4HAZB

Crystal structure of crm1 inhibitor leptomycin b in complex with crm1(r543s,k548e,k579q)-ran-ranbp1
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
121
structure length
121
Chain Sequence
b'EEDEEVLYKVRAKLFRFDKDAKEWKERGTGDCKFLKNKKTNKVRILMRRDKTLKICANHIIAPEYTLKPNVGSDRSWVYACTADIAEGEAEAFTFAIRFGSKENADKFKEEFEKAQEINKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTP-binding nuclear protein Ran
molecule tags Protein transport/antibiotic
source organism Homo sapiens
publication title Nuclear export inhibition through covalent conjugation and hydrolysis of Leptomycin B by CRM1.
pubmed doi rcsb
total genus 35
structure length 121
sequence length 121
ec nomenclature
pdb deposition date 2012-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00638 Ran_BP1 RanBP1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4hazB00
2ROVA 3RCPA 5J3TA 2P0DA 1GG3A 5DH9B 2HTHB 1FGYA 2HE7A 2BCJA 3MPXA 4L6EA 1V61A 1WJ1A 2ZPYA 2X18A 1B55A 1TXDA 3CXBB 4KHAA 2DHJA 3FM8C 3TFMA 1X1FA 2K2UA 1WI1A 3AJ4A 1FAOA 3HW2B 1ZM0A 2Z0PA 2COFA 2DX1A 5JHHA 5KQ1A 4HB0B 2W2XD 4KHBB 4CHMA 2DX5A 4HAUB 3PP2A 4WVFB 4KHOA 5DHFB 2RGNB 2DYQA 2ADZA 2CODA 2D10A 4TKNA 1QQGA 1FOEA 1Q67A 2OQBA 2R0DA 4ZRJA 3U8ZA 1U29A 2D9XA 4DBBA 2COAA 2D9VA 1TQZA 2YS3A 2I1JA 3CIKA 1FHWA 4IAPA 4GZUA 5J3YA 2ELAA 4K17A 1MK9B 5HE0A 1WJMA 4WSFA 3HK0A 2J0JA 2E2XA 1ZC3B 3WA0A 2I5FA 1GC7A 2YS5A 1XCGA 3P6AA 1DBHA 1WGQA 2OTXA 1PLSA 4HB4B 1U27A 4A6KA 3BINA 5D3WA 2RUKB 3TO1A 3QWMA 1J0WA 2EMSA 2Y7BA 3D8DA 1M7EA 3A98B 2M38A 1ZVRA 1SGHA 1P5TA 2DYNA 3ZDTA 3TVVA 1DROA 5FI1A 2MFQA 2EJ8A 2DLWA 2Z0OA 3SYXA 2P0FA 1W1HA 3U7DA 4MY6A 5C5BA 3IVFA 4EJNA 5D3YA 2YVCA 4P7IA 2DKPA 4K2PA 4NSWA 2ELBA 5C5BB 4XWXA 4GXBA 1ZC4B 2D11A 2D9YA 2PZ1A 3QBVB 2D9ZA 4PQ0A 1SHCA 2P0HA 1BAKA 2LULA 5GOWB 1ISNA 2NZ8B 5C79A 1H4RA 2EMTA 2Y8FA 3X23A 2AL6A 3PVWA 1EGXA 4K2OA 2UZSA 1FB8A 4A6FA 4H8SA 2FJLA 2CRFA 3ODXA 1X11A 1K5GB 4A5KA 1V89A 1BWNA 1GC6A 4EKUA 3BJIA 2RSGA 4NY0A 2COCA 5LONB 3HQCA 3LJUX 2YT1A 2D4QA 1U5FA 2Y8GA 2KGXB 5JHGA 1Y5OA 4K81A 3OANA 1P3RA 3DXCA 4WJ7A 4ZRIA 3TW1A 3KZ1A 2P8VA 2KCJA 2YRYA 1I7AA 2J0MA 3FSSA 5JLJB 1AWEA 4HATB 2LG1A 1KZ7A 2DA0A 1Z87A 2EC1A 1UPQA 4DX8A 2L2IA 2MDXA 5CLQB 1J19A 2CY5A 1V5UA 2MWNB 3D8EA 5DIFB 2K2JA 2DKQA 3PEGA 1MPHA 2K00A 3NSUA 4YL8A 2DTCA 2DHIA 1U5GA 1U2BA 1EF1A 5LOPB 3VIAA 2J0KA 1V5MA 1FHOA 2IFSA 2N0YA 1DDMA 3PVLA 2Z0QA 3P7ZA 2KUPA 2YS1A 4MK0A 1WG7A 1UEFA 4MT7A 5HE2A 2LOXA 3M1IB 1M7RA 1WVHA 1BTNA 2XQNM 2IYBA 5EFXA 1MAIA 4IOYX 3MDBC 1XR0B 1BTKA 2D2QA 2QKMA 2JP2A 4A6HA 2R09A 1XD4A 1P6SA 1I2HA 4DXAB 1RRPB 2GJYA 2LKOA 1X1GA 2DN6A 4GN1A 3ML4A 4HAXB 2VRWB 4KAXB 2Q13A 5L81A 4PNKA 1ZSQA 1U5DA 1K5DB 2H7DA 1E5WA 3TCAA 2I5CA 1PFJA 5HE1A 2RLOA 3KSYA 2YSZA 4HAYB 3ULBA 2MKRA 3F0WA 1OQNA 2M14A 1X86A 4HB3B 4HAZB 2J59M 4HDQA 5D3XA 5J3QA 3GYOA 2N23A 5C6RA 4HAWB 1QC6A 3D8FA 2UVMA 2VKIA 5KQ4A 1MK7B 1NTYA 4HB2B 1AQCA 1PMSA 3KRXA 4ZRKA 4Z2NA 3ULCA 4GMVA 1DDWA 1H10A 