2MDXA 4HAUB 3KRXA 5KQ1A 4CHMA 3GYPA 2VSZA 1OY2A 4IOYX 2CRFA 2J0MA 5D3XA 1LB1A 5C6RA 1XODA 4NSWA 5HE3A 4DXAB 3ODOA 1V61A 1Q67A 2HE7A 4YONA 1MKEA 2CY4A 1FGZA 4IFSA 3KZ1A 3TO1A 2Z0QA 1X1FA 2DHJA 3M1IB 3ODXA 2K2UA 1DDMA 2YT1A 1NI2A 1Z87A 2Y7BA 3SO6A 5EFXA 3QIJA 2YS1A 3X23A 2YS5A 2CY5A 4HB4B 2EJ8A 1WGUA 1FHXA 2OQBA 4A6HA 5JP4A 2X18A 1BWNA 4HDOA 2V76A 1K5GB 1WVHA 4CYEA 3SV1A 1MAIA 3V5WA 3RCPA 4F7UP 1SHCA 2DX5A 2BCJA 4C0AA 3DXCA 1DYNA 2ZPYA 5HE0A 1TJ6A 2JP2A 2GJYA 2RUKB 3O96A 4Z2MB 4PQ0A 5DHAB 1ISNA 4GN1A 3PG7A 2H7EA 1U5EA 1Y5OA 1AWEA 1M7EA 2QKLA 3FM8C 3U8ZA 1GC6A 2CAYA 3P7ZA 1XX0A 3FSSA 1BTNA 2YS3A 3NSUA 2LOXA 4EMOA 1X05A 2GCJA 2QKMA 4P7IA 2RSGA 4WSFA 2YVCA 2AEHA 2L2IA 2YT0A 5J3YA 1P5TA 1DBHA 3TW1A 3KSYA 1PMSA 1ZSQA 4NY0A 1PLSA 4GMVA 3MDBC 5D3WA 1U2BA 5HE1A 5L81A 5DH9B 4HAXB 4HAWB 2RVBB 1V5PA 5LOPB 2GS0A 5C5BB 3WA0A 1DDVA 2ROVA 1V5UA 3GYOA 2YRYA 5DI9B 2M38A 1UPQA 4F7GA 4DX8A 2J0JA 3D8EA 5JHGA 3HW2B 5D27A 2GCLA 1UNPA 2W2XC 3F5RA 3TFMA 3SYXA 1WJMA 2MFQA 4YL8A 3HK0A 1GC7A 2P0HA 4GXBA 1EF1A 2VKIA 2Q13A 2YF0A 2KUPA 3IVFA 2H7DA 4K2PA 3ZVRA 5CLQB 4A6FA 3T06A 4HAZB 2P0DA 5KCVA 2I1KA 1XD4A 1ZC3B 3OANA 4KVGB 2EC1A 1P3RA 2N23A 3VIAA 4EKUA 1U5GA 4HAVB 2EMSA 1WG7A 2RGNB 4IAPA 5DHFB 3PEGA 1MPHA 2P8VA 3DXDA 3A8PA 2DHIA 4WJ7A 4MY6A 2YSZA 4MT7A 2OTXA 1W1GA 1BAKA 2R09A 2LULA 3N7CA 1MK9B 3HQCA 4D0NB 2ADZA 1QC6A 4A5KA 3SUZA 2D9WA 4KHOA 1LW3A 1UPRA 1KI1B 1FB8A 4ZRKA 3ZDTA 3PP2A 3VOQA 2DA0A 1W1DA 3WYFB 1H4RA 1V89A 2W2WA 4GPTB 1K5DB 2M14A 2D4QA 2DTCA 2KGXB 4XWXA 2DKQA 2L1CA 1TXDA 2DKPA 2Y8FA 2D9YA 4ZRIA 2UZRA 4GMXB 4CHJA 1X1GA 3P6AA 3CXBB 5JHHA 1KZGA 1P6SA 3CIKA 2ROZB 1U5FA 2AL6A 1WJ1A 4Z2NA 5D3YA 1AQCA 4HAYB 3G9WA 3ULCA 2N0YA 2HTHB 4KHAA 4GZUA 1E5WA 1FHWA 4HDQA 1RRPB 1NTYA 2FJLA 2Z0OA 4K81A 2DYQA 3ULBA 1NU2A 1V5MA 1X11A 2MWNB 3D8FA 4B6HA 4ZRJA 4BBKA 3ODWA 3D8DA 1KZ7A 2Y8GA 4HB0B 2NZ8B 1OQNA 2IYBA 2NMBA 3AJ4A 2XQNM 1EVHA 4DBBA 2I1JA 2IFSA 1M7RA 1B55A 4MK0A 2D9ZA 4DX90 3AU5A 3TCAA 3UZTA 1IRSA 1UNRA 2CODA 1WI1A 2EMTA 1PFJA 3A98B 4Y94A 4EJNA 5DIFB 1EAZA 1Y19B 2UVMA 1GG3A 1OMWA 2I5CA 3A8QA 3PVLA 2LKOA 3KY9A 5C5BA 3MPXA 1V88A 5KQ4A 2DLWA 1UNQA 4TKNA 1H10A 2E2XA 1SGHA 4HB2B 1RJ2A 1J0WA 3QWMA 2J59M 2G35A 2VRWB 4HHVA 3PZDA 1MK7B 2ELAA 3ML4A 3PVWA 4K17A 4A6KA 2DHKA 2J0KA 1FOEA 3LJUX 2D9VA 2D2QA 2I5FA 2LOZA 2DX1A 1U29A 3PVUA 1TQZA 1U5DA 2Z0PA 2D10A 4H8SA 4WVFB 1X86A 4HATB 4L6EA 5C16A 2D9XA 1QQGA 3QBVB 1N3HA 1ZC4B 4K2OA 2MKRA 1UEFA 4KHBB 1EGXA 2K2JA 2DYNA 1XCGA 3TVVA 2K00A 5LONB 3U7DA 1XR0B 4TYZA
chains in the Genus database with same CATH superfamily
