3DXEA

Crystal structure of the intracellular domain of human app (t668a mutant) in complex with fe65-ptb2
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
124
structure length
124
Chain Sequence
FQVYYLGNVPVAKPVGVDVINGALESVLSSSSREQWTPSHVSVAPATLTILHQQTEAVLGECRVRFLSFLAVGRDVHTFAFIMAAGPASFCCHMFWCEPNAASLSEAVQAACMLRYQKCLDARS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Protein binding
molecule keywords Amyloid beta A4 protein-binding family B member 1
publication title Structure of the intracellular domain of the amyloid precursor protein in complex with Fe65-PTB2.
pubmed doi rcsb
source organism Homo sapiens
total genus 36
structure length 124
sequence length 124
chains with identical sequence C
ec nomenclature
pdb deposition date 2008-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00640 PID Phosphotyrosine interaction domain (PTB/PID)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3dxeA00
1LW3A 2I1JA 3BINA 2RGNB 3A8PA 3VIAA 1GG3A 2GCLA 4GMVA 1E5WA 5HE2A 3N7CA 1XD4A 3D8FA 4HATB 1FHWA 2DTCA 4K2PA 3PZDA 5HE3A 1X05A 1V5MA 1P6SA 2COCA 2ZPYA 1P5TA 4EMOA 5JHHA 1X86A 4WSFA 3AJ4A 3QWMA 5KQ1A 4A5KA 2XQNM 1ZC3B 3G9WA 2P8VA 4KHOA 2W2WA 2YT1A 5C16A 2YVCA 1OY2A 4GN1A 2GJYA 4DBBA 3GYOA 1GC7A 1MPHA 3U7DA 3V5WA 5D3WA 1ZC4B 3PG7A 4C0AA 4ZRIA 4CHJA 1U5GA 4A6FB 1FB8A 1TJ6A 1DROA 1U29A 2YS5A 5HE0A 4HAYB 1U27A 3CIKA 2RNRB 4Z2NA 2D9WA 1FHOA 3P6AA 2DFKA 4PQ0A 1EAZA 3IVFA 4K2OA 1UNQA 2GCJA 2GS0A 1LB1A 4KHBB 4WJ7A 2Z0PA 1QC6A 3WYFB 1X1GA 3SO6A 2EJ8A 5CLLB 1Y19B 2I5FA 2ELAA 3TVVA 2J0MA 2D9YA 5JP4A 2QKLA 2H7EA 2R09A 2Z0OA 5D27A 2LOXA 4F7GA 4GXBA 5DH9B 2YSZA 2P0HA 2W2XC 1UNRA 4CYEA 3AU5A 4GMXB 1NTYA 2G35A 5FI0A 2DHKA 2VKIA 4K17A 1FOEA 2Q13A 1ISNA 2V76A 3ZDTA 5J3TA 2D11A 3TFMA 2RLOA 5C5BA 4A6HA 2MKRA 2NMBA 2NZ8B 1DDVA 1BTNA 2I5CA 3U8ZA 3DXDA 4ZRKA 3GYPA 1J19A 3AU4A 1GC6A 3VOQA 2Y8FA 4GZUA 2E2XA 4MT7A 1W1HA 2AEHA 1BWNA 1ZM0A 4HAZB 2Y7BA 1V88A 1Z87A 3ODOA 5DHAB 2ELBA 2M38A 1Y5OA 2Y8GA 4F7UP 1V5PA 1WI1A 3WA0A 3T06A 1DDMA 1BAKA 4PNKA 1AWEA 2DN6A 4HAXB 4P7IA 2K00A 3FSSA 1K5DB 1V89A 2LG1A 4HB3B 2YT0A 4DX8A 1WGQA 1FGYA 1U5EA 5LONB 1KZGA 1UPQA 1FGZA 1K5GB 4WVFB 3QIJA 1XR0B 2UVMA 4IOYX 1DDWA 1W1GA 2ROVA 4D0NB 5J3QA 4F7HA 4HB2B 4IAPA 1V5UA 1WVHA 2LULA 1M7RA 1H10A 2COFA 5C79A 4NSWA 2JP2A 3KZ1A 3PVWA 4ZRJA 2VRWB 3F5RA 3D8DA 4B6HA 2CY4A 1W1DA 2OQBA 1H4RA 1UNPA 3PVUA 2ROZB 4MK0A 5DIFB 1BTKA 1RRPB 2LYDA 2YF0A 2DYQA 1X1FA 1PFJA 2L1CA 2HTHB 2K2JA 5D3YA 3FEHA 1KZ7A 2BCJA 4YONA 2DYNA 3UZTA 2H7DA 1EGXA 4XWXA 2ADZA 3DXCA 2DHJA 3O96A 3KRWA 3ZVRA 2KGXB 1EVHA 2P0DA 2D9XA 1QQGA 3HQCA 1ZSQA 2RSGA 5FI1A 5DI9B 1N3HA 4HB0B 4EKUA 2DKPA 1I7AA 1Q67A 3ML4A 2DX1A 3HW2B 2UZRA 2DKQA 5DHFB 2VSZA 2W2XD 3PVLA 2CRFA 3PSCA 4Z2MB 1FHXA 1MIXA 1EF1A 4L6EA 1XX0A 3ODXA 1B55A 1I2HA 4HAUB 1AQCA 2MWNB 2CAYA 3P7ZA 2UZSA 3TW1A 3MDBC 1MK9B 2YS1A 1KI1B 2X18A 4TYZA 3FM8C 2CODA 4A6FA 1U5DA 3TCAA 4HAVB 1TQZA 3A8QA 2M14A 2D10A 5LOPB 1IRSA 2COAA 4HB4B 