3VOQA 3FEHA 2UZRA 2V76A 2W2XC 2L1CA 3AU5A 2RVBB 3A8QA 4HAVB 1UPRA 2NMBA 1N3HA 1OMWA 1EVHA 5DHAB 1U5EA 2G35A 3KRWA 5HE3A 1NU2A 1KI1B 4GPTB 2ROZB 4EMOA 4A6FB 3PSCA 5C16A 3G9WA 3SO6A 4HDOA 3PG7A 5D3VA 2GCLA 2VSZA 5DI9B 1MIZB 4TYZA 1OY2A 1X05A 1WGUA 4D0NB 3SUZA 1XODA 2RNRB 3DXDA 1MKEA 2H7EA 3V5WA 4Y94A 3KY9A 1FGZA 3SNHA 2CAYA 4B6HA 4F7GA 1Y19B 1KZGA 2LOZA 1XKEA 3AU4A 1LW3A 5FI0A 1NI2A 4YONA 2I1KA 4DX90 3ODWA 4KVGB 4F7UP 3O96A 2AEHA 2CY4A 3GYPA 3PVUA 3A8PA 1IRSA 4IFSA 1UNQA 1MIXA 2DFKA 1W1DA 1XX0A 4F7HA 2QKLA 2GS0A 1NTVA 3ODOA 1RJ2A 1W1GA 2D9WA 4HHVA 3T06A 4Z2MB 2GCJA 3N7CA 5KCVA 1UNRA 1V5PA 3QIJA 3PZDA 1UNPA 5CLLB 4C0AA 3DXEA 3ZVRA 3SV1A 1DDVA 2YT0A 2YF0A 1LB1A 1V88A 5D27A 2W2WA 4CHJA 1TJ6A 3UZTA 1FHXA 5JP4A 3WYFB 4BBKA 2DHKA 4GMXB 3F5RA 1EAZA 1DYNA 4CYEA 2LYDA
chains in the Genus database with same CATH superfamily
2ROVA 2Z4DA 3RCPA 5J3TA 2P0DA 1GG3A 5DH9B 2HTHB 1FGYA 2HE7A 2BCJA 3MPXA 3U12A 4L6EA 1V61A 1WJ1A 2ZPYA 2X18A 1B55A 4QJ3B 1TXDA 3CXBB 4KHAA 2DHJA 3FM8C 3TFMA 1X1FA 2K2UA 3HIEA 1WI1A 3AJ4A 1FAOA 3HW2B 1ZM0A 2Z0PA 2COFA 2DX1A 5JHHA 5KQ1A 4HB0B 2W2XD 4KHBB 4CHMA 2DX5A 4HAUB 4DIXA 3PP2A 4WVFB 4KHOA 5DHFB 2RGNB 2DYQA 2ADZA 2CODA 2D10A 4TKNA 3NWFA 1QQGA 1FOEA 1Q67A 2OQBA 2R0DA 4ZRJA 3U8ZA 1U29A 2D9XA 4DBBA 2COAA 2D9VA 1TQZA 3NWAA 2GUMA 2YS3A 2I1JA 3CIKA 1FHWA 4IAPA 4OSNA 4GZUA 5J3YA 2ELAA 4K17A 1MK9B 5HE0A 1WJMA 4WSFA 3HK0A 2J0JA 2E2XA 1ZC3B 3WA0A 2I5FA 1GC7A 2YS5A 1XCGA 3P6AA 1DBHA 1WGQA 2OTXA 1PLSA 4HB4B 1U27A 4A6KA 2Z59A 3BINA 5D3WA 2RUKB 3TO1A 3QWMA 1J0WA 2EMSA 2Y7BA 3D8DA 1M7EA 3A98B 2M38A 2KUQA 1ZVRA 1SGHA 3NWDA 1P5TA 2DYNA 3ZDTA 3TVVA 1DROA 5FI1A 3DCXA 2MFQA 2EJ8A 2DLWA 2Z0OA 3SYXA 2RRFA 2P0FA 1W1HA 3U7DA 4MY6A 5C5BA 1ZYIA 3IVFA 4EJNA 5D3YA 2YVCA 4P7IA 2DKPA 4K2PA 4NSWA 2ELBA 5C5BB 4XWXA 4GXBA 1ZC4B 2D11A 2D9YA 2PZ1A 3QBVB 2D9ZA 4PQ0A 1SHCA 2P0HA 1BAKA 2LULA 5GOWB 5M4YB 1ISNA 2NZ8B 5C79A 1H4RA 2EMTA 2Y8FA 3X23A 2AL6A 3PVWA 1EGXA 4K2OA 2UZSA 3A58A 1FB8A 4A6FA 4H8SA 2FJLA 2CRFA 3HSAA 3ODXA 1X11A 1K5GB 4A5KA 1V89A 1BWNA 1GC6A 4EKUA 3BJIA 5I2SA 2RSGA 4NY0A 2COCA 5LONB 3HQCA 3LJUX 2YT1A 2D4QA 1MI1A 1U5FA 2Y8GA 4QJ5B 2KGXB 2R2YA 5JHGA 1Y5OA 4L1RA 4K81A 3OANA 2K8EA 1P3RA 3DXCA 4WJ7A 4ZRIA 2KR0A 3TW1A 3KZ1A 2KIEA 2P8VA 2KCJA 2YRYA 1I7AA 2J0MA 3FSSA 5JLJB 1AWEA 4HATB 2LG1A 1KZ7A 2DA0A 1Z87A 2EC1A 1UPQA 4DX8A 2L2IA 2MDXA 5CLQB 1J19A 2CY5A 1V5UA 2MWNB 3D8EA 5DIFB 2K2JA 2DKQA 3PEGA 1MPHA 2K00A 3NSUA 4YL8A 2DTCA 2DHIA 2YT2A 1U5GA 1U2BA 1EF1A 5LOPB 3VIAA 2J0KA 1V5MA 1FHOA 2IFSA 2N0YA 1DDMA 3PVLA 2Z0QA 2KIGA 5I2MA 3P7ZA 2KUPA 2YS1A 4MK0A 1WG7A 1UEFA 4MT7A 5HE2A 2LOXA 3M1IB 4QXAB 1M7RA 1WVHA 4D6WA 1BTNA 2XQNM 2IYBA 4GNKB 4HSIA 5EFXA 1MAIA 4IOYX 3MDBC 1XR0B 1BTKA 2D2QA 2QKMA 2JP2A 4A6HA 2R09A 1XD4A 1P6SA 1I2HA 4DXAB 1RRPB 2GJYA 2LKOA 1X1GA 2DN6A 4GN1A 3ML4A 4HAXB 2VRWB 2Z14A 4QJ4B 4KAXB 2Q13A 5L81A 4PNKA 5IRSA 1ZSQA 1U5DA 2ZKMX 1K5DB 2H7DA 1E5WA 3TCAA 2I5CA 1PFJA 5HE1A 2RLOA 3KSYA 