4HAZB

Crystal structure of crm1 inhibitor leptomycin b in complex with crm1(r543s,k548e,k579q)-ran-ranbp1
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
121
structure length
121
Chain Sequence
EEDEEVLYKVRAKLFRFDKDAKEWKERGTGDCKFLKNKKTNKVRILMRRDKTLKICANHIIAPEYTLKPNVGSDRSWVYACTADIAEGEAEAFTFAIRFGSKENADKFKEEFEKAQEINKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTP-binding nuclear protein Ran
publication title Nuclear export inhibition through covalent conjugation and hydrolysis of Leptomycin B by CRM1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport/antibiotic
total genus 35
structure length 121
sequence length 121
ec nomenclature
pdb deposition date 2012-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00638 Ran_BP1 RanBP1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4hazB00
1Y5OA 5HE2A 1WGQA 3BINA 2I1KA 4C0AA 2K2JA 2COCA 2RLOA 2DYNA 2W2WA 2XQNM 3KY9A 1U5FA 1BAKA 2HE7A 1FOEA 2FJLA 2D4QA 2AEHA 1DBHA 4A6FA 2YSZA 1QQGA 2G35A 1MIZB 1V5MA 2GCLA 4IFSA 4XWXA 2KCJA 2KGXB 1NTVA 2J0KA 1EF1A 1FAOA 1V5UA 3DXEA 4NY0A 1U27A 3TCAA 4HDQA 4P7IA 4Z2NA 1OQNA 4WVFB 1XKEA 2YT1A 3GYOA 4HAWB 1GC7A 1I7AA 3OANA 2IYBA 3D8EA 2D9VA 3F0WA 3ODXA 5L81A 3MDBC 1Y19B 3TFMA 3PZDA 4L6EA 5HE0A 5LOPB 1XODA 2AL6A 1FB8A 5JP4A 1ZSQA 1X86A 3X23A 3RCPA 3QWMA 1FHWA 1H10A 3ODWA 2YVCA 3BJIA 1P5TA 4Y94A 4A6HA 5JLJB 1X05A 4CHMA 4IOYX 3KZ1A 4GXBA 3PP2A 3CXBB 2YS5A 4HAXB 3A98B 2P0HA 2R09A 2ROVA 3A8PA 2I5CA 2CY5A 1MKEA 1MK7B 3PG7A 5C5BA 2K2UA 1ZC3B 3ODOA 4KHOA 1BTKA 4KAXB 2QKLA 1P6SA 3D8DA 3PSCA 3U7DA 1FHOA 1NU2A 1MIXA 1U2BA 4EMOA 3FSSA 5DI9B 3M1IB 2UZSA 1J0WA 1UNPA 4D0NB 3U8ZA 3CIKA 4CHJA 5CLQB 1LW3A 4KHBB 2DHJA 2UVMA 3HQCA 2RSGA 1H4RA 5DIFB 1OY2A 5KQ1A 2D10A 2Y8FA 2BCJA 5D3XA 3FM8C 1DDWA 1XR0B 3A8QA 4GPTB 1LB1A 3MPXA 2I1JA 1U5GA 1NTYA 1V61A 1ZM0A 4HAZB 5J3TA 2DYQA 1EGXA 1X1FA 1EVHA 