5CLLB 2D11A 3AU4A 1DROA 2RNRB 2LG1A 1MIXA 2YT2A 5GOWB 4KAXB 2P0FA 1ZM0A 3DXEA 1BTKA 1ZVRA 2DN6A 5HE2A 4OT1A 1FAOA 5FI1A 1XKEA 5JLJB 1I2HA 2UZSA 2LYDA 2ELBA 1I7AA 1J19A 2W2XD 1MIZB 2KCJA 1NTVA 1T77A 1WGQA 3PSCA 1DDWA 2R0DA 4A6FB 2KIGA 5J3TA 4CSQA 4PNKA 1U27A 3BJIA 2COAA 2RLOA 5J3QA 3BINA 5C79A 2DFKA 2COCA 2COFA 5FI0A 1FHOA 2PZ1A 5IRSA 4HB3B 4F7HA 1FGYA 3KRWA 5D3VA 3SNHA 3F0WA 1W1HA 3FEHA 2MDXA 4HAUB 3KRXA 5KQ1A 4L1RA 4CHMA 3GYPA 2Z59A 2VSZA 1OY2A 4IOYX 2CRFA 2J0MA 5D3XA 1LB1A 5C6RA 1XODA 4NSWA 5HE3A 4DXAB 3ODOA 1V61A 1Q67A 2HE7A 4YONA 1MKEA 2CY4A 1FGZA 4IFSA 3KZ1A 3TO1A 2Z0QA 1MI1A 1X1FA 2DHJA 3M1IB 3ODXA 2K2UA 5M4YB 1DDMA 2YT1A 1NI2A 1Z87A 2Y7BA 3SO6A 5EFXA 3QIJA 2YS1A 4GOUA 3X23A 2YS5A 2CY5A 4HB4B 2EJ8A 1WGUA 1FHXA 2OQBA 4A6HA 5JP4A 2X18A 1BWNA 4HDOA 2V76A 1K5GB 1WVHA 4CYEA 3SV1A 1MAIA 3V5WA 3RCPA 4F7UP 1SHCA 2DX5A 2BCJA 4C0AA 2GUMA 3DXCA 3HSAA 1DYNA 2ZPYA 5HE0A 1TJ6A 2JP2A 2GJYA 2RUKB 2FJUB 3B77A 3O96A 4Z2MB 4PQ0A 5DHAB 1ISNA 4GN1A 3PG7A 2H7EA 1U5EA 1Y5OA 1AWEA 1M7EA 2QKLA 3FM8C 3U8ZA 1GC6A 2CAYA 3FSSA 1XX0A 3P7ZA 1BTNA 2KR0A 2YS3A 3NSUA 2K8EA 2LOXA 4EMOA 1X05A 2GCJA 2QKMA 4P7IA 2RSGA 4WSFA 2YVCA 4QJ5B 2AEHA 2L2IA 4OSNA 5I2MA 2YT0A 5J3YA 2K49A 1P5TA 1DBHA 3TW1A 3KSYA 1PMSA 1ZSQA 4NY0A 1PLSA 4GMVA 3MDBC 5D3WA 1U2BA 5HE1A 5L81A 5DH9B 4HAXB 4HAWB 2RVBB 3NWAA 5I2SA 4DIXA 1V5PA 5LOPB 2GS0A 3U12A 5C5BB 3WA0A 1DDVA 2ROVA 4QJ4B 1V5UA 3GYOA 2YRYA 5DI9B 2M38A 1UPQA 4F7GA 4DX8A 2J0JA 3D8EA 5JHGA 2Z4DA 3NWFA 3HW2B 5D27A 2GCLA 1UNPA 2W2XC 5LG4B 3F5RA 3TFMA 3SYXA 4D6WA 1WJMA 4QXAB 2MFQA 4YL8A 3HK0A 1GC7A 2P0HA 2Z14A 4GXBA 1EF1A 2VKIA 2R2YA 2Q13A 2YF0A 2KUPA 3IVFA 2H7DA 4K2PA 3DCXA 3ZVRA 5CLQB 4A6FA 3T06A 4HAZB 2P0DA 5KCVA 2I1KA 1XD4A 1ZC3B 3OANA 4KVGB 2EC1A 2ZKMX 1P3RA 2KUQA 2N23A 3OHMB 3VIAA 4EKUA 1U5GA 4HAVB 2EMSA 1WG7A 2RGNB 4IAPA 5DHFB 3PEGA 1MPHA 2P8VA 3DXDA 3A8PA 2DHIA 4QJ3B 4WJ7A 4MY6A 2YSZA 4MT7A 2OTXA 1W1GA 1BAKA 2R09A 2LULA 3N7CA 1MK9B 3HQCA 4D0NB 2ADZA 1QC6A 4A5KA 3SUZA 2D9WA 4KHOA 1LW3A 1UPRA 1KI1B 1FB8A 4ZRKA 3ZDTA 4HSIA 3PP2A 3VOQA 2DA0A 1W1DA 3WYFB 1H4RA 1V89A 2W2WA 2KIEA 4GPTB 1K5DB 2M14A 2D4QA 2DTCA 2KGXB 4XWXA 2DKQA 2L1CA 1TXDA 2DKPA 2Y8FA 2D9YA 4ZRIA 2UZRA 4GMXB 4CHJA 1X1GA 3P6AA 1ZYIA 3CXBB 5JHHA 1KZGA 1P6SA 3CIKA 2ROZB 1U5FA 2AL6A 1WJ1A 4Z2NA 5D3YA 1AQCA 4HAYB 3G9WA 3ULCA 2N0YA 2HTHB 4KHAA 4GZUA 1E5WA 1FHWA 4HDQA 1RRPB 1NTYA 2FJLA 2Z0OA 3NWDA 4K81A 2DYQA 3ULBA 1NU2A 1V5MA 1X11A 2MWNB 3D8FA 4B6HA 4ZRJA 4BBKA 3ODWA 3D8DA 4KHBA 1KZ7A 2Y8GA 4HB0B 2NZ8B 1OQNA 2IYBA 2NMBA 3AJ4A 3FVCA 2XQNM 1EVHA 4DBBA 2I1JA 2IFSA 1M7RA 1B55A 3A58A 4MK0A 2D9ZA 4DX90 3AU5A 3TCAA 3UZTA 1IRSA 1UNRA 2Z13A 2CODA 1WI1A 2EMTA 3HIEA 3NW8A 1PFJA 3A98B 4Y94A 4EJNA 5DIFB 1EAZA 1Y19B 2UVMA 1GG3A 1OMWA 2I5CA 3A8QA 3PVLA 2LKOA 3KY9A 5C5BA 3MPXA 1V88A 5KQ4A 2DLWA 1UNQA 4TKNA 1H10A 2E2XA 1SGHA 4HB2B 1RJ2A 1J0WA 3QWMA 2J59M 2G35A 2VRWB 4HHVA 3PZDA 1MK7B 2ELAA 3ML4A 2RRFA 3PVWA 2NBVA 4K17A 4A6KA 2DHKA 2J0KA 1FOEA 3LJUX 2D9VA 2D2QA 2I5FA 2LOZA 2DX1A 1U29A 3PVUA 1TQZA 1U5DA 2Z0PA 2D10A 4H8SA 4GNKB 4WVFB 1X86A 4HATB 4L6EA 5C16A 2D9XA 1QQGA 3QBVB 1N3HA 1ZC4B 4K2OA 2MKRA 1UEFA 4KHBB 1EGXA 2K2JA 2DYNA 1XCGA 3TVVA 2K00A 5LONB 3U7DA 1XR0B 4TYZA