2YSZA 4HAYB 3ULBA 2MKRA 3F0WA 1OQNA 2M14A 1X86A 4HB3B 4HAZB 2J59M 4HDQA 4CSQA 4KHBA 5D3XA 5J3QA 3GYOA 2N23A 5C6RA 4HAWB 1QC6A 3D8FA 3NW8A 2UVMA 2VKIA 5KQ4A 1MK7B 1NTYA 4HB2B 1AQCA 1PMSA 3KRXA 4ZRKA 4Z2NA 3ULCA 4GMVA 1DDWA 1H10A 3VOQA 3FEHA 1T77A 2UZRA 2V76A 3FVCA 2W2XC 2L1CA 2NBVA 3AU5A 2RVBB 3A8QA 4HAVB 1UPRA 2NMBA 4GOUA 1N3HA 1OMWA 1EVHA 5DHAB 1U5EA 2G35A 3KRWA 5HE3A 1NU2A 1KI1B 4GPTB 2ROZB 4EMOA 4A6FB 3PSCA 5C16A 3G9WA 3SO6A 4HDOA 3PG7A 5D3VA 2GCLA 2VSZA 5DI9B 1MIZB 4TYZA 1OY2A 1X05A 1WGUA 4D0NB 3SUZA 2K49A 1XODA 2RNRB 3DXDA 2Z13A 4OT1A 1MKEA 3OHMB 2H7EA 3V5WA 4Y94A 3KY9A 1FGZA 3SNHA 2CAYA 4B6HA 4F7GA 1Y19B 1KZGA 2LOZA 1XKEA 3AU4A 1LW3A 5FI0A 1NI2A 4YONA 2I1KA 4DX90 3ODWA 4KVGB 4F7UP 3O96A 2AEHA 2CY4A 3GYPA 3PVUA 3A8PA 1IRSA 4IFSA 1UNQA 1MIXA 2DFKA 1W1DA 1XX0A 4F7HA 2QKLA 2GS0A 1NTVA 3ODOA 1RJ2A 1W1GA 2D9WA 4HHVA 3T06A 4Z2MB 3B77A 2GCJA 3N7CA 5KCVA 1UNRA 1V5PA 3QIJA 3PZDA 1UNPA 5CLLB 4C0AA 3DXEA 3ZVRA 3SV1A 1DDVA 2YT0A 2YF0A 1LB1A 5LG4B 1V88A 5D27A 2W2WA 4CHJA 1TJ6A 3UZTA 1FHXA 5JP4A 3WYFB 4BBKA 2DHKA 4GMXB 3F5RA 1EAZA 1DYNA 4CYEA 2FJUB 2LYDA
chains in the Genus database with same CATH topology
2ROVA 3RCPA 5J3TA 2P0DA 1GG3A 5DH9B 2HTHB 1FGYA 2HE7A 2BCJA 3MPXA 4L6EA 1V61A 1WJ1A 2ZPYA 2X18A 1B55A 1TXDA 3CXBB 4KHAA 2DHJA 3FM8C 3TFMA 1X1FA 2K2UA 1WI1A 3AJ4A 1FAOA 3HW2B 1ZM0A 2Z0PA 2COFA 2DX1A 5JHHA 5KQ1A 4HB0B 2W2XD 4KHBB 4CHMA 2DX5A 4HAUB 3PP2A 4WVFB 4KHOA 5DHFB 2RGNB 2DYQA 2ADZA 2CODA 2D10A 4TKNA 1QQGA 1FOEA 1Q67A 2OQBA 2R0DA 4ZRJA 3U8ZA 1U29A 2D9XA 4DBBA 2COAA 2D9VA 1TQZA 2YS3A 2I1JA 3CIKA 1FHWA 4IAPA 4GZUA 5J3YA 2ELAA 4K17A 1MK9B 5HE0A 1WJMA 4WSFA 3HK0A 2J0JA 2E2XA 1ZC3B 3WA0A 2I5FA 1GC7A 2YS5A 1XCGA 3P6AA 1DBHA 1WGQA 2OTXA 1PLSA 4HB4B 1U27A 4A6KA 3BINA 5D3WA 2RUKB 3TO1A 3QWMA 1J0WA 2EMSA 2Y7BA 3D8DA 1M7EA 3A98B 2M38A 1ZVRA 1SGHA 1P5TA 2DYNA 3ZDTA 3TVVA 1DROA 5FI1A 2MFQA 2EJ8A 2DLWA 2Z0OA 3SYXA 2P0FA 1W1HA 3U7DA 4MY6A 5C5BA 3IVFA 4EJNA 5D3YA 2YVCA 4P7IA 2DKPA 4K2PA 4NSWA 2ELBA 5C5BB 4XWXA 4GXBA 1ZC4B 2D11A 2D9YA 2PZ1A 3QBVB 2D9ZA 4PQ0A 1SHCA 2P0HA 1BAKA 2LULA 5GOWB 1ISNA 2NZ8B 5C79A 1H4RA 2EMTA 2Y8FA 3X23A 2AL6A 3PVWA 1EGXA 4K2OA 2UZSA 1FB8A 4A6FA 4H8SA 2FJLA 2CRFA 3ODXA 1X11A 1K5GB 4A5KA 1V89A 1BWNA 1GC6A 4EKUA 3BJIA 2RSGA 4NY0A 2COCA 5LONB 3HQCA 3LJUX 2YT1A 2D4QA 1U5FA 2Y8GA 2KGXB 5JHGA 1Y5OA 4K81A 3OANA 1P3RA 3DXCA 4WJ7A 4ZRIA 3TW1A 3KZ1A 2P8VA 2KCJA 2YRYA 1I7AA 2J0MA 3FSSA 5JLJB 1AWEA 4HATB 2LG1A 1KZ7A 2DA0A 1Z87A 2EC1A 1UPQA 4DX8A 2L2IA 2MDXA 5CLQB 1J19A 2CY5A 1V5UA 2MWNB 3D8EA 5DIFB 2K2JA 2DKQA 3PEGA 1MPHA 2K00A 3NSUA 4YL8A 2DTCA 2DHIA 1U5GA 1U2BA 1EF1A 5LOPB 3VIAA 2J0KA 1V5MA 1FHOA 2IFSA 2N0YA 1DDMA 3PVLA 2Z0QA 3P7ZA 2KUPA 2YS1A 4MK0A 1WG7A 1UEFA 4MT7A 5HE2A 2LOXA 3M1IB 1M7RA 1WVHA 1BTNA 2XQNM 2IYBA 5EFXA 1MAIA 4IOYX 3MDBC 1XR0B 1BTKA 2D2QA 2QKMA 2JP2A 4A6HA 2R09A 1XD4A 1P6SA 1I2HA 4DXAB 1RRPB 2GJYA 2LKOA 1X1GA 2DN6A 4GN1A 3ML4A 4HAXB 2VRWB 4KAXB 2Q13A 5L81A 