3ULBA 1P3RA 3ULCA 1XCGA 4HAWB 2OTXA 5D3XA 4GPTB 3X23A 4A6KA 1DBHA 4HDOA 2R0DA 2P0FA 2I1KA 1OQNA 3TO1A 3BJIA 3SYXA 1MKEA 4CHMA 2N0YA 5C5BB 2L2IA 2IFSA 4K81A 5HE1A 2LOZA 3CXBB 1SGHA 2D4QA 3A98B 3NSUA 1MIZB 3SNHA 4H8SA 1V61A 4KAXB 2LKOA 5KCVA 2AL6A 1WGUA 2D9ZA 2DLWA 3MPXA 2FJLA 2CY5A 1ZVRA 2EMSA 2K2UA 3KSYA 1NU2A 1DYNA 2DX5A 2KUPA 4HDQA 3OANA 5CLQB 4TKNA 2RUKB 1TXDA 2QKMA 4EJNA 2J0JA 2J0KA 5GOWB 1M7EA 3PP2A 1UEFA 4YL8A 2YS3A 1U2BA 3DXEA 2MFQA 2D9VA 3SUZA 2D2QA 4NY0A 2Z0QA 3LJUX 1MK7B 3RCPA 1UPRA 1XODA 2YRYA 5JLJB 2HE7A 3HK0A 2RVBB 1WG7A 4MY6A 2J59M 5D3VA 2DHIA 5KQ4A 2PZ1A 4DX90 2EMTA 1PMSA 2EC1A 4IFSA 5EFXA 1OMWA 2MDXA 1PLSA 1MAIA 1X11A 4DXAB 2IYBA 1NTVA 1RJ2A 1NI2A 3QBVB 2DA0A 1SHCA 3ODWA 5L81A 1WJ1A 3KRXA 4Y94A 2KCJA 1FAOA 5C6RA 4KVGB 4BBKA 3SV1A 5J3YA 3F0WA 4HHVA 1U5FA 3M1IB 3D8EA 4KHAA 5JHGA 1J0WA 1WJMA 3PEGA 1XKEA 3KY9A 2N23A
chains in the Genus database with same CATH superfamily
1LW3A 2I1JA 3BINA 2RGNB 3A8PA 3VIAA 1GG3A 2GCLA 4GMVA 1E5WA 5HE2A 2KIEA 3N7CA 1XD4A 3D8FA 4HATB 1FHWA 2DTCA 4K2PA 3PZDA 5HE3A 1X05A 1V5MA 1P6SA 2COCA 2ZPYA 1P5TA 4EMOA 5JHHA 1X86A 4WSFA 3AJ4A 3QWMA 5KQ1A 3NW8A 4A5KA 2XQNM 1ZC3B 3G9WA 2P8VA 3B77A 4KHOA 2NBVA 2W2WA 2YT1A 5C16A 2YVCA 1OY2A 4QJ4B 4GN1A 2GJYA 4DBBA 3GYOA 1GC7A 1MPHA 3U7DA 3V5WA 2Z4DA 5D3WA 1ZC4B 3PG7A 4C0AA 3FVCA 4ZRIA 4CHJA 1U5GA 4A6FB 1FB8A 1TJ6A 1DROA 1U29A 2YS5A 5HE0A 3NWDA 4HAYB 4QJ3B 1U27A 3CIKA 2RNRB 2GUMA 4Z2NA 2D9WA 1FHOA 3P6AA 2DFKA 4PQ0A 1EAZA 3IVFA 4K2OA 1UNQA 2GCJA 2GS0A 1LB1A 4KHBB 4WJ7A 2RRFA 2Z0PA 1QC6A 3WYFB 1X1GA 3SO6A 2EJ8A 5CLLB 1Y19B 2I5FA 2ELAA 3TVVA 2J0MA 2D9YA 5JP4A 2QKLA 2H7EA 2R09A 2Z0OA 5D27A 2LOXA 4F7GA 4GXBA 5DH9B 2YSZA 2P0HA 2FJUB 2W2XC 1UNRA 4CYEA 3AU5A 4GMXB 1NTYA 2G35A 5FI0A 2DHKA 2VKIA 2Z59A 4K17A 1FOEA 2Q13A 3NWFA 4QJ5B 1ISNA 2V76A 3ZDTA 5J3TA 2D11A 3TFMA 2RLOA 5C5BA 4A6HA 2MKRA 2NMBA 2NZ8B 1DDVA 1BTNA 2I5CA 3U8ZA 3DXDA 4ZRKA 3GYPA 1J19A 3AU4A 1GC6A 3VOQA 2Y8FA 4GZUA 2E2XA 4MT7A 4HSIA 1W1HA 2YT2A 1BWNA 2AEHA 2KR0A 1ZM0A 4HAZB 2Y7BA 1V88A 1Z87A 3ODOA 5DHAB 2ELBA 2M38A 1Y5OA 2Y8GA 4F7UP 1V5PA 1WI1A 3WA0A 3T06A 1DDMA 1BAKA 4PNKA 1AWEA 2DN6A 4HAXB 4P7IA 2K00A 3FSSA 1K5DB 1V89A 2LG1A 4HB3B 2YT0A 4DX8A 1WGQA 1FGYA 1T77A 1U5EA 5LONB 1KZGA 1UPQA 1FGZA 5M4YB 1K5GB 4WVFB 3QIJA 1XR0B 2UVMA 4IOYX 1DDWA 4GNKB 1W1GA 2ROVA 4D0NB 5J3QA 4F7HA 4HB2B 3HSAA 4DIXA 4IAPA 1V5UA 1WVHA 2LULA 1M7RA 1H10A 2COFA 5C79A 4NSWA 2JP2A 3KZ1A 3PVWA 4ZRJA 2VRWB 1ZYIA 3F5RA 3D8DA 4B6HA 2CY4A 1W1DA 2OQBA 1H4RA 1UNPA 3PVUA 2ROZB 4MK0A 5DIFB 1BTKA 1RRPB 2LYDA 2YF0A 2DYQA 1X1FA 1PFJA 2L1CA 2HTHB 2K2JA 5D3YA 3FEHA 1KZ7A 2BCJA 4YONA 2DYNA 3UZTA 2H7DA 1EGXA 4XWXA 2ADZA 3DXCA 2DHJA 3O96A 3KRWA 3ZVRA 2KGXB 1EVHA 2P0DA 2R2YA 2D9XA 1QQGA 3HQCA 5LG4B 1ZSQA 2RSGA 5FI1A 5DI9B 1N3HA 4HB0B 4EKUA 2DKPA 1MI1A 1I7AA 3HIEA 1Q67A 3ML4A 2DX1A 3A58A 3HW2B 2UZRA 2DKQA 5DHFB 2VSZA 2W2XD 3PVLA 2CRFA 3PSCA 4Z2MB 1FHXA 1MIXA 4GOUA 1EF1A 4L6EA 1XX0A 3ODXA 1B55A 1I2HA 