4HAZB

Crystal structure of crm1 inhibitor leptomycin b in complex with crm1(r543s,k548e,k579q)-ran-ranbp1
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
121
structure length
121
Chain Sequence
EEDEEVLYKVRAKLFRFDKDAKEWKERGTGDCKFLKNKKTNKVRILMRRDKTLKICANHIIAPEYTLKPNVGSDRSWVYACTADIAEGEAEAFTFAIRFGSKENADKFKEEFEKAQEINKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport/antibiotic
molecule keywords GTP-binding nuclear protein Ran
publication title Nuclear export inhibition through covalent conjugation and hydrolysis of Leptomycin B by CRM1.
pubmed doi rcsb
source organism Homo sapiens
total genus 35
structure length 121
sequence length 121
ec nomenclature
pdb deposition date 2012-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00638 Ran_BP1 RanBP1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4hazB00
3DXDA 4A6FB 5DHAB 1KI1B 4MT7A 4HDOA 3UZTA 4C0AA 1FGYA 1XKEA 3ULCA 1W1HA 5D3VA 3ML4A 3GYOA 5C16A 2MKRA 5CLQB 1Q67A 3NSUA 5EFXA 2DX1A 2YS1A 2DHJA 1UEFA 2D9YA 1V5UA 4GN1A 4HB4B 1NTVA 1DYNA 4MY6A 3KRXA 3TCAA 1K5GB 2D9XA 4HB0B 3D8FA 5DI9B 5HE0A 4KHBB 2LOZA 5D3YA 4HATB 1V88A 3PSCA 2D10A 1DDWA 2CY4A 1H4RA 4GXBA 1U5EA 4KAXB 1V5MA 1B55A 3QIJA 5D3XA 2D9ZA 1U5FA 5KQ4A 2I5CA 2ROZB 4YL8A 2R0DA 1K5DB 1ZVRA 3BJIA 3D8EA 2BCJA 2YSZA 2XQNM 4HB2B 1FHXA 5GOWB 3SUZA 5LONB 4KHAA 1UNQA 3ODOA 3F5RA 2GJYA 2MFQA 1H10A 2DFKA 5DH9B 4K2OA 1XCGA 2I1KA 1MAIA 2DYQA 1DDVA 2DKQA 1P3RA 3X23A 1M7RA 1Y5OA 1ZC4B 3ULBA 1WGQA 4KVGB 1WG7A 3G9WA 1TJ6A 4PNKA 3SV1A 5J3YA 1SHCA 1MPHA 3HQCA 3AJ4A 1X1FA 1EGXA 2H7DA 2DHIA 4GMXB 2DTCA 2LULA 1PMSA 4HHVA 2ADZA 3PZDA 1WJ1A 4Z2NA 2OTXA 4CHMA 2RUKB 1EVHA 2RNRB 1AWEA 1W1GA 1ZSQA 1ISNA 3U7DA 1UNRA 2CODA 5L81A 2COCA 3P7ZA 3RCPA 1OMWA 2VKIA 5DIFB 2W2WA 1GC6A 1RRPB 4NY0A 3A8PA 3FEHA 1TQZA 4HB3B 3A8QA 1MIXA 3TW1A 4GMVA 3CIKA 3QBVB 2K2JA 2GCJA 2IYBA 4XWXA 1NI2A 1V89A 4A5KA 4B6HA 5KCVA 3OANA 1N3HA 5C6RA 2ZPYA 2QKLA 4BBKA 4IAPA 1ZC3B 1P6SA 2YRYA 4F7UP 3DXCA 5JHHA 5FI0A 1KZ7A 3BINA 1P5TA 4DX90 2D9WA 2NZ8B 2J0JA 2H7EA 1XODA 2N0YA 2JP2A 2AL6A 4P7IA 3FSSA 3HW2B 2EMTA 3P6AA 2M14A 3MPXA 2I5FA 1MK9B 1X05A 1U5DA 3HK0A 2R09A 2Z0QA 1V5PA 1DDMA 3VOQA 3WYFB 4F7GA 1OY2A 5CLLB 2E2XA 5JLJB 4HAZB 4DBBA 1FB8A 1Y19B 4GZUA 2W2XD 4HAXB 2KUPA 2D9VA 2X18A 3KY9A 4ZRKA 2P8VA 5KQ1A 2GS0A 2AEHA 2DN6A 1PFJA 4IOYX 3M1IB 3PVWA 2EJ8A 1RJ2A 1BTNA 5J3QA 4KHOA 1BAKA 4CYEA 2NMBA 3A98B 3AU5A 2MDXA 4EMOA 2DLWA 2QKMA 2OQBA 1IRSA 1DBHA 1U27A 1FAOA 3MDBC 4K2PA 5JHGA 4Z2MB 5C5BA 1BTKA 4EJNA 2L2IA 3V5WA 1AQCA 1UPQA 1Z87A 2Z0OA 1MKEA 1NU2A 3GYPA 2K2UA 3KSYA 1UPRA 1ZM0A 4A6HA 1QC6A 5LOPB 4HAUB 3TO1A 4CHJA 2I1JA 1GG3A 4HAWB 3PEGA 1NTYA 2DX5A 2YT1A 2HE7A 2D11A 5D27A 3ZVRA 2PZ1A 2MWNB 2KGXB 2RSGA 3T06A 1LB1A 1M7EA 2COFA 5JP4A 1I7AA 1FHWA 2DKPA 2CAYA 3KZ1A 2RLOA 4EKUA 3SNHA 3VIAA 4HDQA 2FJLA 3TFMA 1TXDA 4HAVB 4L6EA 1X1GA 4TYZA 1QQGA 2Q13A 2YT0A 4IFSA 1XR0B 2EMSA 2M38A 2P0HA 2LKOA 1KZGA 4DXAB 5J3TA 2UVMA 1FGZA 3N7CA 