chains in the Genus database with same CATH topology
5CLLB 2D11A 3AU4A 1DROA 2RNRB 2LG1A 1MIXA 5GOWB 4KAXB 2P0FA 1ZM0A 3DXEA 1BTKA 1ZVRA 2DN6A 5HE2A 1FAOA 5FI1A 1XKEA 5JLJB 1I2HA 2UZSA 2LYDA 2ELBA 1I7AA 1J19A 2W2XD 1MIZB 2KCJA 1NTVA 1WGQA 3PSCA 1DDWA 2R0DA 4A6FB 5J3TA 4PNKA 1U27A 3BJIA 2COAA 2RLOA 5J3QA 3BINA 5C79A 2DFKA 2COCA 2COFA 5FI0A 1FHOA 2PZ1A 4HB3B 4F7HA 1FGYA 3KRWA 5D3VA 3SNHA 3F0WA 1W1HA 3FEHA 2MDXA 4HAUB 3KRXA 5KQ1A 4CHMA 3GYPA 2VSZA 1OY2A 4IOYX 2CRFA 2J0MA 5D3XA 1LB1A 5C6RA 1XODA 4NSWA 5HE3A 4DXAB 3ODOA 1V61A 1Q67A 2HE7A 4YONA 1MKEA 2CY4A 1FGZA 4IFSA 3KZ1A 3TO1A 2Z0QA 1X1FA 2DHJA 3M1IB 3ODXA 2K2UA 1DDMA 2YT1A 1NI2A 1Z87A 2Y7BA 3SO6A 5EFXA 3QIJA 2YS1A 3X23A 2YS5A 2CY5A 4HB4B 2EJ8A 1WGUA 1FHXA 2OQBA 4A6HA 5JP4A 2X18A 1BWNA 4HDOA 2V76A 1K5GB 1WVHA 4CYEA 3SV1A 1MAIA 3V5WA 3RCPA 4F7UP 1SHCA 2DX5A 2BCJA 4C0AA 3DXCA 1DYNA 2ZPYA 5HE0A 1TJ6A 2JP2A 2GJYA 2RUKB 3O96A 4Z2MB 4PQ0A 5DHAB 1ISNA 4GN1A 3PG7A 2H7EA 1U5EA 1Y5OA 1AWEA 1M7EA 2QKLA 3FM8C 3U8ZA 1GC6A 2CAYA 3P7ZA 1XX0A 3FSSA 1BTNA 2YS3A 3NSUA 2LOXA 4EMOA 1X05A 2GCJA 2QKMA 4P7IA 2RSGA 4WSFA 2YVCA 2AEHA 2L2IA 2YT0A 5J3YA 1P5TA 1DBHA 3TW1A 3KSYA 1PMSA 1ZSQA 4NY0A 1PLSA 4GMVA 3MDBC 5D3WA 1U2BA 5HE1A 5L81A 5DH9B 4HAXB 4HAWB 2RVBB 1V5PA 5LOPB 2GS0A 5C5BB 3WA0A 1DDVA 2ROVA 1V5UA 3GYOA 2YRYA 5DI9B 2M38A 1UPQA 4F7GA 4DX8A 2J0JA 3D8EA 5JHGA 3HW2B 5D27A 2GCLA 1UNPA 2W2XC 3F5RA 3TFMA 3SYXA 1WJMA 2MFQA 4YL8A 3HK0A 1GC7A 2P0HA 4GXBA 1EF1A 2VKIA 2Q13A 2YF0A 2KUPA 3IVFA 2H7DA 4K2PA 3ZVRA 5CLQB 4A6FA 3T06A 4HAZB 2P0DA 5KCVA 2I1KA 1XD4A 1ZC3B 3OANA 4KVGB 2EC1A 1P3RA 2N23A 3VIAA 4EKUA 1U5GA 4HAVB 2EMSA 1WG7A 2RGNB 4IAPA 5DHFB 3PEGA 1MPHA 2P8VA 3DXDA 3A8PA 2DHIA 4WJ7A 4MY6A 2YSZA 4MT7A 2OTXA 1W1GA 1BAKA 2R09A 2LULA 3N7CA 1MK9B 3HQCA 4D0NB 2ADZA 1QC6A 4A5KA 3SUZA 2D9WA 4KHOA 1LW3A 1UPRA 1KI1B 1FB8A 4ZRKA 3ZDTA 3PP2A 3VOQA 2DA0A 1W1DA 3WYFB 1H4RA 1V89A 2W2WA 4GPTB 1K5DB 2M14A 2D4QA 2DTCA 2KGXB 4XWXA 2DKQA 2L1CA 1TXDA 2DKPA 2Y8FA 2D9YA 4ZRIA 2UZRA 4GMXB 4CHJA 1X1GA 3P6AA 3CXBB 5JHHA 1KZGA 1P6SA 3CIKA 2ROZB 1U5FA 2AL6A 1WJ1A 4Z2NA 5D3YA 1AQCA 4HAYB 3G9WA 3ULCA 2N0YA 2HTHB 4KHAA 4GZUA 1E5WA 1FHWA 4HDQA 1RRPB 1NTYA 2FJLA 2Z0OA 4K81A 2DYQA 3ULBA 1NU2A 1V5MA 1X11A 2MWNB 3D8FA 4B6HA 4ZRJA 4BBKA 3ODWA 3D8DA 1KZ7A 2Y8GA 4HB0B 2NZ8B 1OQNA 2IYBA 2NMBA 3AJ4A 2XQNM 1EVHA 4DBBA 2I1JA 2IFSA 1M7RA 1B55A 4MK0A 2D9ZA 4DX90 3AU5A 3TCAA 3UZTA 1IRSA 1UNRA 2CODA 1WI1A 2EMTA 1PFJA 3A98B 4Y94A 4EJNA 5DIFB 1EAZA 1Y19B 2UVMA 1GG3A 1OMWA 2I5CA 3A8QA 3PVLA 2LKOA 3KY9A 5C5BA 3MPXA 1V88A 5KQ4A 2DLWA 1UNQA 4TKNA 1H10A 2E2XA 1SGHA 4HB2B 1RJ2A 1J0WA 3QWMA 