4HAUB 1AQCA 2MWNB 2CAYA 3P7ZA 2UZSA 5I2MA 3MDBC 4QXAB 3TW1A 1MK9B 4L1RA 2YS1A 1KI1B 2X18A 4TYZA 3FM8C 2CODA 4A6FA 1U5DA 3TCAA 4HAVB 1TQZA 3A8QA 2M14A 2D10A 5LOPB 1IRSA 2COAA 4HB4B 3ULBA 1P3RA 3ULCA 1XCGA 4HAWB 2OTXA 5D3XA 4GPTB 3X23A 4KHBA 4A6KA 1DBHA 4HDOA 2R0DA 2P0FA 4OT1A 2I1KA 1OQNA 3TO1A 3BJIA 3SYXA 1MKEA 4CHMA 2N0YA 5C5BB 2L2IA 2IFSA 4K81A 5HE1A 2LOZA 3CXBB 1SGHA 2D4QA 3A98B 2KIGA 3NSUA 3U12A 1MIZB 3SNHA 4H8SA 1V61A 4KAXB 2LKOA 5KCVA 2AL6A 1WGUA 2D9ZA 2DLWA 3MPXA 2FJLA 2CY5A 1ZVRA 2EMSA 2K2UA 3KSYA 4D6WA 1NU2A 1DYNA 2DX5A 2KUPA 4HDQA 3OANA 5CLQB 4TKNA 2RUKB 5I2SA 4OSNA 1TXDA 2QKMA 4EJNA 2ZKMX 2J0JA 2J0KA 5GOWB 1M7EA 3PP2A 2Z13A 1UEFA 4YL8A 2YS3A 1U2BA 3DXEA 2MFQA 2D9VA 3SUZA 2K49A 2D2QA 4NY0A 2Z0QA 4CSQA 3LJUX 1MK7B 3RCPA 1UPRA 1XODA 5IRSA 2YRYA 5JLJB 2KUQA 2HE7A 3HK0A 2RVBB 1WG7A 4MY6A 2J59M 5D3VA 2DHIA 5KQ4A 2PZ1A 4DX90 2EMTA 1PMSA 2EC1A 4IFSA 5EFXA 1OMWA 2MDXA 2Z14A 1PLSA 1MAIA 1X11A 4DXAB 2IYBA 3OHMB 1NTVA 1RJ2A 1NI2A 3QBVB 2DA0A 1SHCA 3ODWA 5L81A 1WJ1A 2K8EA 3KRXA 4Y94A 2KCJA 1FAOA 5C6RA 4KVGB 3DCXA 4BBKA 3SV1A 5J3YA 3F0WA 4HHVA 1U5FA 3M1IB 3D8EA 4KHAA 3NWAA 5JHGA 1J0WA 1WJMA 3PEGA 1XKEA 3KY9A 2N23A
chains in the Genus database with same CATH topology
1LW3A 2I1JA 3BINA 2RGNB 3A8PA 3VIAA 1GG3A 2GCLA 4GMVA 1E5WA 5HE2A 3N7CA 1XD4A 3D8FA 4HATB 1FHWA 2DTCA 4K2PA 3PZDA 5HE3A 1X05A 1V5MA 1P6SA 2COCA 2ZPYA 1P5TA 4EMOA 5JHHA 1X86A 4WSFA 3AJ4A 3QWMA 5KQ1A 4A5KA 2XQNM 1ZC3B 3G9WA 2P8VA 4KHOA 2W2WA 2YT1A 5C16A 2YVCA 1OY2A 4GN1A 2GJYA 4DBBA 3GYOA 1GC7A 1MPHA 3U7DA 3V5WA 5D3WA 1ZC4B 3PG7A 4C0AA 4ZRIA 4CHJA 1U5GA 4A6FB 1FB8A 1TJ6A 1DROA 1U29A 2YS5A 5HE0A 4HAYB 1U27A 3CIKA 2RNRB 4Z2NA 2D9WA 1FHOA 3P6AA 2DFKA 4PQ0A 1EAZA 3IVFA 4K2OA 1UNQA 2GCJA 2GS0A 1LB1A 4KHBB 4WJ7A 2Z0PA 1QC6A 3WYFB 1X1GA 3SO6A 2EJ8A 5CLLB 1Y19B 2I5FA 2ELAA 3TVVA 2J0MA 2D9YA 5JP4A 2QKLA 2H7EA 2R09A 2Z0OA 5D27A 2LOXA 4F7GA 4GXBA 5DH9B 2YSZA 2P0HA 2W2XC 1UNRA 4CYEA 3AU5A 4GMXB 1NTYA 2G35A 5FI0A 2DHKA 2VKIA 4K17A 1FOEA 2Q13A 1ISNA 2V76A 3ZDTA 5J3TA 2D11A 3TFMA 2RLOA 5C5BA 4A6HA 2MKRA 2NMBA 2NZ8B 1DDVA 1BTNA 2I5CA 3U8ZA 3DXDA 4ZRKA 3GYPA 1J19A 3AU4A 1GC6A 3VOQA 2Y8FA 4GZUA 2E2XA 4MT7A 1W1HA 2AEHA 1BWNA 1ZM0A 4HAZB 2Y7BA 1V88A 1Z87A 3ODOA 5DHAB 2ELBA 2M38A 1Y5OA 2Y8GA 4F7UP 1V5PA 1WI1A 3WA0A 3T06A 1DDMA 1BAKA 4PNKA 1AWEA 2DN6A 4HAXB 4P7IA 2K00A 3FSSA 1K5DB 1V89A 2LG1A 4HB3B 2YT0A 4DX8A 1WGQA 1FGYA 1U5EA 5LONB 1KZGA 1UPQA 1FGZA 1K5GB 4WVFB 3QIJA 1XR0B 2UVMA 4IOYX 1DDWA 1W1GA 2ROVA 4D0NB 5J3QA 4F7HA 4HB2B 4IAPA 1V5UA 1WVHA 2LULA 1M7RA 1H10A 2COFA 5C79A 4NSWA 2JP2A 3KZ1A 3PVWA 4ZRJA 2VRWB 3F5RA 3D8DA 4B6HA 2CY4A 1W1DA 2OQBA 1H4RA 1UNPA 3PVUA 2ROZB 4MK0A 5DIFB 1BTKA 1RRPB 2LYDA 2YF0A 2DYQA 1X1FA 1PFJA 2L1CA 2HTHB 2K2JA 5D3YA 3FEHA 1KZ7A 2BCJA 4YONA 2DYNA 3UZTA 2H7DA 1EGXA 4XWXA 2ADZA 3DXCA 2DHJA 3O96A 3KRWA 3ZVRA 2KGXB 1EVHA 2P0DA 2D9XA 1QQGA 3HQCA 1ZSQA 2RSGA 5FI1A 5DI9B 1N3HA 4HB0B 4EKUA 2DKPA 1I7AA 1Q67A 3ML4A 2DX1A 3HW2B 2UZRA 