4PNKA 1ZSQA 1U5DA 1K5DB 2H7DA 1E5WA 3TCAA 2I5CA 1PFJA 5HE1A 2RLOA 3KSYA 2YSZA 4HAYB 3ULBA 2MKRA 3F0WA 1OQNA 2M14A 1X86A 4HB3B 4HAZB 2J59M 4HDQA 5D3XA 5J3QA 3GYOA 2N23A 5C6RA 4HAWB 1QC6A 3D8FA 2UVMA 2VKIA 5KQ4A 1MK7B 1NTYA 4HB2B 1AQCA 1PMSA 3KRXA 4ZRKA 4Z2NA 3ULCA 4GMVA 1DDWA 1H10A 3VOQA 3FEHA 2UZRA 2V76A 2W2XC 2L1CA 3AU5A 2RVBB 3A8QA 4HAVB 1UPRA 2NMBA 1N3HA 1OMWA 1EVHA 5DHAB 1U5EA 2G35A 3KRWA 5HE3A 1NU2A 1KI1B 4GPTB 2ROZB 4EMOA 4A6FB 3PSCA 5C16A 3G9WA 3SO6A 4HDOA 3PG7A 5D3VA 2GCLA 2VSZA 5DI9B 1MIZB 4TYZA 1OY2A 1X05A 1WGUA 4D0NB 3SUZA 1XODA 2RNRB 3DXDA 1MKEA 2H7EA 3V5WA 4Y94A 3KY9A 1FGZA 3SNHA 2CAYA 4B6HA 4F7GA 1Y19B 1KZGA 2LOZA 1XKEA 3AU4A 1LW3A 5FI0A 1NI2A 4YONA 2I1KA 4DX90 3ODWA 4KVGB 4F7UP 3O96A 2AEHA 2CY4A 3GYPA 3PVUA 3A8PA 1IRSA 4IFSA 1UNQA 1MIXA 2DFKA 1W1DA 1XX0A 4F7HA 2QKLA 2GS0A 1NTVA 3ODOA 1RJ2A 1W1GA 2D9WA 4HHVA 3T06A 4Z2MB 2GCJA 3N7CA 5KCVA 1UNRA 1V5PA 3QIJA 3PZDA 1UNPA 5CLLB 4C0AA 3DXEA 3ZVRA 3SV1A 1DDVA 2YT0A 2YF0A 1LB1A 1V88A 5D27A 2W2WA 4CHJA 1TJ6A 3UZTA 1FHXA 5JP4A 3WYFB 4BBKA 2DHKA 4GMXB 3F5RA 1EAZA 1DYNA 4CYEA 2LYDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ROV A;  3RCP A;  5J3T A;  2P0D A;  1GG3 A;  5DH9 B;  2HTH B;  1FGY A;  2HE7 A;  2BCJ A;  3MPX A;  4L6E A;  1V61 A;  1WJ1 A;  2ZPY A;  2X18 A;  1B55 A;  1TXD A;  3CXB B;  4KHA A;  2DHJ A;  3FM8 C;  3TFM A;  1X1F A;  2K2U A;  1WI1 A;  3AJ4 A;  1FAO A;  3HW2 B;  1ZM0 A;  2Z0P A;  2COF A;  2DX1 A;  5JHH A;  5KQ1 A;  4HB0 B;  2W2X D;  4KHB B;  4CHM A;  2DX5 A;  4HAU B;  3PP2 A;  4WVF B;  4KHO A;  5DHF B;  2RGN B;  2DYQ A;  2ADZ A;  2COD A;  2D10 A;  4TKN A;  1QQG A;  1FOE A;  1Q67 A;  2OQB A;  2R0D A;  4ZRJ A;  3U8Z A;  1U29 A;  2D9X A;  4DBB A;  2COA A;  2D9V A;  1TQZ A;  2YS3 A;  2I1J A;  3CIK A;  1FHW A;  4IAP A;  4GZU A;  5J3Y A;  2ELA A;  4K17 A;  1MK9 B;  5HE0 A;  1WJM A;  4WSF A;  3HK0 A;  2J0J A;  2E2X A;  1ZC3 B;  3WA0 A;  2I5F A;  1GC7 A;  2YS5 A;  1XCG A;  3P6A A;  1DBH A;  1WGQ A;  2OTX A;  1PLS A;  4HB4 B;  1U27 A;  4A6K A;  3BIN A;  5D3W A;  2RUK B;  3TO1 A;  3QWM A;  1J0W A;  2EMS A;  2Y7B A;  3D8D A;  1M7E A;  3A98 B;  2M38 A;  1ZVR A;  1SGH A;  1P5T A;  2DYN A;  3ZDT A;  3TVV A;  1DRO A;  5FI1 A;  2MFQ A;  2EJ8 A;  2DLW A;  2Z0O A;  3SYX A;  2P0F A;  1W1H A;  3U7D A;  4MY6 A;  5C5B A;  3IVF A;  4EJN A;  5D3Y A;  2YVC A;  4P7I A;  2DKP A;  4K2P A;  4NSW A;  2ELB A;  5C5B B;  4XWX A;  4GXB A;  1ZC4 B;  2D11 A;  2D9Y A;  2PZ1 A;  3QBV B;  2D9Z A;  4PQ0 A;  1SHC A;  2P0H A;  1BAK A;  2LUL A;  5GOW B;  1ISN A;  2NZ8 B;  5C79 A;  1H4R A;  2EMT A;  2Y8F A;  3X23 A;  2AL6 A;  3PVW A;  1EGX A;  4K2O A;  2UZS A;  1FB8 A;  4A6F A;  4H8S A;  2FJL A;  2CRF A;  3ODX A;  1X11 A;  1K5G B;  4A5K A;  1V89 A;  1BWN A;  1GC6 A;  4EKU A;  3BJI A;  2RSG A;  4NY0 A;  2COC A;  5LON B;  3HQC A;  3LJU X;  2YT1 A;  2D4Q A;  1U5F A;  2Y8G A;  2KGX B;  5JHG A;  1Y5O A;  4K81 A;  3OAN A;  1P3R A;  3DXC A;  4WJ7 