2J59M 2G35A 2VRWB 4HHVA 3PZDA 1MK7B 2ELAA 3ML4A 3PVWA 4K17A 4A6KA 2DHKA 2J0KA 1FOEA 3LJUX 2D9VA 2D2QA 2I5FA 2LOZA 2DX1A 1U29A 3PVUA 1TQZA 1U5DA 2Z0PA 2D10A 4H8SA 4WVFB 1X86A 4HATB 4L6EA 5C16A 2D9XA 1QQGA 3QBVB 1N3HA 1ZC4B 4K2OA 2MKRA 1UEFA 4KHBB 1EGXA 2K2JA 2DYNA 1XCGA 3TVVA 2K00A 5LONB 3U7DA 1XR0B 4TYZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CLL B;  2D11 A;  3AU4 A;  1DRO A;  2RNR B;  2LG1 A;  1MIX A;  5GOW B;  4KAX B;  2P0F A;  1ZM0 A;  3DXE A;  1BTK A;  1ZVR A;  2DN6 A;  5HE2 A;  1FAO A;  5FI1 A;  1XKE A;  5JLJ B;  1I2H A;  2UZS A;  2LYD A;  2ELB A;  1I7A A;  1J19 A;  2W2X D;  1MIZ B;  2KCJ A;  1NTV A;  1WGQ A;  3PSC A;  1DDW A;  2R0D A;  4A6F B;  5J3T A;  4PNK A;  1U27 A;  3BJI A;  2COA A;  2RLO A;  5J3Q A;  3BIN A;  5C79 A;  2DFK A;  2COC A;  2COF A;  5FI0 A;  1FHO A;  2PZ1 A;  4HB3 B;  4F7H A;  1FGY A;  3KRW A;  5D3V A;  3SNH A;  3F0W A;  1W1H A;  3FEH A;  2MDX A;  4HAU B;  3KRX A;  5KQ1 A;  4CHM A;  3GYP A;  2VSZ A;  1OY2 A;  4IOY X;  2CRF A;  2J0M A;  5D3X A;  1LB1 A;  5C6R A;  1XOD A;  4NSW A;  5HE3 A;  4DXA B;  3ODO A;  1V61 A;  1Q67 A;  2HE7 A;  4YON A;  1MKE A;  2CY4 A;  1FGZ A;  4IFS A;  3KZ1 A;  3TO1 A;  2Z0Q A;  1X1F A;  2DHJ A;  3M1I B;  3ODX A;  2K2U A;  1DDM A;  2YT1 A;  1NI2 A;  1Z87 A;  2Y7B A;  3SO6 A;  5EFX A;  3QIJ A;  2YS1 A;  3X23 A;  2YS5 A;  2CY5 A;  4HB4 B;  2EJ8 A;  1WGU A;  1FHX A;  2OQB A;  4A6H A;  5JP4 A;  2X18 A;  1BWN A;  4HDO A;  2V76 A;  1K5G B;  1WVH A;  4CYE A;  3SV1 A;  1MAI A;  3V5W A;  3RCP A;  4F7U P;  1SHC A;  2DX5 A;  2BCJ A;  4C0A A;  3DXC A;  1DYN A;  2ZPY A;  5HE0 A;  1TJ6 A;  2JP2 A;  2GJY A;  2RUK B;  3O96 A;  4Z2M B;  4PQ0 A;  5DHA B;  1ISN A;  4GN1 A;  3PG7 A;  2H7E A;  1U5E A;  1Y5O A;  1AWE A;  1M7E A;  2QKL A;  3FM8 C;  3U8Z A;  1GC6 A;  2CAY A;  3P7Z A;  1XX0 A;  3FSS A;  1BTN A;  2YS3 A;  3NSU A;  2LOX A;  4EMO A;  1X05 A;  2GCJ A;  2QKM A;  4P7I A;  2RSG A;  4WSF A;  2YVC A;  2AEH A;  2L2I A;  2YT0 A;  5J3Y A;  1P5T A;  1DBH A;  3TW1 A;  3KSY A;  1PMS A;  1ZSQ A;  4NY0 A;  1PLS A;  4GMV A;  3MDB C;  5D3W A;  1U2B A;  5HE1 A;  5L81 A;  5DH9 B;  4HAX B;  4HAW B;  2RVB B;  1V5P A;  5LOP B;  2GS0 A;  5C5B B;  3WA0 A;  1DDV A;  2ROV A;  1V5U A;  3GYO A;  2YRY A;  5DI9 B;  2M38 A;  1UPQ A;  4F7G A;  4DX8 A;  2J0J A;  3D8E A;  5JHG A;  3HW2 B;  5D27 A;  2GCL A;  1UNP A;  2W2X C;  3F5R A;  3TFM A;  3SYX A;  1WJM A;  2MFQ A;  4YL8 A;  3HK0 A;  1GC7 A;  2P0H A;  4GXB A;  1EF1 A;  2VKI A;  2Q13 A;  2YF0 A;  2KUP A;  3IVF A;  2H7D A;  4K2P A;  3ZVR A;  5CLQ B;  4A6F A;  3T06 A;  4HAZ B;  2P0D A;  5KCV A;  2I1K A;  1XD4 A;  1ZC3 B;  3OAN A;  4KVG B;  2EC1 A;  1P3R A;  2N23 A;  3VIA A;  4EKU A;  1U5G A;  4HAV B;  2EMS A;  1WG7 A;  2RGN B;  4IAP A;  5DHF B;  3PEG A;  1MPH