2DKQA 5DHFB 2VSZA 2W2XD 3PVLA 2CRFA 3PSCA 4Z2MB 1FHXA 1MIXA 1EF1A 4L6EA 1XX0A 3ODXA 1B55A 1I2HA 4HAUB 1AQCA 2MWNB 2CAYA 3P7ZA 2UZSA 3TW1A 3MDBC 1MK9B 2YS1A 1KI1B 2X18A 4TYZA 3FM8C 2CODA 4A6FA 1U5DA 3TCAA 4HAVB 1TQZA 3A8QA 2M14A 2D10A 5LOPB 1IRSA 2COAA 4HB4B 3ULBA 1P3RA 3ULCA 1XCGA 4HAWB 2OTXA 5D3XA 4GPTB 3X23A 4A6KA 1DBHA 4HDOA 2R0DA 2P0FA 2I1KA 1OQNA 3TO1A 3BJIA 3SYXA 1MKEA 4CHMA 2N0YA 5C5BB 2L2IA 2IFSA 4K81A 5HE1A 2LOZA 3CXBB 1SGHA 2D4QA 3A98B 3NSUA 1MIZB 3SNHA 4H8SA 1V61A 4KAXB 2LKOA 5KCVA 2AL6A 1WGUA 2D9ZA 2DLWA 3MPXA 2FJLA 2CY5A 1ZVRA 2EMSA 2K2UA 3KSYA 1NU2A 1DYNA 2DX5A 2KUPA 4HDQA 3OANA 5CLQB 4TKNA 2RUKB 1TXDA 2QKMA 4EJNA 2J0JA 2J0KA 5GOWB 1M7EA 3PP2A 1UEFA 4YL8A 2YS3A 1U2BA 3DXEA 2MFQA 2D9VA 3SUZA 2D2QA 4NY0A 2Z0QA 3LJUX 1MK7B 3RCPA 1UPRA 1XODA 2YRYA 5JLJB 2HE7A 3HK0A 2RVBB 1WG7A 4MY6A 2J59M 5D3VA 2DHIA 5KQ4A 2PZ1A 4DX90 2EMTA 1PMSA 2EC1A 4IFSA 5EFXA 1OMWA 2MDXA 1PLSA 1MAIA 1X11A 4DXAB 2IYBA 1NTVA 1RJ2A 1NI2A 3QBVB 2DA0A 1SHCA 3ODWA 5L81A 1WJ1A 3KRXA 4Y94A 2KCJA 1FAOA 5C6RA 4KVGB 4BBKA 3SV1A 5J3YA 3F0WA 4HHVA 1U5FA 3M1IB 3D8EA 4KHAA 5JHGA 1J0WA 1WJMA 3PEGA 1XKEA 3KY9A 2N23A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LW3 A;  2I1J A;  3BIN A;  2RGN B;  3A8P A;  3VIA A;  1GG3 A;  2GCL A;  4GMV A;  1E5W A;  5HE2 A;  3N7C A;  1XD4 A;  3D8F A;  4HAT B;  1FHW A;  2DTC A;  4K2P A;  3PZD A;  5HE3 A;  1X05 A;  1V5M A;  1P6S A;  2COC A;  2ZPY A;  1P5T A;  4EMO A;  5JHH A;  1X86 A;  4WSF A;  3AJ4 A;  3QWM A;  5KQ1 A;  4A5K A;  2XQN M;  1ZC3 B;  3G9W A;  2P8V A;  4KHO A;  2W2W A;  2YT1 A;  5C16 A;  2YVC A;  1OY2 A;  4GN1 A;  2GJY A;  4DBB A;  3GYO A;  1GC7 A;  1MPH A;  3U7D A;  3V5W A;  5D3W A;  1ZC4 B;  3PG7 A;  4C0A A;  4ZRI A;  4CHJ A;  1U5G A;  4A6F B;  1FB8 A;  1TJ6 A;  1DRO A;  1U29 A;  2YS5 A;  5HE0 A;  4HAY B;  1U27 A;  3CIK A;  2RNR B;  4Z2N A;  2D9W A;  1FHO A;  3P6A A;  2DFK A;  4PQ0 A;  1EAZ A;  3IVF A;  4K2O A;  1UNQ A;  2GCJ A;  2GS0 A;  1LB1 A;  4KHB B;  4WJ7 A;  2Z0P A;  1QC6 A;  3WYF B;  1X1G A;  3SO6 A;  2EJ8 A;  5CLL B;  1Y19 B;  2I5F A;  2ELA A;  3TVV A;  2J0M A;  2D9Y A;  5JP4 A;  2QKL A;  2H7E A;  2R09 A;  2Z0O A;  5D27 A;  2LOX A;  4F7G A;  4GXB A;  5DH9 B;  2YSZ A;  2P0H A;  2W2X C;  1UNR A;  4CYE A;  3AU5 A;  4GMX B;  1NTY A;  2G35 A;  5FI0 A;  2DHK A;  2VKI A;  4K17 A;  1FOE A;  2Q13 A;  1ISN A;  2V76 A;  3ZDT A;  5J3T A;  2D11 A;  3TFM A;  2RLO A;  5C5B A;  4A6H A;  2MKR A;  2NMB A;  2NZ8 B;  1DDV A;  1BTN A;  2I5C A;  3U8Z A;  3DXD A;  4ZRK A;  3GYP A;  1J19 A;  3AU4 A;  1GC6 A;  3VOQ A;  2Y8F A;  4GZU A;  2E2X A;  4MT7 A;  1W1H A;  2AEH A;  1BWN A;  1ZM0 A;  4HAZ B;  2Y7B A;  1V88 A;  1Z87 A;  3ODO A;  5DHA B;  2ELB A;  2M38 A;  1Y5O A;  2Y8G A;  4F7U P;  1V5P A;  1WI1 A;  3WA0 A;  3T06 A;  1DDM A;  1BAK A;  4PNK A;  1AWE A;  2DN6 A;  4HAX B;  4P7I A;  2K00 A;  3FSS A;  1K5D B;  1V89 A;  2LG1 A;  4HB3 B;  2YT0 A;  4DX8 A;  1WGQ A;  1FGY A;  1U5E A;  