4HB4B 4B6HA 2CODA 5C79A 2E2XA 2Q13A 1EAZA 2RVBB 4MT7A 2EMTA 3VIAA 2COFA 4PQ0A 1V88A 1V89A 2N23A 2DLWA 5HE3A 4H8SA 4TKNA 3FEHA 1V5PA 4CYEA 4IAPA 2EJ8A 5HE1A 4HAYB 2LULA 5GOWB 4GMXB 3NSUA 5J3QA 3HW2B 2COAA 1MPHA 2P0DA 4K17A 4KVGB 4ZRKA 2GS0A 5FI0A 2EC1A 1BWNA 4GMVA 2DX1A 4GN1A 3ZVRA 1PLSA 3KRWA 1ISNA 1K5GB 4HHVA 2GCJA 1OMWA 2LG1A 1UPQA 5KCVA 5KQ4A 2W2XC 4HAUB 2DX5A 4A5KA 4MK0A 2PZ1A 1UNRA 4KHAA 2DKQA 5D27A 1TJ6A 4F7UP 2ELAA 2GJYA 2P8VA 2J0MA 3ML4A 4TYZA 3PVUA 2DFKA 1KZGA 5CLLB 2M38A 4EJNA 2N0YA 1P3RA 1M7EA 2HTHB 1AQCA 2R0DA 2X18A 2CRFA 1DDVA 2MFQA 3WA0A 3QIJA 2D2QA 5C16A 2RUKB 2Z0PA 1GC6A 4HB3B 2ADZA 3PEGA 1E5WA 1MAIA 4MY6A 3PVWA 4A6KA 1WJMA 2M14A 1B55A 3VOQA 2LKOA 3LJUX 3ZDTA 4HAVB 4YL8A 5D3WA 3TW1A 1WGUA 2MKRA 1N3HA 1SHCA 4HDOA 2VKIA 4K2OA 2RNRB 1K5DB 4EKUA 1DYNA 1Z87A 3SUZA 2OQBA 2IFSA 3D8FA 3TVVA 3DXCA 1X11A 1RRPB 3F5RA 2D11A 1WJ1A 4PNKA 5LONB 3WYFB 2LOXA 1DROA 2DHKA 3G9WA 5D3VA 2D9WA 1Q67A 1PMSA 3TO1A 2YS1A 3KSYA 2MWNB 2ZPYA 2VRWB 4DX8A 2NZ8B 2EMSA 4HB2B 1U5DA 3PVLA 4GZUA 1FGZA 4DBBA 2DKPA 2OTXA 2ROZB 1TXDA 1SGHA 3ULBA 4K2PA 2CAYA 1FGYA 4DX90 3P7ZA 2QKMA 1FHXA 2L1CA 2DHIA 2P0FA 1KI1B 2YS3A 2DTCA 2YT0A 2V76A 4F7GA 4A6FB 3IVFA 2YRYA 4K81A 2DN6A 1WG7A 4HB0B 2L2IA 1XD4A 3AU4A 2YF0A 2MDXA 1UEFA 3SO6A 1KZ7A 1BTNA 1XX0A 1U29A 4ZRJA 4Z2MB 3P6AA 3DXDA 5DHAB 1U5EA 1I2HA 2KUPA 5J3YA 2JP2A 3UZTA 2DA0A 4BBKA 3KRXA 1NI2A 2VSZA 2ELBA 2NMBA 1WI1A 4YONA 1RJ2A 1W1DA 5C6RA 3O96A 1W1GA 3T06A 1IRSA 2Z0OA 3GYPA 3SYXA 5C5BB 2K00A 1ZC4B 1GG3A 2LYDA 3SNHA 4F7HA 4NSWA 1M7RA 4HATB 5EFXA 1TQZA 4WJ7A 5JHHA 1AWEA 2J0JA 1J19A 1W1HA 2LOZA 3QBVB 3N7CA 2H7EA 3HK0A 4ZRIA 3ULCA 1DDMA 1XCGA 4DXAB 5D3YA 1UPRA 2I5FA 1QC6A 1WVHA 3SV1A 2H7DA 4WSFA 2W2XD 3AU5A 1MK9B 2RGNB 2Y7BA 2Z0QA 1ZVRA 5JHGA 3AJ4A 1UNQA 2J59M 5DHFB 5FI1A 2D9YA 2D9ZA 1PFJA 2Y8GA 2D9XA 3V5WA 1X1GA 5DH9B 2UZRA 2CY4A