A;  2P8V A;  3DXD A;  3A8P A;  2DHI A;  4WJ7 A;  4MY6 A;  2YSZ A;  4MT7 A;  2OTX A;  1W1G A;  1BAK A;  2R09 A;  2LUL A;  3N7C A;  1MK9 B;  3HQC A;  4D0N B;  2ADZ A;  1QC6 A;  4A5K A;  3SUZ A;  2D9W A;  4KHO A;  1LW3 A;  1UPR A;  1KI1 B;  1FB8 A;  4ZRK A;  3ZDT A;  3PP2 A;  3VOQ A;  2DA0 A;  1W1D A;  3WYF B;  1H4R A;  1V89 A;  2W2W A;  4GPT B;  1K5D B;  2M14 A;  2D4Q A;  2DTC A;  2KGX B;  4XWX A;  2DKQ A;  2L1C A;  1TXD A;  2DKP A;  2Y8F A;  2D9Y A;  4ZRI A;  2UZR A;  4GMX B;  4CHJ A;  1X1G A;  3P6A A;  3CXB B;  5JHH A;  1KZG A;  1P6S A;  3CIK A;  2ROZ B;  1U5F A;  2AL6 A;  1WJ1 A;  4Z2N A;  5D3Y A;  1AQC A;  4HAY B;  3G9W A;  3ULC A;  2N0Y A;  2HTH B;  4KHA A;  4GZU A;  1E5W A;  1FHW A;  4HDQ A;  1RRP B;  1NTY A;  2FJL A;  2Z0O A;  4K81 A;  2DYQ A;  3ULB A;  1NU2 A;  1V5M A;  1X11 A;  2MWN B;  3D8F A;  4B6H A;  4ZRJ A;  4BBK A;  3ODW A;  3D8D A;  1KZ7 A;  2Y8G A;  4HB0 B;  2NZ8 B;  1OQN A;  2IYB A;  2NMB A;  3AJ4 A;  2XQN M;  1EVH A;  4DBB A;  2I1J A;  2IFS A;  1M7R A;  1B55 A;  4MK0 A;  2D9Z A;  4DX9 0;  3AU5 A;  3TCA A;  3UZT A;  1IRS A;  1UNR A;  2COD A;  1WI1 A;  2EMT A;  1PFJ A;  3A98 B;  4Y94 A;  4EJN A;  5DIF B;  1EAZ A;  1Y19 B;  2UVM A;  1GG3 A;  1OMW A;  2I5C A;  3A8Q A;  3PVL A;  2LKO A;  3KY9 A;  5C5B A;  3MPX A;  1V88 A;  5KQ4 A;  2DLW A;  1UNQ A;  4TKN A;  1H10 A;  2E2X A;  1SGH A;  4HB2 B;  1RJ2 A;  1J0W A;  3QWM A;  2J59 M;  2G35 A;  2VRW B;  4HHV A;  3PZD A;  1MK7 B;  2ELA A;  3ML4 A;  3PVW A;  4K17 A;  4A6K A;  2DHK A;  2J0K A;  1FOE A;  3LJU X;  2D9V A;  2D2Q A;  2I5F A;  2LOZ A;  2DX1 A;  1U29 A;  3PVU A;  1TQZ A;  1U5D A;  2Z0P A;  2D10 A;  4H8S A;  4WVF B;  1X86 A;  4HAT B;  4L6E A;  5C16 A;  2D9X A;  1QQG A;  3QBV B;  1N3H A;  1ZC4 B;  4K2O A;  2MKR A;  1UEF A;  4KHB B;  1EGX A;  2K2J A;  2DYN A;  1XCG A;  3TVV A;  2K00 A;  5LON B;  3U7D A;  1XR0 B;  4TYZ A; 
#chains in the Genus database with same CATH topology
 5CLL B;  2D11 A;  3AU4 A;  1DRO A;  2RNR B;  2LG1 A;  1MIX A;  2YT2 A;  5GOW B;  4KAX B;  2P0F A;  1ZM0 A;  3DXE A;  1BTK A;  1ZVR A;  2DN6 A;  5HE2 A;  4OT1 A;  1FAO A;  5FI1 A;  1XKE A;  5JLJ B;  1I2H A;  2UZS A;  2LYD A;  2ELB A;  1I7A A;  1J19 A;  2W2X D;  1MIZ B;  2KCJ A;  1NTV A;  1T77 A;  1WGQ A;  3PSC A;  1DDW A;  2R0D A;  4A6F B;  2KIG A;  5J3T A;  4CSQ A;  4PNK A;  1U27 A;  3BJI A;  2COA A;  2RLO A;  5J3Q A;  3BIN A;  5C79 A;  2DFK A;  2COC A;  2COF A;  5FI0 A;  1FHO A;  2PZ1 A;  5IRS A;  4HB3 B;  4F7H A;  1FGY A;  3KRW A;  5D3V A;  3SNH A;  3F0W A;  1W1H A;  3FEH A;  2MDX A;  4HAU B;  3KRX A;  5KQ1 A;  4L1R A;  4CHM A;  3GYP A;  2Z59 A;  2VSZ A;  1OY2 A;  4IOY X;  2CRF A;  2J0M A;  5D3X A;  1LB1 A;  5C6R A;  1XOD A;  4NSW A;  5HE3 A;  4DXA B;  3ODO A;  1V61 A;  1Q67 A;  2HE7 A;  4YON