5DHFB 2DYNA 2CY5A 2YS5A 2P0DA 1U5GA 4ZRJA 2ELAA 2Y8FA 2L1CA 2ELBA 2D4QA 2YVCA 3AU4A 1X86A 2Z0PA 3ODWA 2Y7BA 2UZRA 1BWNA 2KCJA 2RGNB 1PLSA 1XX0A 4K81A 4TKNA 1FOEA 2IFSA 4DX8A 5HE3A 2LOXA 5HE2A 3TVVA 4NSWA 5FI1A 4ZRIA 2YF0A 2W2XC 1FHOA 1WGUA 2COAA 1GC7A 2J0MA 3DXEA 4PQ0A 4YONA 2CRFA 1J0WA 2GCLA 4D0NB 2K00A 3D8DA 3FM8C 2J0KA 1MIZB 5D3WA 3O96A 1X11A 3WA0A 1XD4A 5C79A 2G35A 1I2HA 1E5WA 1U29A 1V61A 4GPTB 1WI1A 3PVLA 5HE1A 4WSFA 3CXBB 3LJUX 1SGHA 2J59M 2N23A 4A6KA 4K17A 2LYDA 2DHKA 2VSZA 1UNPA 3F0WA 3PVUA 1EF1A 3ODXA 1J19A 2EC1A 2V76A 2RVBB 3SO6A 4F7HA 3IVFA 3U8ZA 2YS3A 2VRWB 3QWMA 1OQNA 4A6FA 2Y8GA 1W1DA 1EAZA 4Y94A 2P0FA 2ROVA 3SYXA 3PG7A 2DA0A 4H8SA 1DROA 3KRWA 1U2BA 5C5BB 2LG1A 4MK0A 1LW3A 1WVHA 2HTHB 3ZDTA 3PP2A 4WJ7A 2D2QA 1MK7B 4WVFB 1WJMA 2UZSA 4HAYB
chains in the Genus database with same CATH superfamily
3DXDA 4A6FB 5DHAB 1KI1B 4MT7A 4HDOA 3UZTA 4C0AA 1FGYA 1XKEA 3ULCA 1W1HA 5D3VA 3ML4A 3GYOA 5C16A 2MKRA 2NBVA 5CLQB 1Q67A 3NSUA 5EFXA 2DX1A 2YS1A 2DHJA 1UEFA 2D9YA 1V5UA 4GN1A 4HB4B 1NTVA 1DYNA 4MY6A 3KRXA 3TCAA 1K5GB 2D9XA 4HB0B 3D8FA 5DI9B 3HSAA 5HE0A 4KHBB 2LOZA 5D3YA 4HATB 1V88A 3PSCA 2D10A 1DDWA 2CY4A 1H4RA 4GXBA 1U5EA 4KAXB 1V5MA 1B55A 3QIJA 5D3XA 2D9ZA 1U5FA 5KQ4A 2I5CA 2ROZB 4YL8A 2R0DA 1K5DB 1ZVRA 3BJIA 3D8EA 2BCJA 2YSZA 2XQNM 4HB2B 1FHXA 5GOWB 3SUZA 5LONB 4KHAA 1UNQA 3ODOA 3F5RA 2GJYA 2MFQA 1H10A 2DFKA 5DH9B 4K2OA 1XCGA 2I1KA 1MAIA 2DYQA 1DDVA 2DKQA 1P3RA 3X23A 1M7RA 1Y5OA 1ZC4B 3ULBA 1WGQA 4KVGB 1WG7A 3G9WA 1TJ6A 4PNKA 3SV1A 5J3YA 1SHCA 1MPHA 3HQCA 3AJ4A 1X1FA 1EGXA 2H7DA 2DHIA 4GMXB 2DTCA 2LULA 3U12A 1PMSA 4HHVA 2ADZA 3PZDA 2KR0A 1WJ1A 4Z2NA 2OTXA 4CHMA 2RUKB 1EVHA 2RNRB 1AWEA 1W1GA 1ZSQA 1ISNA 3U7DA 1UNRA 2CODA 5L81A 2COCA 3P7ZA 3RCPA 1OMWA 2VKIA 5DIFB 2W2WA 3A58A 2GUMA 1GC6A 1RRPB 4NY0A 3A8PA 3FEHA 1TQZA 4HB3B 3A8QA 3OHMB 1MIXA 3TW1A 5LG4B 4GMVA 3CIKA 3QBVB 2K2JA 2GCJA 2IYBA 4XWXA 1NI2A 1V89A 4A5KA 4B6HA 5KCVA 3OANA 1N3HA 5C6RA 2ZPYA 2QKLA 4BBKA 4IAPA 1ZC3B 1P6SA 2YRYA 4F7UP 3DXCA 5M4YB 5JHHA 5FI0A 1KZ7A 3BINA 1P5TA 4DX90 4CSQA 2D9WA 2NZ8B 2J0JA 1MI1A 4QXAB 2H7EA 1XODA 2N0YA 2JP2A 2AL6A 4P7IA 3FSSA 3HW2B 2EMTA 3P6AA 2M14A 3MPXA 2I5FA 1MK9B 1X05A 1U5DA 3HK0A 2R09A 2Z0QA 1V5PA 1DDMA 3VOQA 3WYFB 4F7GA 1OY2A 5CLLB 2E2XA 4QJ4B 5JLJB 4HAZB 3DCXA 4DBBA 1FB8A 1Y19B 4GZUA 5IRSA 2W2XD 4HAXB 2KUPA 2D9VA 2X18A 2YT2A 3KY9A 4ZRKA 2P8VA 5KQ1A 2GS0A 2AEHA 2DN6A 1PFJA 1T77A 4IOYX 3M1IB 3PVWA 2EJ8A 1RJ2A 5I2MA 2KIEA 1BTNA 5J3QA 4KHOA 1BAKA 3HIEA 4CYEA 2NMBA 3A98B 3AU5A 2MDXA 4EMOA 2DLWA 2KUQA 2QKMA 2OQBA 3NWAA 1IRSA 1DBHA 1U27A 1FAOA 3MDBC 4K2PA 5JHGA 2ZKMX 4Z2MB 5C5BA 1BTKA 2K8EA 4EJNA 2L2IA 3V5WA 1AQCA 1UPQA 1Z87A 2Z0OA 1MKEA 1NU2A 3GYPA 2K2UA 3KSYA 4GNKB 4L1RA 4OSNA 1UPRA 3FVCA 1ZM0A 4A6HA 1QC6A 5LOPB 4HAUB 3TO1A 4CHJA 2I1JA 1GG3A 4HAWB 3PEGA 1NTYA 2DX5A 4HSIA 2YT1A 2HE7A 2D11A 5D27A 3ZVRA 2PZ1A 2MWNB 2KGXB 2RSGA 3T06A 2RRFA 1LB1A 1M7EA 2COFA 5JP4A 1I7AA 1FHWA 2DKPA 2CAYA 