A;  4ZRI A;  3TW1 A;  3KZ1 A;  2P8V A;  2KCJ A;  2YRY A;  1I7A A;  2J0M A;  3FSS A;  5JLJ B;  1AWE A;  4HAT B;  2LG1 A;  1KZ7 A;  2DA0 A;  1Z87 A;  2EC1 A;  1UPQ A;  4DX8 A;  2L2I A;  2MDX A;  5CLQ B;  1J19 A;  2CY5 A;  1V5U A;  2MWN B;  3D8E A;  5DIF B;  2K2J A;  2DKQ A;  3PEG A;  1MPH A;  2K00 A;  3NSU A;  4YL8 A;  2DTC A;  2DHI A;  1U5G A;  1U2B A;  1EF1 A;  5LOP B;  3VIA A;  2J0K A;  1V5M A;  1FHO A;  2IFS A;  2N0Y A;  1DDM A;  3PVL A;  2Z0Q A;  3P7Z A;  2KUP A;  2YS1 A;  4MK0 A;  1WG7 A;  1UEF A;  4MT7 A;  5HE2 A;  2LOX A;  3M1I B;  1M7R A;  1WVH A;  1BTN A;  2XQN M;  2IYB A;  5EFX A;  1MAI A;  4IOY X;  3MDB C;  1XR0 B;  1BTK A;  2D2Q A;  2QKM A;  2JP2 A;  4A6H A;  2R09 A;  1XD4 A;  1P6S A;  1I2H A;  4DXA B;  1RRP B;  2GJY A;  2LKO A;  1X1G A;  2DN6 A;  4GN1 A;  3ML4 A;  4HAX B;  2VRW B;  4KAX B;  2Q13 A;  5L81 A;  4PNK A;  1ZSQ A;  1U5D A;  1K5D B;  2H7D A;  1E5W A;  3TCA A;  2I5C A;  1PFJ A;  5HE1 A;  2RLO A;  3KSY A;  2YSZ A;  4HAY B;  3ULB A;  2MKR A;  3F0W A;  1OQN A;  2M14 A;  1X86 A;  4HB3 B;  4HAZ B;  2J59 M;  4HDQ A;  5D3X A;  5J3Q A;  3GYO A;  2N23 A;  5C6R A;  4HAW B;  1QC6 A;  3D8F A;  2UVM A;  2VKI A;  5KQ4 A;  1MK7 B;  1NTY A;  4HB2 B;  1AQC A;  1PMS A;  3KRX A;  4ZRK A;  4Z2N A;  3ULC A;  4GMV A;  1DDW A;  1H10 A;  3VOQ A;  3FEH A;  2UZR A;  2V76 A;  2W2X C;  2L1C A;  3AU5 A;  2RVB B;  3A8Q A;  4HAV B;  1UPR A;  2NMB A;  1N3H A;  1OMW A;  1EVH A;  5DHA B;  1U5E A;  2G35 A;  3KRW A;  5HE3 A;  1NU2 A;  1KI1 B;  4GPT B;  2ROZ B;  4EMO A;  4A6F B;  3PSC A;  5C16 A;  3G9W A;  3SO6 A;  4HDO A;  3PG7 A;  5D3V A;  2GCL A;  2VSZ A;  5DI9 B;  1MIZ B;  4TYZ A;  1OY2 A;  1X05 A;  1WGU A;  4D0N B;  3SUZ A;  1XOD A;  2RNR B;  3DXD A;  1MKE A;  2H7E A;  3V5W A;  4Y94 A;  3KY9 A;  1FGZ A;  3SNH A;  2CAY A;  4B6H A;  4F7G A;  1Y19 B;  1KZG A;  2LOZ A;  1XKE A;  3AU4 A;  1LW3 A;  5FI0 A;  1NI2 A;  4YON A;  2I1K A;  4DX9 0;  3ODW A;  4KVG B;  4F7U P;  3O96 A;  2AEH A;  2CY4 A;  3GYP A;  3PVU A;  3A8P A;  1IRS A;  4IFS A;  1UNQ A;  1MIX A;  2DFK A;  1W1D A;  1XX0 A;  4F7H A;  2QKL A;  2GS0 A;  1NTV A;  3ODO A;  1RJ2 A;  1W1G A;  2D9W A;  4HHV A;  3T06 A;  4Z2M B;  2GCJ A;  3N7C A;  5KCV A;  1UNR A;  1V5P A;  3QIJ A;  3PZD A;  1UNP A;  5CLL B;  4C0A A;  3DXE A;  3ZVR A;  3SV1 A;  1DDV A;  2YT0 A;  2YF0 A;  1LB1 A;  1V88 A;  5D27 A;  2W2W A;  4CHJ A;  1TJ6 A;  3UZT A;  1FHX A;  5JP4 A;  3WYF B;  4BBK A;  2DHK A;  4GMX B;  3F5R A;  1EAZ A;  1DYN A;  4CYE A;  2LYD A; 
#chains in the Genus database with same CATH topology