5LON B;  1KZG A;  1UPQ A;  1FGZ A;  1K5G B;  4WVF B;  3QIJ A;  1XR0 B;  2UVM A;  4IOY X;  1DDW A;  1W1G A;  2ROV A;  4D0N B;  5J3Q A;  4F7H A;  4HB2 B;  4IAP A;  1V5U A;  1WVH A;  2LUL A;  1M7R A;  1H10 A;  2COF A;  5C79 A;  4NSW A;  2JP2 A;  3KZ1 A;  3PVW A;  4ZRJ A;  2VRW B;  3F5R A;  3D8D A;  4B6H A;  2CY4 A;  1W1D A;  2OQB A;  1H4R A;  1UNP A;  3PVU A;  2ROZ B;  4MK0 A;  5DIF B;  1BTK A;  1RRP B;  2LYD A;  2YF0 A;  2DYQ A;  1X1F A;  1PFJ A;  2L1C A;  2HTH B;  2K2J A;  5D3Y A;  3FEH A;  1KZ7 A;  2BCJ A;  4YON A;  2DYN A;  3UZT A;  2H7D A;  1EGX A;  4XWX A;  2ADZ A;  3DXC A;  2DHJ A;  3O96 A;  3KRW A;  3ZVR A;  2KGX B;  1EVH A;  2P0D A;  2D9X A;  1QQG A;  3HQC A;  1ZSQ A;  2RSG A;  5FI1 A;  5DI9 B;  1N3H A;  4HB0 B;  4EKU A;  2DKP A;  1I7A A;  1Q67 A;  3ML4 A;  2DX1 A;  3HW2 B;  2UZR A;  2DKQ A;  5DHF B;  2VSZ A;  2W2X D;  3PVL A;  2CRF A;  3PSC A;  4Z2M B;  1FHX A;  1MIX A;  1EF1 A;  4L6E A;  1XX0 A;  3ODX A;  1B55 A;  1I2H A;  4HAU B;  1AQC A;  2MWN B;  2CAY A;  3P7Z A;  2UZS A;  3TW1 A;  3MDB C;  1MK9 B;  2YS1 A;  1KI1 B;  2X18 A;  4TYZ A;  3FM8 C;  2COD A;  4A6F A;  1U5D A;  3TCA A;  4HAV B;  1TQZ A;  3A8Q A;  2M14 A;  2D10 A;  5LOP B;  1IRS A;  2COA A;  4HB4 B;  3ULB A;  1P3R A;  3ULC A;  1XCG A;  4HAW B;  2OTX A;  5D3X A;  4GPT B;  3X23 A;  4A6K A;  1DBH A;  4HDO A;  2R0D A;  2P0F A;  2I1K A;  1OQN A;  3TO1 A;  3BJI A;  3SYX A;  1MKE A;  4CHM A;  2N0Y A;  5C5B B;  2L2I A;  2IFS A;  4K81 A;  5HE1 A;  2LOZ A;  3CXB B;  1SGH A;  2D4Q A;  3A98 B;  3NSU A;  1MIZ B;  3SNH A;  4H8S A;  1V61 A;  4KAX B;  2LKO A;  5KCV A;  2AL6 A;  1WGU A;  2D9Z A;  2DLW A;  3MPX A;  2FJL A;  2CY5 A;  1ZVR A;  2EMS A;  2K2U A;  3KSY A;  1NU2 A;  1DYN A;  2DX5 A;  2KUP A;  4HDQ A;  3OAN A;  5CLQ B;  4TKN A;  2RUK B;  1TXD A;  2QKM A;  4EJN A;  2J0J A;  2J0K A;  5GOW B;  1M7E A;  3PP2 A;  1UEF A;  4YL8 A;  2YS3 A;  1U2B A;  3DXE A;  2MFQ A;  2D9V A;  3SUZ A;  2D2Q A;  4NY0 A;  2Z0Q A;  3LJU X;  1MK7 B;  3RCP A;  1UPR A;  1XOD A;  2YRY A;  5JLJ B;  2HE7 A;  3HK0 A;  2RVB B;  1WG7 A;  4MY6 A;  2J59 M;  5D3V A;  2DHI A;  5KQ4 A;  2PZ1 A;  4DX9 0;  2EMT A;  1PMS A;  2EC1 A;  4IFS A;  5EFX A;  1OMW A;  2MDX A;  1PLS A;  1MAI A;  1X11 A;  4DXA B;  2IYB A;  1NTV A;  1RJ2 A;  1NI2 A;  3QBV B;  2DA0 A;  1SHC A;  3ODW A;  5L81 A;  1WJ1 A;  3KRX A;  4Y94 A;  2KCJ A;  1FAO A;  5C6R A;  4KVG B;  4BBK A;  3SV1 A;  5J3Y A;  3F0W A;  4HHV A;  1U5F A;  3M1I B;  3D8E A;  4KHA A;  5JHG A;  1J0W A;  1WJM A;  3PEG A;  1XKE A;  3KY9 A;  2N23 A; 
#chains in the Genus database with same CATH topology