3KZ1A 4QJ5B 2RLOA 4EKUA 3B77A 3SNHA 3VIAA 4HDQA 2FJLA 3TFMA 1TXDA 4HAVB 4L6EA 1X1GA 4TYZA 1QQGA 2Q13A 2YT0A 4IFSA 1XR0B 2EMSA 2M38A 2P0HA 2LKOA 1KZGA 4DXAB 4KHBA 5J3TA 2UVMA 1FGZA 3N7CA 5DHFB 4GOUA 2DYNA 4DIXA 2CY5A 2YS5A 2P0DA 1U5GA 4ZRJA 2ELAA 2Y8FA 2L1CA 2ELBA 2D4QA 2YVCA 3AU4A 1X86A 2Z0PA 3ODWA 2Z13A 4QJ3B 2R2YA 2Y7BA 2UZRA 1BWNA 2KCJA 2RGNB 1PLSA 1XX0A 4K81A 4TKNA 1FOEA 2IFSA 4DX8A 5HE3A 2Z4DA 2LOXA 2Z59A 5HE2A 3TVVA 4NSWA 5FI1A 4ZRIA 2YF0A 2W2XC 2Z14A 1FHOA 1WGUA 2COAA 3NWDA 1GC7A 2J0MA 3NW8A 3DXEA 4PQ0A 4YONA 2CRFA 1J0WA 2GCLA 4D0NB 2K00A 3D8DA 3FM8C 2J0KA 1MIZB 5D3WA 5I2SA 3O96A 1X11A 3WA0A 3NWFA 1XD4A 5C79A 2G35A 1I2HA 1E5WA 1U29A 2KIGA 1V61A 4GPTB 1WI1A 3PVLA 5HE1A 4WSFA 3CXBB 3LJUX 1SGHA 2J59M 2N23A 4A6KA 4K17A 2LYDA 2DHKA 2VSZA 1UNPA 3F0WA 3PVUA 4D6WA 1EF1A 3ODXA 1J19A 2EC1A 1ZYIA 2V76A 2RVBB 3SO6A 4F7HA 3IVFA 3U8ZA 2YS3A 2VRWB 3QWMA 1OQNA 4A6FA 2Y8GA 1W1DA 1EAZA 4Y94A 2K49A 2P0FA 2ROVA 3SYXA 3PG7A 2DA0A 4H8SA 1DROA 3KRWA 4OT1A 1U2BA 2FJUB 5C5BB 2LG1A 4MK0A 1LW3A 1WVHA 2HTHB 3ZDTA 3PP2A 4WJ7A 2D2QA 1MK7B 4WVFB 1WJMA 2UZSA 4HAYB
chains in the Genus database with same CATH topology
3DXDA 4A6FB 5DHAB 1KI1B 4MT7A 4HDOA 3UZTA 4C0AA 1FGYA 1XKEA 3ULCA 1W1HA 5D3VA 3ML4A 3GYOA 5C16A 2MKRA 5CLQB 1Q67A 3NSUA 5EFXA 2DX1A 2YS1A 2DHJA 1UEFA 2D9YA 1V5UA 4GN1A 4HB4B 1NTVA 1DYNA 4MY6A 3KRXA 3TCAA 1K5GB 2D9XA 4HB0B 3D8FA 5DI9B 5HE0A 4KHBB 2LOZA 5D3YA 4HATB 1V88A 3PSCA 2D10A 1DDWA 2CY4A 1H4RA 4GXBA 1U5EA 4KAXB 1V5MA 1B55A 3QIJA 5D3XA 2D9ZA 1U5FA 5KQ4A 2I5CA 2ROZB 4YL8A 2R0DA 1K5DB 1ZVRA 3BJIA 3D8EA 2BCJA 2YSZA 2XQNM 4HB2B 1FHXA 5GOWB 3SUZA 5LONB 4KHAA 1UNQA 3ODOA 3F5RA 2GJYA 2MFQA 1H10A 2DFKA 5DH9B 4K2OA 1XCGA 2I1KA 1MAIA 2DYQA 1DDVA 2DKQA 1P3RA 3X23A 1M7RA 1Y5OA 1ZC4B 3ULBA 1WGQA 4KVGB 1WG7A 3G9WA 1TJ6A 4PNKA 3SV1A 5J3YA 1SHCA 1MPHA 3HQCA 3AJ4A 1X1FA 1EGXA 2H7DA 2DHIA 4GMXB 2DTCA 2LULA 1PMSA 4HHVA 2ADZA 3PZDA 1WJ1A 4Z2NA 2OTXA 4CHMA 2RUKB 1EVHA 2RNRB 1AWEA 1W1GA 1ZSQA 1ISNA 3U7DA 1UNRA 2CODA 5L81A 2COCA 3P7ZA 3RCPA 1OMWA 2VKIA 5DIFB 2W2WA 1GC6A 1RRPB 4NY0A 3A8PA 3FEHA 1TQZA 4HB3B 3A8QA 1MIXA 3TW1A 4GMVA 3CIKA 3QBVB 2K2JA 2GCJA 2IYBA 4XWXA 1NI2A 1V89A 4A5KA 4B6HA 5KCVA 3OANA 1N3HA 5C6RA 2ZPYA 2QKLA 4BBKA 4IAPA 1ZC3B 1P6SA 2YRYA 4F7UP 3DXCA 5JHHA 5FI0A 1KZ7A 3BINA 1P5TA 4DX90 2D9WA 2NZ8B 2J0JA 2H7EA 1XODA 2N0YA 2JP2A 2AL6A 4P7IA 3FSSA 3HW2B 2EMTA 3P6AA 2M14A 3MPXA 2I5FA 1MK9B 1X05A 1U5DA 3HK0A 2R09A 2Z0QA 1V5PA 1DDMA 3VOQA 3WYFB 4F7GA 1OY2A 5CLLB 2E2XA 5JLJB 4HAZB 4DBBA 1FB8A 1Y19B 4GZUA 2W2XD 4HAXB 2KUPA 2D9VA 2X18A 3KY9A 4ZRKA 2P8VA 5KQ1A 2GS0A 2AEHA 2DN6A 1PFJA 4IOYX 3M1IB 3PVWA 2EJ8A 1RJ2A 1BTNA 5J3QA 4KHOA 1BAKA 4CYEA 2NMBA 3A98B 3AU5A 2MDXA 4EMOA 2DLWA 2QKMA 2OQBA 1IRSA 1DBHA 1U27A 1FAOA 3MDBC 4K2PA 5JHGA 4Z2MB 5C5BA 1BTKA 4EJNA 2L2IA 3V5WA 1AQCA 1UPQA 1Z87A 2Z0OA 1MKEA 1NU2A 3GYPA 2K2UA 3KSYA 1UPRA 1ZM0A 4A6HA 1QC6A 5LOPB 4HAUB 3TO1A 4CHJA 2I1JA 1GG3A 4HAWB 3PEGA 1NTYA 