A;  1MKE A;  2CY4 A;  1FGZ A;  4IFS A;  3KZ1 A;  3TO1 A;  2Z0Q A;  1MI1 A;  1X1F A;  2DHJ A;  3M1I B;  3ODX A;  2K2U A;  5M4Y B;  1DDM A;  2YT1 A;  1NI2 A;  1Z87 A;  2Y7B A;  3SO6 A;  5EFX A;  3QIJ A;  2YS1 A;  4GOU A;  3X23 A;  2YS5 A;  2CY5 A;  4HB4 B;  2EJ8 A;  1WGU A;  1FHX A;  2OQB A;  4A6H A;  5JP4 A;  2X18 A;  1BWN A;  4HDO A;  2V76 A;  1K5G B;  1WVH A;  4CYE A;  3SV1 A;  1MAI A;  3V5W A;  3RCP A;  4F7U P;  1SHC A;  2DX5 A;  2BCJ A;  4C0A A;  2GUM A;  3DXC A;  3HSA A;  1DYN A;  2ZPY A;  5HE0 A;  1TJ6 A;  2JP2 A;  2GJY A;  2RUK B;  2FJU B;  3B77 A;  3O96 A;  4Z2M B;  4PQ0 A;  5DHA B;  1ISN A;  4GN1 A;  3PG7 A;  2H7E A;  1U5E A;  1Y5O A;  1AWE A;  1M7E A;  2QKL A;  3FM8 C;  3U8Z A;  1GC6 A;  2CAY A;  3FSS A;  1XX0 A;  3P7Z A;  1BTN A;  2KR0 A;  2YS3 A;  3NSU A;  2K8E A;  2LOX A;  4EMO A;  1X05 A;  2GCJ A;  2QKM A;  4P7I A;  2RSG A;  4WSF A;  2YVC A;  4QJ5 B;  2AEH A;  2L2I A;  4OSN A;  5I2M A;  2YT0 A;  5J3Y A;  2K49 A;  1P5T A;  1DBH A;  3TW1 A;  3KSY A;  1PMS A;  1ZSQ A;  4NY0 A;  1PLS A;  4GMV A;  3MDB C;  5D3W A;  1U2B A;  5HE1 A;  5L81 A;  5DH9 B;  4HAX B;  4HAW B;  2RVB B;  3NWA A;  5I2S A;  4DIX A;  1V5P A;  5LOP B;  2GS0 A;  3U12 A;  5C5B B;  3WA0 A;  1DDV A;  2ROV A;  4QJ4 B;  1V5U A;  3GYO A;  2YRY A;  5DI9 B;  2M38 A;  1UPQ A;  4F7G A;  4DX8 A;  2J0J A;  3D8E A;  5JHG A;  2Z4D A;  3NWF A;  3HW2 B;  5D27 A;  2GCL A;  1UNP A;  2W2X C;  5LG4 B;  3F5R A;  3TFM A;  3SYX A;  4D6W A;  1WJM A;  4QXA B;  2MFQ A;  4YL8 A;  3HK0 A;  1GC7 A;  2P0H A;  2Z14 A;  4GXB A;  1EF1 A;  2VKI A;  2R2Y A;  2Q13 A;  2YF0 A;  2KUP A;  3IVF A;  2H7D A;  4K2P A;  3DCX A;  3ZVR A;  5CLQ B;  4A6F A;  3T06 A;  4HAZ B;  2P0D A;  5KCV A;  2I1K A;  1XD4 A;  1ZC3 B;  3OAN A;  4KVG B;  2EC1 A;  2ZKM X;  1P3R A;  2KUQ A;  2N23 A;  3OHM B;  3VIA A;  4EKU A;  1U5G A;  4HAV B;  2EMS A;  1WG7 A;  2RGN B;  4IAP A;  5DHF B;  3PEG A;  1MPH A;  2P8V A;  3DXD A;  3A8P A;  2DHI A;  4QJ3 B;  4WJ7 A;  4MY6 A;  2YSZ A;  4MT7 A;  2OTX A;  1W1G A;  1BAK A;  2R09 A;  2LUL A;  3N7C A;  1MK9 B;  3HQC A;  4D0N B;  2ADZ A;  1QC6 A;  4A5K A;  3SUZ A;  2D9W A;  4KHO A;  1LW3 A;  1UPR A;  1KI1 B;  1FB8 A;  4ZRK A;  3ZDT A;  4HSI A;  3PP2 A;  3VOQ A;  2DA0 A;  1W1D A;  3WYF B;  1H4R A;  1V89 A;  2W2W A;  2KIE A;  4GPT B;  1K5D B;  2M14 A;  2D4Q A;  2DTC A;  2KGX B;  4XWX A;  2DKQ A;  2L1C A;  1TXD A;  2DKP A;  2Y8F A;  2D9Y A;  4ZRI A;  2UZR A;  4GMX B;  4CHJ A;  1X1G A;  3P6A A;  1ZYI A;  3CXB B;  5JHH A;  1KZG A;  1P6S A;  3CIK A;  2ROZ B;  1U5F A;  2AL6 A;  1WJ1 A;  4Z2N A;  5D3Y A;  1AQC A;  4HAY B;  3G9W A;  3ULC A;  2N0Y A;  2HTH B;  4KHA A;  4GZU A;  1E5W A;  1FHW A;  4HDQ A;  1RRP B;  1NTY A;  2FJL A;  2Z0O A;  3NWD A;  4K81 A;  2DYQ A;  3ULB A;  1NU2 A;  1V5M