 2ROV A;  2Z4D A;  3RCP A;  5J3T A;  2P0D A;  1GG3 A;  5DH9 B;  2HTH B;  1FGY A;  2HE7 A;  2BCJ A;  3MPX A;  3U12 A;  4L6E A;  1V61 A;  1WJ1 A;  2ZPY A;  2X18 A;  1B55 A;  4QJ3 B;  1TXD A;  3CXB B;  4KHA A;  2DHJ A;  3FM8 C;  3TFM A;  1X1F A;  2K2U A;  3HIE A;  1WI1 A;  3AJ4 A;  1FAO A;  3HW2 B;  1ZM0 A;  2Z0P A;  2COF A;  2DX1 A;  5JHH A;  5KQ1 A;  4HB0 B;  2W2X D;  4KHB B;  4CHM A;  2DX5 A;  4HAU B;  4DIX A;  3PP2 A;  4WVF B;  4KHO A;  5DHF B;  2RGN B;  2DYQ A;  2ADZ A;  2COD A;  2D10 A;  4TKN A;  3NWF A;  1QQG A;  1FOE A;  1Q67 A;  2OQB A;  2R0D A;  4ZRJ A;  3U8Z A;  1U29 A;  2D9X A;  4DBB A;  2COA A;  2D9V A;  1TQZ A;  3NWA A;  2GUM A;  2YS3 A;  2I1J A;  3CIK A;  1FHW A;  4IAP A;  4OSN A;  4GZU A;  5J3Y A;  2ELA A;  4K17 A;  1MK9 B;  5HE0 A;  1WJM A;  4WSF A;  3HK0 A;  2J0J A;  2E2X A;  1ZC3 B;  3WA0 A;  2I5F A;  1GC7 A;  2YS5 A;  1XCG A;  3P6A A;  1DBH A;  1WGQ A;  2OTX A;  1PLS A;  4HB4 B;  1U27 A;  4A6K A;  2Z59 A;  3BIN A;  5D3W A;  2RUK B;  3TO1 A;  3QWM A;  1J0W A;  2EMS A;  2Y7B A;  3D8D A;  1M7E A;  3A98 B;  2M38 A;  2KUQ A;  1ZVR A;  1SGH A;  3NWD A;  1P5T A;  2DYN A;  3ZDT A;  3TVV A;  1DRO A;  5FI1 A;  3DCX A;  2MFQ A;  2EJ8 A;  2DLW A;  2Z0O A;  3SYX A;  2RRF A;  2P0F A;  1W1H A;  3U7D A;  4MY6 A;  5C5B A;  1ZYI A;  3IVF A;  4EJN A;  5D3Y A;  2YVC A;  4P7I A;  2DKP A;  4K2P A;  4NSW A;  2ELB A;  5C5B B;  4XWX A;  4GXB A;  1ZC4 B;  2D11 A;  2D9Y A;  2PZ1 A;  3QBV B;  2D9Z A;  4PQ0 A;  1SHC A;  2P0H A;  1BAK A;  2LUL A;  5GOW B;  5M4Y B;  1ISN A;  2NZ8 B;  5C79 A;  1H4R A;  2EMT A;  2Y8F A;  3X23 A;  2AL6 A;  3PVW A;  1EGX A;  4K2O A;  2UZS A;  3A58 A;  1FB8 A;  4A6F A;  4H8S A;  2FJL A;  2CRF A;  3HSA A;  3ODX A;  1X11 A;  1K5G B;  4A5K A;  1V89 A;  1BWN A;  1GC6 A;  4EKU A;  3BJI A;  5I2S A;  2RSG A;  4NY0 A;  2COC A;  5LON B;  3HQC A;  3LJU X;  2YT1 A;  2D4Q A;  1MI1 A;  1U5F A;  2Y8G A;  4QJ5 B;  2KGX B;  2R2Y A;  5JHG A;  1Y5O A;  4L1R A;  4K81 A;  3OAN A;  2K8E A;  1P3R A;  3DXC A;  4WJ7 A;  4ZRI A;  2KR0 A;  3TW1 A;  3KZ1 A;  2KIE A;  2P8V A;  2KCJ A;  2YRY A;  1I7A A;  2J0M A;  3FSS A;  5JLJ B;  1AWE A;  4HAT B;  2LG1 A;  1KZ7 A;  2DA0 A;  1Z87 A;  2EC1 A;  1UPQ A;  4DX8 A;  2L2I A;  2MDX A;  5CLQ B;  1J19 A;  2CY5 A;  1V5U A;  2MWN B;  3D8E A;  5DIF B;  2K2J A;  2DKQ A;  3PEG A;  1MPH A;  2K00 A;  3NSU A;  4YL8 A;  2DTC A;  2DHI A;  2YT2 A;  1U5G A;  1U2B A;  1EF1 A;  5LOP B;  3VIA A;  2J0K A;  1V5M A;  1FHO A;  2IFS A;  2N0Y A;  1DDM A;  3PVL A;  2Z0Q A;  2KIG A;  5I2M A;  3P7Z A;  2KUP A;  2YS1 A;  4MK0 A;  1WG7 A;  1UEF A;  4MT7 A;  5HE2 A;  2LOX A;  3M1I B;  4QXA B;  1M7R A;  1WVH A;  4D6W A;  1BTN A;  2XQN M;  2IYB A;  4GNK B;  4HSI A;  5EFX A;  1MAI A;  4IOY X;  3MDB C;  1XR0 B;  1BTK A;  2D2Q A;  2QKM A;  2JP2 A;  4A6H A;  2R09 A;  1XD4 A;  1P6S A;  1I2H A;  4DXA B;  1RRP B;  2GJY A;  2LKO A;  1X1G A;  2DN6 A;  4GN1 A;  3ML4 A;  4HAX B;  2VRW B;  2Z14 A;  4QJ4 B;  4KAX B;  2Q13 A;  5L81 A;  4PNK A;  5IRS A;  1ZSQ A;  1U5D A;  2ZKM X;  1K5D B;  2H7D A;  1E5W A;  3TCA A;  2I5C A;  1PFJ A;  5HE1 A;  2RLO A;  3KSY A;  2YSZ A;  4HAY B;  3ULB A;  2MKR A;  3F0W A;  1OQN A;  2M14 A;  1X86 A;  4HB3 B;  4HAZ B;  2J59 M;  4HDQ A;  4CSQ A;  4KHB A;  5D3X A;  5J3Q A;  3GYO A;  2N23 A;  5C6R A;  4HAW B;  1QC6 