2DX5A 2YT1A 2HE7A 2D11A 5D27A 3ZVRA 2PZ1A 2MWNB 2KGXB 2RSGA 3T06A 1LB1A 1M7EA 2COFA 5JP4A 1I7AA 1FHWA 2DKPA 2CAYA 3KZ1A 2RLOA 4EKUA 3SNHA 3VIAA 4HDQA 2FJLA 3TFMA 1TXDA 4HAVB 4L6EA 1X1GA 4TYZA 1QQGA 2Q13A 2YT0A 4IFSA 1XR0B 2EMSA 2M38A 2P0HA 2LKOA 1KZGA 4DXAB 5J3TA 2UVMA 1FGZA 3N7CA 5DHFB 2DYNA 2CY5A 2YS5A 2P0DA 1U5GA 4ZRJA 2ELAA 2Y8FA 2L1CA 2ELBA 2D4QA 2YVCA 3AU4A 1X86A 2Z0PA 3ODWA 2Y7BA 2UZRA 1BWNA 2KCJA 2RGNB 1PLSA 1XX0A 4K81A 4TKNA 1FOEA 2IFSA 4DX8A 5HE3A 2LOXA 5HE2A 3TVVA 4NSWA 5FI1A 4ZRIA 2YF0A 2W2XC 1FHOA 1WGUA 2COAA 1GC7A 2J0MA 3DXEA 4PQ0A 4YONA 2CRFA 1J0WA 2GCLA 4D0NB 2K00A 3D8DA 3FM8C 2J0KA 1MIZB 5D3WA 3O96A 1X11A 3WA0A 1XD4A 5C79A 2G35A 1I2HA 1E5WA 1U29A 1V61A 4GPTB 1WI1A 3PVLA 5HE1A 4WSFA 3CXBB 3LJUX 1SGHA 2J59M 2N23A 4A6KA 4K17A 2LYDA 2DHKA 2VSZA 1UNPA 3F0WA 3PVUA 1EF1A 3ODXA 1J19A 2EC1A 2V76A 2RVBB 3SO6A 4F7HA 3IVFA 3U8ZA 2YS3A 2VRWB 3QWMA 1OQNA 4A6FA 2Y8GA 1W1DA 1EAZA 4Y94A 2P0FA 2ROVA 3SYXA 3PG7A 2DA0A 4H8SA 1DROA 3KRWA 1U2BA 5C5BB 2LG1A 4MK0A 1LW3A 1WVHA 2HTHB 3ZDTA 3PP2A 4WJ7A 2D2QA 1MK7B 4WVFB 1WJMA 2UZSA 4HAYB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DXD A;  4A6F B;  5DHA B;  1KI1 B;  4MT7 A;  4HDO A;  3UZT A;  4C0A A;  1FGY A;  1XKE A;  3ULC A;  1W1H A;  5D3V A;  3ML4 A;  3GYO A;  5C16 A;  2MKR A;  5CLQ B;  1Q67 A;  3NSU A;  5EFX A;  2DX1 A;  2YS1 A;  2DHJ A;  1UEF A;  2D9Y A;  1V5U A;  4GN1 A;  4HB4 B;  1NTV A;  1DYN A;  4MY6 A;  3KRX A;  3TCA A;  1K5G B;  2D9X A;  4HB0 B;  3D8F A;  5DI9 B;  5HE0 A;  4KHB B;  2LOZ A;  5D3Y A;  4HAT B;  1V88 A;  3PSC A;  2D10 A;  1DDW A;  2CY4 A;  1H4R A;  4GXB A;  1U5E A;  4KAX B;  1V5M A;  1B55 A;  3QIJ A;  5D3X A;  2D9Z A;  1U5F A;  5KQ4 A;  2I5C A;  2ROZ B;  4YL8 A;  2R0D A;  1K5D B;  1ZVR A;  3BJI A;  3D8E A;  2BCJ A;  2YSZ A;  2XQN M;  4HB2 B;  1FHX A;  5GOW B;  3SUZ A;  5LON B;  4KHA A;  1UNQ A;  3ODO A;  3F5R A;  2GJY A;  2MFQ A;  1H10 A;  2DFK A;  5DH9 B;  4K2O A;  1XCG A;  2I1K A;  1MAI A;  2DYQ A;  1DDV A;  2DKQ A;  1P3R A;  3X23 A;  1M7R A;  1Y5O A;  1ZC4 B;  3ULB A;  1WGQ A;  4KVG B;  1WG7 A;  3G9W A;  1TJ6 A;  4PNK A;  3SV1 A;  5J3Y A;  1SHC A;  1MPH A;  3HQC A;  3AJ4 A;  1X1F A;  1EGX A;  2H7D A;  2DHI A;  4GMX B;  2DTC A;  2LUL A;  1PMS A;  4HHV A;  2ADZ A;  3PZD A;  1WJ1 A;  4Z2N A;  2OTX A;  4CHM A;  2RUK B;  1EVH A;  2RNR B;  1AWE A;  1W1G A;  1ZSQ A;  1ISN A;  3U7D A;  1UNR A;  2COD A;  5L81 A;  2COC A;  3P7Z A;  3RCP A;  1OMW A;  2VKI A;  5DIF B;  2W2W A;  1GC6 A;  1RRP B;  4NY0 A;  3A8P A;  3FEH A;  1TQZ A;  4HB3 B;  3A8Q A;  1MIX A;  3TW1 A;  4GMV A;  3CIK A;  3QBV B;  2K2J A;  2GCJ A;  2IYB A;  4XWX A;  1NI2 A;  1V89 A;  4A5K A;  4B6H A;  5KCV A;  3OAN A;  1N3H A;  5C6R A;  2ZPY A;  2QKL A;  4BBK A;  4IAP A;  1ZC3 B;  1P6S A;  2YRY A;  4F7U P;  3DXC A;  5JHH A;  5FI0 A;  1KZ7 A;  3BIN A;  1P5T A;  4DX9 0;  2D9W A;  2NZ8 B;  2J0J A;  2H7E A;  1XOD A;  2N0Y A;  2JP2 A;  2AL6 A;  4P7I A;  