chains in the Genus database with same CATH superfamily
1Y5OA 5HE2A 1WGQA 3NW8A 3BINA 2I1KA 4C0AA 2K2JA 2COCA 2RLOA 2DYNA 2W2WA 2XQNM 3KY9A 1U5FA 1BAKA 2HE7A 1FOEA 4L1RA 2FJLA 2D4QA 2RRFA 2AEHA 1DBHA 4A6FA 2YSZA 1QQGA 2G35A 1MIZB 1V5MA 3B77A 2GCLA 4IFSA 4XWXA 2KCJA 2KGXB 1NTVA 2J0KA 1EF1A 1FAOA 3HIEA 1V5UA 3DXEA 4NY0A 1U27A 3TCAA 4HDQA 4P7IA 4Z2NA 1OQNA 4WVFB 1XKEA 2YT1A 3GYOA 4HAWB 1GC7A 1I7AA 3OANA 2IYBA 3NWFA 3D8EA 2D9VA 3F0WA 3ODXA 5L81A 3MDBC 1Y19B 3TFMA 4QJ5B 3PZDA 4L6EA 5HE0A 5LOPB 1XODA 2AL6A 1FB8A 5JP4A 1ZSQA 1X86A 3X23A 3RCPA 3QWMA 1FHWA 1H10A 3ODWA 2YVCA 3BJIA 1P5TA 4Y94A 4A6HA 5JLJB 1X05A 4CHMA 4IOYX 3KZ1A 4GXBA 3PP2A 3CXBB 2YS5A 4HAXB 3A98B 2P0HA 2R09A 2ROVA 3A8PA 2I5CA 2CY5A 1MKEA 1MK7B 3PG7A 5C5BA 2K2UA 1ZC3B 3ODOA 4KHOA 1BTKA 4KAXB 2QKLA 1P6SA 3D8DA 2FJUB 3PSCA 3U7DA 1FHOA 1NU2A 1MIXA 1U2BA 4EMOA 3FSSA 5DI9B 3M1IB 2UZSA 1J0WA 1UNPA 4D0NB 3U8ZA 3CIKA 4CHJA 5CLQB 1LW3A 4KHBB 2DHJA 2UVMA 3HQCA 2RSGA 1H4RA 5DIFB 1OY2A 5KQ1A 2D10A 2Y8FA 2BCJA 5D3XA 3FM8C 1DDWA 2Z14A 5M4YB 1XR0B 3A8QA 4GPTB 1LB1A 3MPXA 2I1JA 1U5GA 1NTYA 1V61A 1ZM0A 3U12A 4HAZB 5J3TA 3A58A 2DYQA 1EGXA 5I2MA 1X1FA 2KUQA 1EVHA 4HB4B 4B6HA 2CODA 5C79A 2E2XA 2Q13A 1EAZA 2RVBB 4MT7A 2EMTA 3VIAA 2COFA 4PQ0A 1V88A 1V89A 2N23A 2DLWA 5HE3A 4H8SA 4TKNA 3FEHA 1V5PA 4CYEA 4IAPA 2EJ8A 2KR0A 5HE1A 4HAYB 2LULA 5GOWB 4GMXB 3NSUA 5J3QA 3HW2B 2COAA 1MPHA 2ZKMX 3HSAA 2P0DA 4K17A 4KVGB 4ZRKA 2GS0A 5FI0A 2EC1A 1BWNA 4GMVA 2DX1A 4GN1A 2Z4DA 3ZVRA 4HSIA 1PLSA 3KRWA 1ISNA 1K5GB 4HHVA 2GCJA 1OMWA 2LG1A 1UPQA 5KCVA 5KQ4A 2W2XC 4HAUB 2DX5A 4A5KA 2K49A 2Z59A 4MK0A 2PZ1A 1UNRA 4KHAA 2DKQA 5D27A 1TJ6A 4F7UP 2ELAA 2GJYA 2P8VA 2J0MA 3ML4A 4TYZA 3PVUA 2DFKA 1KZGA 5CLLB 2M38A 4EJNA 2N0YA 1P3RA 4QXAB 1M7EA 2HTHB 1AQCA 2NBVA 2R0DA 2X18A 2CRFA 1DDVA 2MFQA 3WA0A 5I2SA 3QIJA 2D2QA 5C16A 2RUKB 2Z0PA 1GC6A 4HB3B 2ADZA 4OSNA 3PEGA 1E5WA 1MAIA 4MY6A 