A;  3D8F A;  3NW8 A;  2UVM A;  2VKI A;  5KQ4 A;  1MK7 B;  1NTY A;  4HB2 B;  1AQC A;  1PMS A;  3KRX A;  4ZRK A;  4Z2N A;  3ULC A;  4GMV A;  1DDW A;  1H10 A;  3VOQ A;  3FEH A;  1T77 A;  2UZR A;  2V76 A;  3FVC A;  2W2X C;  2L1C A;  2NBV A;  3AU5 A;  2RVB B;  3A8Q A;  4HAV B;  1UPR A;  2NMB A;  4GOU A;  1N3H A;  1OMW A;  1EVH A;  5DHA B;  1U5E A;  2G35 A;  3KRW A;  5HE3 A;  1NU2 A;  1KI1 B;  4GPT B;  2ROZ B;  4EMO A;  4A6F B;  3PSC A;  5C16 A;  3G9W A;  3SO6 A;  4HDO A;  3PG7 A;  5D3V A;  2GCL A;  2VSZ A;  5DI9 B;  1MIZ B;  4TYZ A;  1OY2 A;  1X05 A;  1WGU A;  4D0N B;  3SUZ A;  2K49 A;  1XOD A;  2RNR B;  3DXD A;  2Z13 A;  4OT1 A;  1MKE A;  3OHM B;  2H7E A;  3V5W A;  4Y94 A;  3KY9 A;  1FGZ A;  3SNH A;  2CAY A;  4B6H A;  4F7G A;  1Y19 B;  1KZG A;  2LOZ A;  1XKE A;  3AU4 A;  1LW3 A;  5FI0 A;  1NI2 A;  4YON A;  2I1K A;  4DX9 0;  3ODW A;  4KVG B;  4F7U P;  3O96 A;  2AEH A;  2CY4 A;  3GYP A;  3PVU A;  3A8P A;  1IRS A;  4IFS A;  1UNQ A;  1MIX A;  2DFK A;  1W1D A;  1XX0 A;  4F7H A;  2QKL A;  2GS0 A;  1NTV A;  3ODO A;  1RJ2 A;  1W1G A;  2D9W A;  4HHV A;  3T06 A;  4Z2M B;  3B77 A;  2GCJ A;  3N7C A;  5KCV A;  1UNR A;  1V5P A;  3QIJ A;  3PZD A;  1UNP A;  5CLL B;  4C0A A;  3DXE A;  3ZVR A;  3SV1 A;  1DDV A;  2YT0 A;  2YF0 A;  1LB1 A;  5LG4 B;  1V88 A;  5D27 A;  2W2W A;  4CHJ A;  1TJ6 A;  3UZT A;  1FHX A;  5JP4 A;  3WYF B;  4BBK A;  2DHK A;  4GMX B;  3F5R A;  1EAZ A;  1DYN A;  4CYE A;  2FJU B;  2LYD A; 
#chains in the Genus database with same CATH homology
 2ROV A;  3RCP A;  5J3T A;  2P0D A;  1GG3 A;  5DH9 B;  2HTH B;  1FGY A;  2HE7 A;  2BCJ A;  3MPX A;  4L6E A;  1V61 A;  1WJ1 A;  2ZPY A;  2X18 A;  1B55 A;  1TXD A;  3CXB B;  4KHA A;  2DHJ A;  3FM8 C;  3TFM A;  1X1F A;  2K2U A;  1WI1 A;  3AJ4 A;  1FAO A;  3HW2 B;  1ZM0 A;  2Z0P A;  2COF A;  2DX1 A;  5JHH A;  5KQ1 A;  4HB0 B;  2W2X D;  4KHB B;  4CHM A;  2DX5 A;  4HAU B;  3PP2 A;  4WVF B;  4KHO A;  5DHF B;  2RGN B;  2DYQ A;  2ADZ A;  2COD A;  2D10 A;  4TKN A;  1QQG A;  1FOE A;  1Q67 A;  2OQB A;  2R0D A;  4ZRJ A;  3U8Z A;  1U29 A;  2D9X A;  4DBB A;  2COA A;  2D9V A;  1TQZ A;  2YS3 A;  2I1J A;  3CIK A;  1FHW A;  4IAP A;  4GZU A;  5J3Y A;  2ELA A;  4K17 A;  1MK9 B;  5HE0 A;  1WJM A;  4WSF A;  3HK0 A;  2J0J A;  2E2X A;  1ZC3 B;  3WA0 A;  2I5F A;  1GC7 A;  2YS5 A;  1XCG A;  3P6A A;  1DBH A;  1WGQ A;  2OTX A;  1PLS A;  4HB4 B;  1U27 A;  4A6K A;  3BIN A;  5D3W A;  2RUK B;  3TO1 A;  3QWM A;  1J0W A;  2EMS A;  2Y7B A;  3D8D A;  1M7E A;  3A98 B;  2M38 A;  1ZVR A;  1SGH A;  1P5T A;  2DYN A;  3ZDT A;  3TVV A;  1DRO A;  5FI1 A;  2MFQ A;  2EJ8 A;  2DLW A;  2Z0O A;  3SYX A;  2P0F A;  1W1H A;  3U7D A;  4MY6 A;  5C5B A;  3IVF A;  4EJN A;  5D3Y A;  2YVC A;  4P7I A;  2DKP A;  4K2P A;  4NSW A;  2ELB A;  5C5B B;  4XWX A;  4GXB A;  1ZC4 B;  2D11 A;  2D9Y A;  2PZ1 A;  3QBV B;  2D9Z A;  4PQ0 A;  1SHC A;  2P0H A;  1BAK A;  2LUL A;  5GOW B;  1ISN A;  2NZ8 B;  5C79 A;  