3FSS A;  3HW2 B;  2EMT A;  3P6A A;  2M14 A;  3MPX A;  2I5F A;  1MK9 B;  1X05 A;  1U5D A;  3HK0 A;  2R09 A;  2Z0Q A;  1V5P A;  1DDM A;  3VOQ A;  3WYF B;  4F7G A;  1OY2 A;  5CLL B;  2E2X A;  5JLJ B;  4HAZ B;  4DBB A;  1FB8 A;  1Y19 B;  4GZU A;  2W2X D;  4HAX B;  2KUP A;  2D9V A;  2X18 A;  3KY9 A;  4ZRK A;  2P8V A;  5KQ1 A;  2GS0 A;  2AEH A;  2DN6 A;  1PFJ A;  4IOY X;  3M1I B;  3PVW A;  2EJ8 A;  1RJ2 A;  1BTN A;  5J3Q A;  4KHO A;  1BAK A;  4CYE A;  2NMB A;  3A98 B;  3AU5 A;  2MDX A;  4EMO A;  2DLW A;  2QKM A;  2OQB A;  1IRS A;  1DBH A;  1U27 A;  1FAO A;  3MDB C;  4K2P A;  5JHG A;  4Z2M B;  5C5B A;  1BTK A;  4EJN A;  2L2I A;  3V5W A;  1AQC A;  1UPQ A;  1Z87 A;  2Z0O A;  1MKE A;  1NU2 A;  3GYP A;  2K2U A;  3KSY A;  1UPR A;  1ZM0 A;  4A6H A;  1QC6 A;  5LOP B;  4HAU B;  3TO1 A;  4CHJ A;  2I1J A;  1GG3 A;  4HAW B;  3PEG A;  1NTY A;  2DX5 A;  2YT1 A;  2HE7 A;  2D11 A;  5D27 A;  3ZVR A;  2PZ1 A;  2MWN B;  2KGX B;  2RSG A;  3T06 A;  1LB1 A;  1M7E A;  2COF A;  5JP4 A;  1I7A A;  1FHW A;  2DKP A;  2CAY A;  3KZ1 A;  2RLO A;  4EKU A;  3SNH A;  3VIA A;  4HDQ A;  2FJL A;  3TFM A;  1TXD A;  4HAV B;  4L6E A;  1X1G A;  4TYZ A;  1QQG A;  2Q13 A;  2YT0 A;  4IFS A;  1XR0 B;  2EMS A;  2M38 A;  2P0H A;  2LKO A;  1KZG A;  4DXA B;  5J3T A;  2UVM A;  1FGZ A;  3N7C A;  5DHF B;  2DYN A;  2CY5 A;  2YS5 A;  2P0D A;  1U5G A;  4ZRJ A;  2ELA A;  2Y8F A;  2L1C A;  2ELB A;  2D4Q A;  2YVC A;  3AU4 A;  1X86 A;  2Z0P A;  3ODW A;  2Y7B A;  2UZR A;  1BWN A;  2KCJ A;  2RGN B;  1PLS A;  1XX0 A;  4K81 A;  4TKN A;  1FOE A;  2IFS A;  4DX8 A;  5HE3 A;  2LOX A;  5HE2 A;  3TVV A;  4NSW A;  5FI1 A;  4ZRI A;  2YF0 A;  2W2X C;  1FHO A;  1WGU A;  2COA A;  1GC7 A;  2J0M A;  3DXE A;  4PQ0 A;  4YON A;  2CRF A;  1J0W A;  2GCL A;  4D0N B;  2K00 A;  3D8D A;  3FM8 C;  2J0K A;  1MIZ B;  5D3W A;  3O96 A;  1X11 A;  3WA0 A;  1XD4 A;  5C79 A;  2G35 A;  1I2H A;  1E5W A;  1U29 A;  1V61 A;  4GPT B;  1WI1 A;  3PVL A;  5HE1 A;  4WSF A;  3CXB B;  3LJU X;  1SGH A;  2J59 M;  2N23 A;  4A6K A;  4K17 A;  2LYD A;  2DHK A;  2VSZ A;  1UNP A;  3F0W A;  3PVU A;  1EF1 A;  3ODX A;  1J19 A;  2EC1 A;  2V76 A;  2RVB B;  3SO6 A;  4F7H A;  3IVF A;  3U8Z A;  2YS3 A;  2VRW B;  3QWM A;  1OQN A;  4A6F A;  2Y8G A;  1W1D A;  1EAZ A;  4Y94 A;  2P0F A;  2ROV A;  3SYX A;  3PG7 A;  2DA0 A;  4H8S A;  1DRO A;  3KRW A;  1U2B A;  5C5B B;  2LG1 A;  4MK0 A;  1LW3 A;  1WVH A;  2HTH B;  3ZDT A;  3PP2 A;  4WJ7 A;  2D2Q A;  1MK7 B;  4WVF B;  1WJM A;  2UZS A;  4HAY B; 
#chains in the Genus database with same CATH topology