3PVWA 4A6KA 3FVCA 2KIEA 1WJMA 2M14A 1B55A 3VOQA 2LKOA 3LJUX 3ZDTA 2GUMA 4HAVB 4YL8A 5D3WA 3TW1A 4KHBA 1WGUA 2MKRA 1N3HA 1SHCA 4HDOA 2VKIA 4K2OA 2RNRB 1K5DB 4EKUA 2K8EA 2R2YA 1DYNA 1Z87A 4OT1A 4DIXA 3SUZA 2OQBA 2IFSA 3D8FA 3TVVA 3DXCA 1X11A 1RRPB 3F5RA 2D11A 4D6WA 1WJ1A 4PNKA 5LONB 3DCXA 3WYFB 2LOXA 1DROA 3NWDA 2DHKA 3G9WA 5D3VA 2D9WA 1Q67A 1PMSA 3TO1A 2YS1A 3KSYA 2MWNB 2ZPYA 2VRWB 4DX8A 2NZ8B 2EMSA 4HB2B 1U5DA 3PVLA 4GZUA 1FGZA 4DBBA 1T77A 2DKPA 2OTXA 2ROZB 1TXDA 1SGHA 3ULBA 4K2PA 2CAYA 1FGYA 4DX90 3P7ZA 2Z13A 2QKMA 1ZYIA 1FHXA 3OHMB 2L1CA 2DHIA 2P0FA 1KI1B 2YS3A 2DTCA 2YT0A 2V76A 4F7GA 4A6FB 3IVFA 2YRYA 4K81A 2DN6A 1WG7A 4HB0B 2L2IA 1XD4A 3AU4A 2YF0A 2MDXA 1UEFA 3SO6A 1KZ7A 1BTNA 1XX0A 1U29A 4ZRJA 4Z2MB 3P6AA 4GNKB 3DXDA 5LG4B 5DHAB 1U5EA 1I2HA 2KUPA 5IRSA 5J3YA 2JP2A 3UZTA 2DA0A 4BBKA 3KRXA 1NI2A 2VSZA 4CSQA 2ELBA 2NMBA 1WI1A 4YONA 1RJ2A 1W1DA 5C6RA 3O96A 1W1GA 3T06A 1IRSA 2Z0OA 3GYPA 3SYXA 5C5BB 2K00A 1ZC4B 1GG3A 2LYDA 3SNHA 4F7HA 4NSWA 1M7RA 4HATB 5EFXA 2KIGA 1TQZA 4WJ7A 5JHHA 1AWEA 2J0JA 1J19A 1W1HA 2LOZA 3NWAA 3QBVB 3N7CA 2YT2A 2H7EA 3HK0A 4ZRIA 3ULCA 1DDMA 1XCGA 4DXAB 5D3YA 1UPRA 4QJ3B 4QJ4B 2I5FA 4GOUA 1QC6A 1WVHA 3SV1A 2H7DA 4WSFA 2W2XD 3AU5A 1MK9B 2RGNB 2Y7BA 2Z0QA 1ZVRA 5JHGA 3AJ4A 1UNQA 2J59M 5DHFB 5FI1A 1MI1A 2D9YA 2D9ZA 1PFJA 2Y8GA 2D9XA 3V5WA 1X1GA 5DH9B 2UZRA 2CY4A
chains in the Genus database with same CATH topology
1Y5OA 5HE2A 1WGQA 3BINA 2I1KA 4C0AA 2K2JA 2COCA 2RLOA 2DYNA 2W2WA 2XQNM 3KY9A 1U5FA 1BAKA 2HE7A 1FOEA 2FJLA 2D4QA 2AEHA 1DBHA 4A6FA 2YSZA 1QQGA 2G35A 1MIZB 1V5MA 2GCLA 4IFSA 4XWXA 2KCJA 2KGXB 1NTVA 2J0KA 1EF1A 1FAOA 1V5UA 3DXEA 4NY0A 1U27A 3TCAA 4HDQA 4P7IA 4Z2NA 1OQNA 4WVFB 1XKEA 2YT1A 3GYOA 4HAWB 1GC7A 1I7AA 3OANA 2IYBA 3D8EA 2D9VA 3F0WA 3ODXA 5L81A 3MDBC 1Y19B 3TFMA 3PZDA 4L6EA 5HE0A 5LOPB 1XODA 2AL6A 1FB8A 5JP4A 1ZSQA 1X86A 3X23A 