A;  1X11 A;  2MWN B;  3D8F A;  4B6H A;  4ZRJ A;  4BBK A;  3ODW A;  3D8D A;  4KHB A;  1KZ7 A;  2Y8G A;  4HB0 B;  2NZ8 B;  1OQN A;  2IYB A;  2NMB A;  3AJ4 A;  3FVC A;  2XQN M;  1EVH A;  4DBB A;  2I1J A;  2IFS A;  1M7R A;  1B55 A;  3A58 A;  4MK0 A;  2D9Z A;  4DX9 0;  3AU5 A;  3TCA A;  3UZT A;  1IRS A;  1UNR A;  2Z13 A;  2COD A;  1WI1 A;  2EMT A;  3HIE A;  3NW8 A;  1PFJ A;  3A98 B;  4Y94 A;  4EJN A;  5DIF B;  1EAZ A;  1Y19 B;  2UVM A;  1GG3 A;  1OMW A;  2I5C A;  3A8Q A;  3PVL A;  2LKO A;  3KY9 A;  5C5B A;  3MPX A;  1V88 A;  5KQ4 A;  2DLW A;  1UNQ A;  4TKN A;  1H10 A;  2E2X A;  1SGH A;  4HB2 B;  1RJ2 A;  1J0W A;  3QWM A;  2J59 M;  2G35 A;  2VRW B;  4HHV A;  3PZD A;  1MK7 B;  2ELA A;  3ML4 A;  2RRF A;  3PVW A;  2NBV A;  4K17 A;  4A6K A;  2DHK A;  2J0K A;  1FOE A;  3LJU X;  2D9V A;  2D2Q A;  2I5F A;  2LOZ A;  2DX1 A;  1U29 A;  3PVU A;  1TQZ A;  1U5D A;  2Z0P A;  2D10 A;  4H8S A;  4GNK B;  4WVF B;  1X86 A;  4HAT B;  4L6E A;  5C16 A;  2D9X A;  1QQG A;  3QBV B;  1N3H A;  1ZC4 B;  4K2O A;  2MKR A;  1UEF A;  4KHB B;  1EGX A;  2K2J A;  2DYN A;  1XCG A;  3TVV A;  2K00 A;  5LON B;  3U7D A;  1XR0 B;  4TYZ A; 
#chains in the Genus database with same CATH homology
 5CLL B;  2D11 A;  3AU4 A;  1DRO A;  2RNR B;  2LG1 A;  1MIX A;  5GOW B;  4KAX B;  2P0F A;  1ZM0 A;  3DXE A;  1BTK A;  1ZVR A;  2DN6 A;  5HE2 A;  1FAO A;  5FI1 A;  1XKE A;  5JLJ B;  1I2H A;  2UZS A;  2LYD A;  2ELB A;  1I7A A;  1J19 A;  2W2X D;  1MIZ B;  2KCJ A;  1NTV A;  1WGQ A;  3PSC A;  1DDW A;  2R0D A;  4A6F B;  5J3T A;  4PNK A;  1U27 A;  3BJI A;  2COA A;  2RLO A;  5J3Q A;  3BIN A;  5C79 A;  2DFK A;  2COC A;  2COF A;  5FI0 A;  1FHO A;  2PZ1 A;  4HB3 B;  4F7H A;  1FGY A;  3KRW A;  5D3V A;  3SNH A;  3F0W A;  1W1H A;  3FEH A;  2MDX A;  4HAU B;  3KRX A;  5KQ1 A;  4CHM A;  3GYP A;  2VSZ A;  1OY2 A;  4IOY X;  2CRF A;  2J0M A;  5D3X A;  1LB1 A;  5C6R A;  1XOD A;  4NSW A;  5HE3 A;  4DXA B;  3ODO A;  1V61 A;  1Q67 A;  2HE7 A;  4YON A;  1MKE A;  2CY4 A;  1FGZ A;  4IFS A;  3KZ1 A;  3TO1 A;  2Z0Q A;  1X1F A;  2DHJ A;  3M1I B;  3ODX A;  2K2U A;  1DDM A;  2YT1 A;  1NI2 A;  1Z87 A;  2Y7B A;  3SO6 A;  5EFX A;  3QIJ A;  2YS1 A;  3X23 A;  2YS5 A;  2CY5 A;  4HB4 B;  2EJ8 A;  1WGU A;  1FHX A;  2OQB A;  4A6H A;  5JP4 A;  2X18 A;  1BWN A;  4HDO A;  2V76 A;  1K5G B;  1WVH A;  4CYE A;  3SV1 A;  1MAI A;  3V5W A;  3RCP A;  4F7U P;  1SHC A;  2DX5 A;  2BCJ A;  4C0A A;  3DXC A;  1DYN A;  2ZPY A;  5HE0 A;  1TJ6 A;  2JP2 A;  2GJY A;  2RUK B;  3O96 A;  4Z2M B;  4PQ0 A;  5DHA B;  1ISN A;  4GN1 A;  3PG7 A;  2H7E A;  1U5E A;  1Y5O A;  1AWE A;  1M7E A;  2QKL A;  3FM8 C;  3U8Z A;  1GC6 A;  2CAY A;  3P7Z A;  1XX0 A;  3FSS A;  1BTN A;  2YS3 A;  3NSU A;  2LOX A;  4EMO A;  1X05 A;  2GCJ A;  2QKM A;  4P7I A;  2RSG A;  4WSF