 3DXD A;  4A6F B;  5DHA B;  1KI1 B;  4MT7 A;  4HDO A;  3UZT A;  4C0A A;  1FGY A;  1XKE A;  3ULC A;  1W1H A;  5D3V A;  3ML4 A;  3GYO A;  5C16 A;  2MKR A;  2NBV A;  5CLQ B;  1Q67 A;  3NSU A;  5EFX A;  2DX1 A;  2YS1 A;  2DHJ A;  1UEF A;  2D9Y A;  1V5U A;  4GN1 A;  4HB4 B;  1NTV A;  1DYN A;  4MY6 A;  3KRX A;  3TCA A;  1K5G B;  2D9X A;  4HB0 B;  3D8F A;  5DI9 B;  3HSA A;  5HE0 A;  4KHB B;  2LOZ A;  5D3Y A;  4HAT B;  1V88 A;  3PSC A;  2D10 A;  1DDW A;  2CY4 A;  1H4R A;  4GXB A;  1U5E A;  4KAX B;  1V5M A;  1B55 A;  3QIJ A;  5D3X A;  2D9Z A;  1U5F A;  5KQ4 A;  2I5C A;  2ROZ B;  4YL8 A;  2R0D A;  1K5D B;  1ZVR A;  3BJI A;  3D8E A;  2BCJ A;  2YSZ A;  2XQN M;  4HB2 B;  1FHX A;  5GOW B;  3SUZ A;  5LON B;  4KHA A;  1UNQ A;  3ODO A;  3F5R A;  2GJY A;  2MFQ A;  1H10 A;  2DFK A;  5DH9 B;  4K2O A;  1XCG A;  2I1K A;  1MAI A;  2DYQ A;  1DDV A;  2DKQ A;  1P3R A;  3X23 A;  1M7R A;  1Y5O A;  1ZC4 B;  3ULB A;  1WGQ A;  4KVG B;  1WG7 A;  3G9W A;  1TJ6 A;  4PNK A;  3SV1 A;  5J3Y A;  1SHC A;  1MPH A;  3HQC A;  3AJ4 A;  1X1F A;  1EGX A;  2H7D A;  2DHI A;  4GMX B;  2DTC A;  2LUL A;  3U12 A;  1PMS A;  4HHV A;  2ADZ A;  3PZD A;  2KR0 A;  1WJ1 A;  4Z2N A;  2OTX A;  4CHM A;  2RUK B;  1EVH A;  2RNR B;  1AWE A;  1W1G A;  1ZSQ A;  1ISN A;  3U7D A;  1UNR A;  2COD A;  5L81 A;  2COC A;  3P7Z A;  3RCP A;  1OMW A;  2VKI A;  5DIF B;  2W2W A;  3A58 A;  2GUM A;  1GC6 A;  1RRP B;  4NY0 A;  3A8P A;  3FEH A;  1TQZ A;  4HB3 B;  3A8Q A;  3OHM B;  1MIX A;  3TW1 A;  5LG4 B;  4GMV A;  3CIK A;  3QBV B;  2K2J A;  2GCJ A;  2IYB A;  4XWX A;  1NI2 A;  1V89 A;  4A5K A;  4B6H A;  5KCV A;  3OAN A;  1N3H A;  5C6R A;  2ZPY A;  2QKL A;  4BBK A;  4IAP A;  1ZC3 B;  1P6S A;  2YRY A;  4F7U P;  3DXC A;  5M4Y B;  5JHH A;  5FI0 A;  1KZ7 A;  3BIN A;  1P5T A;  4DX9 0;  4CSQ A;  2D9W A;  2NZ8 B;  2J0J A;  1MI1 A;  4QXA B;  2H7E A;  1XOD A;  2N0Y A;  2JP2 A;  2AL6 A;  4P7I A;  3FSS A;  3HW2 B;  2EMT A;  3P6A A;  2M14 A;  3MPX A;  2I5F A;  1MK9 B;  1X05 A;  1U5D A;  3HK0 A;  2R09 A;  2Z0Q A;  1V5P A;  1DDM A;  3VOQ A;  3WYF B;  4F7G A;  1OY2 A;  5CLL B;  2E2X A;  4QJ4 B;  5JLJ B;  4HAZ B;  3DCX A;  4DBB A;  1FB8 A;  1Y19 B;  4GZU A;  5IRS A;  2W2X D;  4HAX B;  2KUP A;  2D9V A;  2X18 A;  2YT2 A;  3KY9 A;  4ZRK A;  2P8V A;  5KQ1 A;  2GS0 A;  2AEH A;  2DN6 A;  1PFJ A;  1T77 A;  4IOY X;  3M1I B;  3PVW A;  2EJ8 A;  1RJ2 A;  5I2M A;  2KIE A;  1BTN A;  5J3Q A;  4KHO A;  1BAK A;  3HIE A;  4CYE A;  2NMB A;  3A98 B;  3AU5 A;  2MDX A;  4EMO A;  2DLW A;  2KUQ A;  2QKM A;  2OQB A;  3NWA A;  1IRS A;  1DBH A;  1U27 A;  1FAO A;  3MDB C;  4K2P A;  5JHG A;  2ZKM X;  4Z2M B;  5C5B A;  1BTK A;  2K8E A;  4EJN A;  2L2I A;  3V5W A;  1AQC A;  1UPQ A;  1Z87 A;  2Z0O A;  1MKE A;  1NU2 A;  3GYP A;  2K2U A;  3KSY A;  4GNK B;  4L1R A;  4OSN A;  1UPR A;  3FVC A;  1ZM0 A;  4A6H A;  1QC6 A;  5LOP B;  4HAU B;  3TO1 A;  4CHJ A;  2I1J A;  1GG3 A;  4HAW B;  3PEG A;  1NTY A;  2DX5 A;  4HSI A;  2YT1 A;  2HE7 A;  2D11 A;  5D27 A;  3ZVR A;  2PZ1 A;  2MWN B;  2KGX B;  2RSG A;  3T06 A;  2RRF A;  1LB1 A;  1M7E A;  2COF A;  5JP4 A;  1I7A A;  1FHW A;  2DKP A;  2CAY A;  3KZ1 A;  4QJ5 B;  2RLO A;  4EKU A;  3B77 A;  3SNH A;  3VIA A;  4HDQ A;  2FJL A;  3TFM A;  1TXD A;  4HAV B;  4L6E A;  1X1G A;  4TYZ A;  1QQG A;  2Q13 A;  2YT0 A;  4IFS A;  1XR0 B;  