1H4R A;  2EMT A;  2Y8F A;  3X23 A;  2AL6 A;  3PVW A;  1EGX A;  4K2O A;  2UZS A;  1FB8 A;  4A6F A;  4H8S A;  2FJL A;  2CRF A;  3ODX A;  1X11 A;  1K5G B;  4A5K A;  1V89 A;  1BWN A;  1GC6 A;  4EKU A;  3BJI A;  2RSG A;  4NY0 A;  2COC A;  5LON B;  3HQC A;  3LJU X;  2YT1 A;  2D4Q A;  1U5F A;  2Y8G A;  2KGX B;  5JHG A;  1Y5O A;  4K81 A;  3OAN A;  1P3R A;  3DXC A;  4WJ7 A;  4ZRI A;  3TW1 A;  3KZ1 A;  2P8V A;  2KCJ A;  2YRY A;  1I7A A;  2J0M A;  3FSS A;  5JLJ B;  1AWE A;  4HAT B;  2LG1 A;  1KZ7 A;  2DA0 A;  1Z87 A;  2EC1 A;  1UPQ A;  4DX8 A;  2L2I A;  2MDX A;  5CLQ B;  1J19 A;  2CY5 A;  1V5U A;  2MWN B;  3D8E A;  5DIF B;  2K2J A;  2DKQ A;  3PEG A;  1MPH A;  2K00 A;  3NSU A;  4YL8 A;  2DTC A;  2DHI A;  1U5G A;  1U2B A;  1EF1 A;  5LOP B;  3VIA A;  2J0K A;  1V5M A;  1FHO A;  2IFS A;  2N0Y A;  1DDM A;  3PVL A;  2Z0Q A;  3P7Z A;  2KUP A;  2YS1 A;  4MK0 A;  1WG7 A;  1UEF A;  4MT7 A;  5HE2 A;  2LOX A;  3M1I B;  1M7R A;  1WVH A;  1BTN A;  2XQN M;  2IYB A;  5EFX A;  1MAI A;  4IOY X;  3MDB C;  1XR0 B;  1BTK A;  2D2Q A;  2QKM A;  2JP2 A;  4A6H A;  2R09 A;  1XD4 A;  1P6S A;  1I2H A;  4DXA B;  1RRP B;  2GJY A;  2LKO A;  1X1G A;  2DN6 A;  4GN1 A;  3ML4 A;  4HAX B;  2VRW B;  4KAX B;  2Q13 A;  5L81 A;  4PNK A;  1ZSQ A;  1U5D A;  1K5D B;  2H7D A;  1E5W A;  3TCA A;  2I5C A;  1PFJ A;  5HE1 A;  2RLO A;  3KSY A;  2YSZ A;  4HAY B;  3ULB A;  2MKR A;  3F0W A;  1OQN A;  2M14 A;  1X86 A;  4HB3 B;  4HAZ B;  2J59 M;  4HDQ A;  5D3X A;  5J3Q A;  3GYO A;  2N23 A;  5C6R A;  4HAW B;  1QC6 A;  3D8F A;  2UVM A;  2VKI A;  5KQ4 A;  1MK7 B;  1NTY A;  4HB2 B;  1AQC A;  1PMS A;  3KRX A;  4ZRK A;  4Z2N A;  3ULC A;  4GMV A;  1DDW A;  1H10 A;  3VOQ A;  3FEH A;  2UZR A;  2V76 A;  2W2X C;  2L1C A;  3AU5 A;  2RVB B;  3A8Q A;  4HAV B;  1UPR A;  2NMB A;  1N3H A;  1OMW A;  1EVH A;  5DHA B;  1U5E A;  2G35 A;  3KRW A;  5HE3 A;  1NU2 A;  1KI1 B;  4GPT B;  2ROZ B;  4EMO A;  4A6F B;  3PSC A;  5C16 A;  3G9W A;  3SO6 A;  4HDO A;  3PG7 A;  5D3V A;  2GCL A;  2VSZ A;  5DI9 B;  1MIZ B;  4TYZ A;  1OY2 A;  1X05 A;  1WGU A;  4D0N B;  3SUZ A;  1XOD A;  2RNR B;  3DXD A;  1MKE A;  2H7E A;  3V5W A;  4Y94 A;  3KY9 A;  1FGZ A;  3SNH A;  2CAY A;  4B6H A;  4F7G A;  1Y19 B;  1KZG A;  2LOZ A;  1XKE A;  3AU4 A;  1LW3 A;  5FI0 A;  1NI2 A;  4YON A;  2I1K A;  4DX9 0;  3ODW A;  4KVG B;  4F7U P;  3O96 A;  2AEH A;  2CY4 A;  3GYP A;  3PVU A;  3A8P A;  1IRS A;  4IFS A;  1UNQ A;  1MIX A;  2DFK A;  1W1D A;  1XX0 A;  4F7H A;  2QKL A;  2GS0 A;  1NTV A;  3ODO A;  1RJ2 A;  1W1G A;  2D9W A;  4HHV A;  3T06 A;  4Z2M B;  2GCJ A;  3N7C A;  5KCV A;  1UNR A;  1V5P A;  3QIJ A;  3PZD A;  1UNP A;  5CLL B;  4C0A A;  3DXE A;  3ZVR A;  3SV1 A;  1DDV A;  2YT0 A;  2YF0 A;  1LB1 A;  1V88 A;  5D27 A;  2W2W A;  4CHJ A;  1TJ6 A;  3UZT A;  1FHX A;  5JP4 A;  3WYF B;  4BBK A;  2DHK A;  4GMX B;  3F5R A;  1EAZ A;  1DYN A;  4CYE A;  2LYD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...