 1LW3 A;  2I1J A;  3BIN A;  2RGN B;  3A8P A;  3VIA A;  1GG3 A;  2GCL A;  4GMV A;  1E5W A;  5HE2 A;  2KIE A;  3N7C A;  1XD4 A;  3D8F A;  4HAT B;  1FHW A;  2DTC A;  4K2P A;  3PZD A;  5HE3 A;  1X05 A;  1V5M A;  1P6S A;  2COC A;  2ZPY A;  1P5T A;  4EMO A;  5JHH A;  1X86 A;  4WSF A;  3AJ4 A;  3QWM A;  5KQ1 A;  3NW8 A;  4A5K A;  2XQN M;  1ZC3 B;  3G9W A;  2P8V A;  3B77 A;  4KHO A;  2NBV A;  2W2W A;  2YT1 A;  5C16 A;  2YVC A;  1OY2 A;  4QJ4 B;  4GN1 A;  2GJY A;  4DBB A;  3GYO A;  1GC7 A;  1MPH A;  3U7D A;  3V5W A;  2Z4D A;  5D3W A;  1ZC4 B;  3PG7 A;  4C0A A;  3FVC A;  4ZRI A;  4CHJ A;  1U5G A;  4A6F B;  1FB8 A;  1TJ6 A;  1DRO A;  1U29 A;  2YS5 A;  5HE0 A;  3NWD A;  4HAY B;  4QJ3 B;  1U27 A;  3CIK A;  2RNR B;  2GUM A;  4Z2N A;  2D9W A;  1FHO A;  3P6A A;  2DFK A;  4PQ0 A;  1EAZ A;  3IVF A;  4K2O A;  1UNQ A;  2GCJ A;  2GS0 A;  1LB1 A;  4KHB B;  4WJ7 A;  2RRF A;  2Z0P A;  1QC6 A;  3WYF B;  1X1G A;  3SO6 A;  2EJ8 A;  5CLL B;  1Y19 B;  2I5F A;  2ELA A;  3TVV A;  2J0M A;  2D9Y A;  5JP4 A;  2QKL A;  2H7E A;  2R09 A;  2Z0O A;  5D27 A;  2LOX A;  4F7G A;  4GXB A;  5DH9 B;  2YSZ A;  2P0H A;  2FJU B;  2W2X C;  1UNR A;  4CYE A;  3AU5 A;  4GMX B;  1NTY A;  2G35 A;  5FI0 A;  2DHK A;  2VKI A;  2Z59 A;  4K17 A;  1FOE A;  2Q13 A;  3NWF A;  4QJ5 B;  1ISN A;  2V76 A;  3ZDT A;  5J3T A;  2D11 A;  3TFM A;  2RLO A;  5C5B A;  4A6H A;  2MKR A;  2NMB A;  2NZ8 B;  1DDV A;  1BTN A;  2I5C A;  3U8Z A;  3DXD A;  4ZRK A;  3GYP A;  1J19 A;  3AU4 A;  1GC6 A;  3VOQ A;  2Y8F A;  4GZU A;  2E2X A;  4MT7 A;  4HSI A;  1W1H A;  2YT2 A;  1BWN A;  2AEH A;  2KR0 A;  1ZM0 A;  4HAZ B;  2Y7B A;  1V88 A;  1Z87 A;  3ODO A;  5DHA B;  2ELB A;  2M38 A;  1Y5O A;  2Y8G A;  4F7U P;  1V5P A;  1WI1 A;  3WA0 A;  3T06 A;  1DDM A;  1BAK A;  4PNK A;  1AWE A;  2DN6 A;  4HAX B;  4P7I A;  2K00 A;  3FSS A;  1K5D B;  1V89 A;  2LG1 A;  4HB3 B;  2YT0 A;  4DX8 A;  1WGQ A;  1FGY A;  1T77 A;  1U5E A;  5LON B;  1KZG A;  1UPQ A;  1FGZ A;  5M4Y B;  1K5G B;  4WVF B;  3QIJ A;  1XR0 B;  2UVM A;  4IOY X;  1DDW A;  4GNK B;  1W1G A;  2ROV A;  4D0N B;  5J3Q A;  4F7H A;  4HB2 B;  3HSA A;  4DIX A;  4IAP A;  1V5U A;  1WVH A;  2LUL A;  1M7R A;  1H10 A;  2COF A;  5C79 A;  4NSW A;  2JP2 A;  3KZ1 A;  3PVW A;  4ZRJ A;  2VRW B;  1ZYI A;  3F5R A;  3D8D A;  4B6H A;  2CY4 A;  1W1D A;  2OQB A;  1H4R A;  1UNP A;  3PVU A;  2ROZ B;  4MK0 A;  5DIF B;  1BTK A;  1RRP B;  2LYD A;  2YF0 A;  2DYQ A;  1X1F A;  1PFJ A;  2L1C A;  2HTH B;  2K2J A;  5D3Y A;  3FEH A;  1KZ7 A;  2BCJ A;  4YON A;  2DYN A;  3UZT A;  2H7D A;  1EGX A;  4XWX A;  2ADZ A;  3DXC A;  2DHJ A;  3O96 A;  3KRW A;  3ZVR A;  2KGX B;  1EVH A;  2P0D A;  2R2Y A;  2D9X A;  1QQG A;  3HQC A;  5LG4 B;  1ZSQ A;  2RSG A;  5FI1 A;  5DI9 B;  1N3H A;  4HB0 B;  4EKU A;  2DKP A;  1MI1 A;  1I7A A;  3HIE A;  1Q67 A;  3ML4 A;  2DX1 A;  3A58 A;  3HW2 B;  2UZR A;  2DKQ A;  5DHF B;  2VSZ A;  2W2X D;  3PVL A;  2CRF A;  3PSC A;  4Z2M B;  1FHX A;  1MIX A;  4GOU A;  1EF1 A;  4L6E A;  1XX0 A;  3ODX A;  1B55 A;  1I2H A;  4HAU B;  1AQC A;  2MWN B;  2CAY A;  3P7Z A;  2UZS A;  5I2M A;  3MDB C;  4QXA B;  3TW1 A;  1MK9 B;  4L1R A;  2YS1 A;  1KI1 B;  2X18 A;  4TYZ A;  3FM8 C;  2COD A;  4A6F A;  1U5D A;  3TCA A;  4HAV B;  1TQZ A;  3A8Q A;  2M14 A;  2D10 A;  5LOP B;  1IRS A;  2COA A;  4HB4 