2EMS A;  2M38 A;  2P0H A;  2LKO A;  1KZG A;  4DXA B;  4KHB A;  5J3T A;  2UVM A;  1FGZ A;  3N7C A;  5DHF B;  4GOU A;  2DYN A;  4DIX A;  2CY5 A;  2YS5 A;  2P0D A;  1U5G A;  4ZRJ A;  2ELA A;  2Y8F A;  2L1C A;  2ELB A;  2D4Q A;  2YVC A;  3AU4 A;  1X86 A;  2Z0P A;  3ODW A;  2Z13 A;  4QJ3 B;  2R2Y A;  2Y7B A;  2UZR A;  1BWN A;  2KCJ A;  2RGN B;  1PLS A;  1XX0 A;  4K81 A;  4TKN A;  1FOE A;  2IFS A;  4DX8 A;  5HE3 A;  2Z4D A;  2LOX A;  2Z59 A;  5HE2 A;  3TVV A;  4NSW A;  5FI1 A;  4ZRI A;  2YF0 A;  2W2X C;  2Z14 A;  1FHO A;  1WGU A;  2COA A;  3NWD A;  1GC7 A;  2J0M A;  3NW8 A;  3DXE A;  4PQ0 A;  4YON A;  2CRF A;  1J0W A;  2GCL A;  4D0N B;  2K00 A;  3D8D A;  3FM8 C;  2J0K A;  1MIZ B;  5D3W A;  5I2S A;  3O96 A;  1X11 A;  3WA0 A;  3NWF A;  1XD4 A;  5C79 A;  2G35 A;  1I2H A;  1E5W A;  1U29 A;  2KIG A;  1V61 A;  4GPT B;  1WI1 A;  3PVL A;  5HE1 A;  4WSF A;  3CXB B;  3LJU X;  1SGH A;  2J59 M;  2N23 A;  4A6K A;  4K17 A;  2LYD A;  2DHK A;  2VSZ A;  1UNP A;  3F0W A;  3PVU A;  4D6W A;  1EF1 A;  3ODX A;  1J19 A;  2EC1 A;  1ZYI A;  2V76 A;  2RVB B;  3SO6 A;  4F7H A;  3IVF A;  3U8Z A;  2YS3 A;  2VRW B;  3QWM A;  1OQN A;  4A6F A;  2Y8G A;  1W1D A;  1EAZ A;  4Y94 A;  2K49 A;  2P0F A;  2ROV A;  3SYX A;  3PG7 A;  2DA0 A;  4H8S A;  1DRO A;  3KRW A;  4OT1 A;  1U2B A;  2FJU B;  5C5B B;  2LG1 A;  4MK0 A;  1LW3 A;  1WVH A;  2HTH B;  3ZDT A;  3PP2 A;  4WJ7 A;  2D2Q A;  1MK7 B;  4WVF B;  1WJM A;  2UZS A;  4HAY B; 
#chains in the Genus database with same CATH homology
 3DXD A;  4A6F B;  5DHA B;  1KI1 B;  4MT7 A;  4HDO A;  3UZT A;  4C0A A;  1FGY A;  1XKE A;  3ULC A;  1W1H A;  5D3V A;  3ML4 A;  3GYO A;  5C16 A;  2MKR A;  5CLQ B;  1Q67 A;  3NSU A;  5EFX A;  2DX1 A;  2YS1 A;  2DHJ A;  1UEF A;  2D9Y A;  1V5U A;  4GN1 A;  4HB4 B;  1NTV A;  1DYN A;  4MY6 A;  3KRX A;  3TCA A;  1K5G B;  2D9X A;  4HB0 B;  3D8F A;  5DI9 B;  5HE0 A;  4KHB B;  2LOZ A;  5D3Y A;  4HAT B;  1V88 A;  3PSC A;  2D10 A;  1DDW A;  2CY4 A;  1H4R A;  4GXB A;  1U5E A;  4KAX B;  1V5M A;  1B55 A;  3QIJ A;  5D3X A;  2D9Z A;  1U5F A;  5KQ4 A;  2I5C A;  2ROZ B;  4YL8 A;  2R0D A;  1K5D B;  1ZVR A;  3BJI A;  3D8E A;  2BCJ A;  2YSZ A;  2XQN M;  4HB2 B;  1FHX A;  5GOW B;  3SUZ A;  5LON B;  4KHA A;  1UNQ A;  3ODO A;  3F5R A;  2GJY A;  2MFQ A;  1H10 A;  2DFK A;  5DH9 B;  4K2O A;  1XCG A;  2I1K A;  1MAI A;  2DYQ A;  1DDV A;  2DKQ A;  1P3R A;  3X23 A;  1M7R A;  1Y5O A;  1ZC4 B;  3ULB A;  1WGQ A;  4KVG B;  1WG7 A;  3G9W A;  1TJ6 A;  4PNK A;  3SV1 A;  5J3Y A;  1SHC A;  1MPH A;  3HQC A;  3AJ4 A;  1X1F A;  1EGX A;  2H7D A;  2DHI A;  4GMX B;  2DTC A;  2LUL A;  1PMS A;  4HHV A;  2ADZ A;  3PZD A;  1WJ1 A;  4Z2N A;  2OTX A;  4CHM A;  2RUK B;  1EVH A;  2RNR B;  1AWE A;  1W1G A;  1ZSQ A;  1ISN A;  3U7D A;  1UNR A;  2COD A;  5L81 A;  2COC A;  3P7Z A;  3RCP A;  1OMW A;  2VKI A;  5DIF B;  2W2W A;  1GC6 A;  1RRP B;  4NY0 A;  3A8P A;  3FEH A;  1TQZ A;  4HB3 B;  3A8Q A;  1MIX