A;  2YVC A;  2AEH A;  2L2I A;  2YT0 A;  5J3Y A;  1P5T A;  1DBH A;  3TW1 A;  3KSY A;  1PMS A;  1ZSQ A;  4NY0 A;  1PLS A;  4GMV A;  3MDB C;  5D3W A;  1U2B A;  5HE1 A;  5L81 A;  5DH9 B;  4HAX B;  4HAW B;  2RVB B;  1V5P A;  5LOP B;  2GS0 A;  5C5B B;  3WA0 A;  1DDV A;  2ROV A;  1V5U A;  3GYO A;  2YRY A;  5DI9 B;  2M38 A;  1UPQ A;  4F7G A;  4DX8 A;  2J0J A;  3D8E A;  5JHG A;  3HW2 B;  5D27 A;  2GCL A;  1UNP A;  2W2X C;  3F5R A;  3TFM A;  3SYX A;  1WJM A;  2MFQ A;  4YL8 A;  3HK0 A;  1GC7 A;  2P0H A;  4GXB A;  1EF1 A;  2VKI A;  2Q13 A;  2YF0 A;  2KUP A;  3IVF A;  2H7D A;  4K2P A;  3ZVR A;  5CLQ B;  4A6F A;  3T06 A;  4HAZ B;  2P0D A;  5KCV A;  2I1K A;  1XD4 A;  1ZC3 B;  3OAN A;  4KVG B;  2EC1 A;  1P3R A;  2N23 A;  3VIA A;  4EKU A;  1U5G A;  4HAV B;  2EMS A;  1WG7 A;  2RGN B;  4IAP A;  5DHF B;  3PEG A;  1MPH A;  2P8V A;  3DXD A;  3A8P A;  2DHI A;  4WJ7 A;  4MY6 A;  2YSZ A;  4MT7 A;  2OTX A;  1W1G A;  1BAK A;  2R09 A;  2LUL A;  3N7C A;  1MK9 B;  3HQC A;  4D0N B;  2ADZ A;  1QC6 A;  4A5K A;  3SUZ A;  2D9W A;  4KHO A;  1LW3 A;  1UPR A;  1KI1 B;  1FB8 A;  4ZRK A;  3ZDT A;  3PP2 A;  3VOQ A;  2DA0 A;  1W1D A;  3WYF B;  1H4R A;  1V89 A;  2W2W A;  4GPT B;  1K5D B;  2M14 A;  2D4Q A;  2DTC A;  2KGX B;  4XWX A;  2DKQ A;  2L1C A;  1TXD A;  2DKP A;  2Y8F A;  2D9Y A;  4ZRI A;  2UZR A;  4GMX B;  4CHJ A;  1X1G A;  3P6A A;  3CXB B;  5JHH A;  1KZG A;  1P6S A;  3CIK A;  2ROZ B;  1U5F A;  2AL6 A;  1WJ1 A;  4Z2N A;  5D3Y A;  1AQC A;  4HAY B;  3G9W A;  3ULC A;  2N0Y A;  2HTH B;  4KHA A;  4GZU A;  1E5W A;  1FHW A;  4HDQ A;  1RRP B;  1NTY A;  2FJL A;  2Z0O A;  4K81 A;  2DYQ A;  3ULB A;  1NU2 A;  1V5M A;  1X11 A;  2MWN B;  3D8F A;  4B6H A;  4ZRJ A;  4BBK A;  3ODW A;  3D8D A;  1KZ7 A;  2Y8G A;  4HB0 B;  2NZ8 B;  1OQN A;  2IYB A;  2NMB A;  3AJ4 A;  2XQN M;  1EVH A;  4DBB A;  2I1J A;  2IFS A;  1M7R A;  1B55 A;  4MK0 A;  2D9Z A;  4DX9 0;  3AU5 A;  3TCA A;  3UZT A;  1IRS A;  1UNR A;  2COD A;  1WI1 A;  2EMT A;  1PFJ A;  3A98 B;  4Y94 A;  4EJN A;  5DIF B;  1EAZ A;  1Y19 B;  2UVM A;  1GG3 A;  1OMW A;  2I5C A;  3A8Q A;  3PVL A;  2LKO A;  3KY9 A;  5C5B A;  3MPX A;  1V88 A;  5KQ4 A;  2DLW A;  1UNQ A;  4TKN A;  1H10 A;  2E2X A;  1SGH A;  4HB2 B;  1RJ2 A;  1J0W A;  3QWM A;  2J59 M;  2G35 A;  2VRW B;  4HHV A;  3PZD A;  1MK7 B;  2ELA A;  3ML4 A;  3PVW A;  4K17 A;  4A6K A;  2DHK A;  2J0K A;  1FOE A;  3LJU X;  2D9V A;  2D2Q A;  2I5F A;  2LOZ A;  2DX1 A;  1U29 A;  3PVU A;  1TQZ A;  1U5D A;  2Z0P A;  2D10 A;  4H8S A;  4WVF B;  1X86 A;  4HAT B;  4L6E A;  5C16 A;  2D9X A;  1QQG A;  3QBV B;  1N3H A;  1ZC4 B;  4K2O A;  2MKR A;  1UEF A;  4KHB B;  1EGX A;  2K2J A;  2DYN A;  1XCG A;  3TVV A;  2K00 A;  5LON B;  3U7D A;  1XR0 B;  4TYZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...