B;  3ULB A;  1P3R A;  3ULC A;  1XCG A;  4HAW B;  2OTX A;  5D3X A;  4GPT B;  3X23 A;  4KHB A;  4A6K A;  1DBH A;  4HDO A;  2R0D A;  2P0F A;  4OT1 A;  2I1K A;  1OQN A;  3TO1 A;  3BJI A;  3SYX A;  1MKE A;  4CHM A;  2N0Y A;  5C5B B;  2L2I A;  2IFS A;  4K81 A;  5HE1 A;  2LOZ A;  3CXB B;  1SGH A;  2D4Q A;  3A98 B;  2KIG A;  3NSU A;  3U12 A;  1MIZ B;  3SNH A;  4H8S A;  1V61 A;  4KAX B;  2LKO A;  5KCV A;  2AL6 A;  1WGU A;  2D9Z A;  2DLW A;  3MPX A;  2FJL A;  2CY5 A;  1ZVR A;  2EMS A;  2K2U A;  3KSY A;  4D6W A;  1NU2 A;  1DYN A;  2DX5 A;  2KUP A;  4HDQ A;  3OAN A;  5CLQ B;  4TKN A;  2RUK B;  5I2S A;  4OSN A;  1TXD A;  2QKM A;  4EJN A;  2ZKM X;  2J0J A;  2J0K A;  5GOW B;  1M7E A;  3PP2 A;  2Z13 A;  1UEF A;  4YL8 A;  2YS3 A;  1U2B A;  3DXE A;  2MFQ A;  2D9V A;  3SUZ A;  2K49 A;  2D2Q A;  4NY0 A;  2Z0Q A;  4CSQ A;  3LJU X;  1MK7 B;  3RCP A;  1UPR A;  1XOD A;  5IRS A;  2YRY A;  5JLJ B;  2KUQ A;  2HE7 A;  3HK0 A;  2RVB B;  1WG7 A;  4MY6 A;  2J59 M;  5D3V A;  2DHI A;  5KQ4 A;  2PZ1 A;  4DX9 0;  2EMT A;  1PMS A;  2EC1 A;  4IFS A;  5EFX A;  1OMW A;  2MDX A;  2Z14 A;  1PLS A;  1MAI A;  1X11 A;  4DXA B;  2IYB A;  3OHM B;  1NTV A;  1RJ2 A;  1NI2 A;  3QBV B;  2DA0 A;  1SHC A;  3ODW A;  5L81 A;  1WJ1 A;  2K8E A;  3KRX A;  4Y94 A;  2KCJ A;  1FAO A;  5C6R A;  4KVG B;  3DCX A;  4BBK A;  3SV1 A;  5J3Y A;  3F0W A;  4HHV A;  1U5F A;  3M1I B;  3D8E A;  4KHA A;  3NWA A;  5JHG A;  1J0W A;  1WJM A;  3PEG A;  1XKE A;  3KY9 A;  2N23 A; 
#chains in the Genus database with same CATH homology
 1LW3 A;  2I1J A;  3BIN A;  2RGN B;  3A8P A;  3VIA A;  1GG3 A;  2GCL A;  4GMV A;  1E5W A;  5HE2 A;  3N7C A;  1XD4 A;  3D8F A;  4HAT B;  1FHW A;  2DTC A;  4K2P A;  3PZD A;  5HE3 A;  1X05 A;  1V5M A;  1P6S A;  2COC A;  2ZPY A;  1P5T A;  4EMO A;  5JHH A;  1X86 A;  4WSF A;  3AJ4 A;  3QWM A;  5KQ1 A;  4A5K A;  2XQN M;  1ZC3 B;  3G9W A;  2P8V A;  4KHO A;  2W2W A;  2YT1 A;  5C16 A;  2YVC A;  1OY2 A;  4GN1 A;  2GJY A;  4DBB A;  3GYO A;  1GC7 A;  1MPH A;  3U7D A;  3V5W A;  5D3W A;  1ZC4 B;  3PG7 A;  4C0A A;  4ZRI A;  4CHJ A;  1U5G A;  4A6F B;  1FB8 A;  1TJ6 A;  1DRO A;  1U29 A;  2YS5 A;  5HE0 A;  4HAY B;  1U27 A;  3CIK A;  2RNR B;  4Z2N A;  2D9W A;  1FHO A;  3P6A A;  2DFK A;  4PQ0 A;  1EAZ A;  3IVF A;  4K2O A;  1UNQ A;  2GCJ A;  2GS0 A;  1LB1 A;  4KHB B;  4WJ7 A;  2Z0P A;  1QC6 A;  3WYF B;  1X1G A;  3SO6 A;  2EJ8 A;  5CLL B;  1Y19 B;  2I5F A;  2ELA A;  3TVV A;  2J0M A;  2D9Y A;  5JP4 A;  2QKL A;  2H7E A;  2R09 A;  2Z0O A;  5D27 A;  2LOX A;  4F7G A;  4GXB A;  5DH9 B;  2YSZ A;  2P0H A;  2W2X C;  1UNR A;  4CYE A;  3AU5 A;  4GMX B;  1NTY A;  2G35 A;  5FI0 A;  2DHK A;  2VKI A;  4K17 A;  1FOE A;  2Q13 A;  1ISN A;  2V76 A;  3ZDT A;  5J3T A;  2D11 A;  3TFM A;  2RLO A;  5C5B A;  4A6H A;  2MKR A;  2NMB A;  2NZ8 B;  1DDV A;  1BTN A;  2I5C A;  3U8Z A;  3DXD A;  4ZRK A;  3GYP A;  1J19 A;  3AU4 A;  1GC6 A;  3VOQ A;  2Y8F A;  4GZU A;  2E2X A;  4MT7 A;  