A;  3TW1 A;  4GMV A;  3CIK A;  3QBV B;  2K2J A;  2GCJ A;  2IYB A;  4XWX A;  1NI2 A;  1V89 A;  4A5K A;  4B6H A;  5KCV A;  3OAN A;  1N3H A;  5C6R A;  2ZPY A;  2QKL A;  4BBK A;  4IAP A;  1ZC3 B;  1P6S A;  2YRY A;  4F7U P;  3DXC A;  5JHH A;  5FI0 A;  1KZ7 A;  3BIN A;  1P5T A;  4DX9 0;  2D9W A;  2NZ8 B;  2J0J A;  2H7E A;  1XOD A;  2N0Y A;  2JP2 A;  2AL6 A;  4P7I A;  3FSS A;  3HW2 B;  2EMT A;  3P6A A;  2M14 A;  3MPX A;  2I5F A;  1MK9 B;  1X05 A;  1U5D A;  3HK0 A;  2R09 A;  2Z0Q A;  1V5P A;  1DDM A;  3VOQ A;  3WYF B;  4F7G A;  1OY2 A;  5CLL B;  2E2X A;  5JLJ B;  4HAZ B;  4DBB A;  1FB8 A;  1Y19 B;  4GZU A;  2W2X D;  4HAX B;  2KUP A;  2D9V A;  2X18 A;  3KY9 A;  4ZRK A;  2P8V A;  5KQ1 A;  2GS0 A;  2AEH A;  2DN6 A;  1PFJ A;  4IOY X;  3M1I B;  3PVW A;  2EJ8 A;  1RJ2 A;  1BTN A;  5J3Q A;  4KHO A;  1BAK A;  4CYE A;  2NMB A;  3A98 B;  3AU5 A;  2MDX A;  4EMO A;  2DLW A;  2QKM A;  2OQB A;  1IRS A;  1DBH A;  1U27 A;  1FAO A;  3MDB C;  4K2P A;  5JHG A;  4Z2M B;  5C5B A;  1BTK A;  4EJN A;  2L2I A;  3V5W A;  1AQC A;  1UPQ A;  1Z87 A;  2Z0O A;  1MKE A;  1NU2 A;  3GYP A;  2K2U A;  3KSY A;  1UPR A;  1ZM0 A;  4A6H A;  1QC6 A;  5LOP B;  4HAU B;  3TO1 A;  4CHJ A;  2I1J A;  1GG3 A;  4HAW B;  3PEG A;  1NTY A;  2DX5 A;  2YT1 A;  2HE7 A;  2D11 A;  5D27 A;  3ZVR A;  2PZ1 A;  2MWN B;  2KGX B;  2RSG A;  3T06 A;  1LB1 A;  1M7E A;  2COF A;  5JP4 A;  1I7A A;  1FHW A;  2DKP A;  2CAY A;  3KZ1 A;  2RLO A;  4EKU A;  3SNH A;  3VIA A;  4HDQ A;  2FJL A;  3TFM A;  1TXD A;  4HAV B;  4L6E A;  1X1G A;  4TYZ A;  1QQG A;  2Q13 A;  2YT0 A;  4IFS A;  1XR0 B;  2EMS A;  2M38 A;  2P0H A;  2LKO A;  1KZG A;  4DXA B;  5J3T A;  2UVM A;  1FGZ A;  3N7C A;  5DHF B;  2DYN A;  2CY5 A;  2YS5 A;  2P0D A;  1U5G A;  4ZRJ A;  2ELA A;  2Y8F A;  2L1C A;  2ELB A;  2D4Q A;  2YVC A;  3AU4 A;  1X86 A;  2Z0P A;  3ODW A;  2Y7B A;  2UZR A;  1BWN A;  2KCJ A;  2RGN B;  1PLS A;  1XX0 A;  4K81 A;  4TKN A;  1FOE A;  2IFS A;  4DX8 A;  5HE3 A;  2LOX A;  5HE2 A;  3TVV A;  4NSW A;  5FI1 A;  4ZRI A;  2YF0 A;  2W2X C;  1FHO A;  1WGU A;  2COA A;  1GC7 A;  2J0M A;  3DXE A;  4PQ0 A;  4YON A;  2CRF A;  1J0W A;  2GCL A;  4D0N B;  2K00 A;  3D8D A;  3FM8 C;  2J0K A;  1MIZ B;  5D3W A;  3O96 A;  1X11 A;  3WA0 A;  1XD4 A;  5C79 A;  2G35 A;  1I2H A;  1E5W A;  1U29 A;  1V61 A;  4GPT B;  1WI1 A;  3PVL A;  5HE1 A;  4WSF A;  3CXB B;  3LJU X;  1SGH A;  2J59 M;  2N23 A;  4A6K A;  4K17 A;  2LYD A;  2DHK A;  2VSZ A;  1UNP A;  3F0W A;  3PVU A;  1EF1 A;  3ODX A;  1J19 A;  2EC1 A;  2V76 A;  2RVB B;  3SO6 A;  4F7H A;  3IVF A;  3U8Z A;  2YS3 A;  2VRW B;  3QWM A;  1OQN A;  4A6F A;  2Y8G A;  1W1D A;  1EAZ A;  4Y94 A;  2P0F A;  2ROV A;  3SYX A;  3PG7 A;  2DA0 A;  4H8S A;  1DRO A;  3KRW A;  1U2B A;  5C5B B;  2LG1 A;  4MK0 A;  1LW3 A;  1WVH A;  2HTH B;  3ZDT A;  3PP2 A;  4WJ7 A;  2D2Q A;  1MK7 B;  4WVF B;  1WJM A;  2UZS A;  4HAY B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...