1W1H A;  2AEH A;  1BWN A;  1ZM0 A;  4HAZ B;  2Y7B A;  1V88 A;  1Z87 A;  3ODO A;  5DHA B;  2ELB A;  2M38 A;  1Y5O A;  2Y8G A;  4F7U P;  1V5P A;  1WI1 A;  3WA0 A;  3T06 A;  1DDM A;  1BAK A;  4PNK A;  1AWE A;  2DN6 A;  4HAX B;  4P7I A;  2K00 A;  3FSS A;  1K5D B;  1V89 A;  2LG1 A;  4HB3 B;  2YT0 A;  4DX8 A;  1WGQ A;  1FGY A;  1U5E A;  5LON B;  1KZG A;  1UPQ A;  1FGZ A;  1K5G B;  4WVF B;  3QIJ A;  1XR0 B;  2UVM A;  4IOY X;  1DDW A;  1W1G A;  2ROV A;  4D0N B;  5J3Q A;  4F7H A;  4HB2 B;  4IAP A;  1V5U A;  1WVH A;  2LUL A;  1M7R A;  1H10 A;  2COF A;  5C79 A;  4NSW A;  2JP2 A;  3KZ1 A;  3PVW A;  4ZRJ A;  2VRW B;  3F5R A;  3D8D A;  4B6H A;  2CY4 A;  1W1D A;  2OQB A;  1H4R A;  1UNP A;  3PVU A;  2ROZ B;  4MK0 A;  5DIF B;  1BTK A;  1RRP B;  2LYD A;  2YF0 A;  2DYQ A;  1X1F A;  1PFJ A;  2L1C A;  2HTH B;  2K2J A;  5D3Y A;  3FEH A;  1KZ7 A;  2BCJ A;  4YON A;  2DYN A;  3UZT A;  2H7D A;  1EGX A;  4XWX A;  2ADZ A;  3DXC A;  2DHJ A;  3O96 A;  3KRW A;  3ZVR A;  2KGX B;  1EVH A;  2P0D A;  2D9X A;  1QQG A;  3HQC A;  1ZSQ A;  2RSG A;  5FI1 A;  5DI9 B;  1N3H A;  4HB0 B;  4EKU A;  2DKP A;  1I7A A;  1Q67 A;  3ML4 A;  2DX1 A;  3HW2 B;  2UZR A;  2DKQ A;  5DHF B;  2VSZ A;  2W2X D;  3PVL A;  2CRF A;  3PSC A;  4Z2M B;  1FHX A;  1MIX A;  1EF1 A;  4L6E A;  1XX0 A;  3ODX A;  1B55 A;  1I2H A;  4HAU B;  1AQC A;  2MWN B;  2CAY A;  3P7Z A;  2UZS A;  3TW1 A;  3MDB C;  1MK9 B;  2YS1 A;  1KI1 B;  2X18 A;  4TYZ A;  3FM8 C;  2COD A;  4A6F A;  1U5D A;  3TCA A;  4HAV B;  1TQZ A;  3A8Q A;  2M14 A;  2D10 A;  5LOP B;  1IRS A;  2COA A;  4HB4 B;  3ULB A;  1P3R A;  3ULC A;  1XCG A;  4HAW B;  2OTX A;  5D3X A;  4GPT B;  3X23 A;  4A6K A;  1DBH A;  4HDO A;  2R0D A;  2P0F A;  2I1K A;  1OQN A;  3TO1 A;  3BJI A;  3SYX A;  1MKE A;  4CHM A;  2N0Y A;  5C5B B;  2L2I A;  2IFS A;  4K81 A;  5HE1 A;  2LOZ A;  3CXB B;  1SGH A;  2D4Q A;  3A98 B;  3NSU A;  1MIZ B;  3SNH A;  4H8S A;  1V61 A;  4KAX B;  2LKO A;  5KCV A;  2AL6 A;  1WGU A;  2D9Z A;  2DLW A;  3MPX A;  2FJL A;  2CY5 A;  1ZVR A;  2EMS A;  2K2U A;  3KSY A;  1NU2 A;  1DYN A;  2DX5 A;  2KUP A;  4HDQ A;  3OAN A;  5CLQ B;  4TKN A;  2RUK B;  1TXD A;  2QKM A;  4EJN A;  2J0J A;  2J0K A;  5GOW B;  1M7E A;  3PP2 A;  1UEF A;  4YL8 A;  2YS3 A;  1U2B A;  3DXE A;  2MFQ A;  2D9V A;  3SUZ A;  2D2Q A;  4NY0 A;  2Z0Q A;  3LJU X;  1MK7 B;  3RCP A;  1UPR A;  1XOD A;  2YRY A;  5JLJ B;  2HE7 A;  3HK0 A;  2RVB B;  1WG7 A;  4MY6 A;  2J59 M;  5D3V A;  2DHI A;  5KQ4 A;  2PZ1 A;  4DX9 0;  2EMT A;  1PMS A;  2EC1 A;  4IFS A;  5EFX A;  1OMW A;  2MDX A;  1PLS A;  1MAI A;  1X11 A;  4DXA B;  2IYB A;  1NTV A;  1RJ2 A;  1NI2 A;  3QBV B;  2DA0 A;  1SHC A;  3ODW A;  5L81 A;  1WJ1 A;  3KRX A;  4Y94 A;  2KCJ A;  1FAO A;  5C6R A;  4KVG B;  4BBK A;  3SV1 A;  5J3Y A;  3F0W A;  4HHV A;  1U5F A;  3M1I B;  3D8E A;  4KHA A;  5JHG A;  1J0W A;  1WJM A;  3PEG A;  1XKE A;  3KY9 A;  2N23 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...