3RCPA 3QWMA 1FHWA 1H10A 3ODWA 2YVCA 3BJIA 1P5TA 4Y94A 4A6HA 5JLJB 1X05A 4CHMA 4IOYX 3KZ1A 4GXBA 3PP2A 3CXBB 2YS5A 4HAXB 3A98B 2P0HA 2R09A 2ROVA 3A8PA 2I5CA 2CY5A 1MKEA 1MK7B 3PG7A 5C5BA 2K2UA 1ZC3B 3ODOA 4KHOA 1BTKA 4KAXB 2QKLA 1P6SA 3D8DA 3PSCA 3U7DA 1FHOA 1NU2A 1MIXA 1U2BA 4EMOA 3FSSA 5DI9B 3M1IB 2UZSA 1J0WA 1UNPA 4D0NB 3U8ZA 3CIKA 4CHJA 5CLQB 1LW3A 4KHBB 2DHJA 2UVMA 3HQCA 2RSGA 1H4RA 5DIFB 1OY2A 5KQ1A 2D10A 2Y8FA 2BCJA 5D3XA 3FM8C 1DDWA 1XR0B 3A8QA 4GPTB 1LB1A 3MPXA 2I1JA 1U5GA 1NTYA 1V61A 1ZM0A 4HAZB 5J3TA 2DYQA 1EGXA 1X1FA 1EVHA 4HB4B 4B6HA 2CODA 5C79A 2E2XA 2Q13A 1EAZA 2RVBB 4MT7A 2EMTA 3VIAA 2COFA 4PQ0A 1V88A 1V89A 2N23A 2DLWA 5HE3A 4H8SA 4TKNA 3FEHA 1V5PA 4CYEA 4IAPA 2EJ8A 5HE1A 4HAYB 2LULA 5GOWB 4GMXB 3NSUA 5J3QA 3HW2B 2COAA 1MPHA 2P0DA 4K17A 4KVGB 4ZRKA 2GS0A 5FI0A 2EC1A 1BWNA 4GMVA 2DX1A 4GN1A 3ZVRA 1PLSA 3KRWA 1ISNA 1K5GB 4HHVA 2GCJA 1OMWA 2LG1A 1UPQA 5KCVA 5KQ4A 2W2XC 4HAUB 2DX5A 4A5KA 4MK0A 2PZ1A 1UNRA 4KHAA 2DKQA 5D27A 1TJ6A 4F7UP 2ELAA 2GJYA 2P8VA 2J0MA 3ML4A 4TYZA 3PVUA 2DFKA 1KZGA 5CLLB 2M38A 4EJNA 2N0YA 1P3RA 1M7EA 2HTHB 1AQCA 2R0DA 2X18A 2CRFA 1DDVA 2MFQA 3WA0A 3QIJA 2D2QA 5C16A 2RUKB 2Z0PA 1GC6A 4HB3B 2ADZA 3PEGA 1E5WA 1MAIA 4MY6A 3PVWA 4A6KA 1WJMA 2M14A 1B55A 3VOQA 2LKOA 3LJUX 3ZDTA 4HAVB 4YL8A 5D3WA 3TW1A 1WGUA 2MKRA 1N3HA 1SHCA 4HDOA 2VKIA 4K2OA 2RNRB 1K5DB 4EKUA 1DYNA 1Z87A 3SUZA 2OQBA 2IFSA 3D8FA 3TVVA 3DXCA 1X11A 1RRPB 3F5RA 2D11A 1WJ1A 4PNKA 5LONB 3WYFB 2LOXA 1DROA 2DHKA 3G9WA 5D3VA 2D9WA 1Q67A 1PMSA 3TO1A 2YS1A 3KSYA 2MWNB 2ZPYA 2VRWB 4DX8A 2NZ8B 2EMSA 4HB2B 1U5DA 3PVLA 4GZUA 1FGZA 4DBBA 2DKPA 2OTXA 2ROZB 1TXDA 1SGHA 3ULBA 4K2PA 2CAYA 1FGYA 4DX90 3P7ZA 2QKMA 1FHXA 2L1CA 2DHIA 2P0FA 1KI1B 2YS3A 2DTCA 2YT0A 2V76A 4F7GA 4A6FB 3IVFA 2YRYA 4K81A 2DN6A 1WG7A 4HB0B 2L2IA 1XD4A 3AU4A 2YF0A 2MDXA 1UEFA 3SO6A 1KZ7A 1BTNA 1XX0A 1U29A 4ZRJA 4Z2MB 3P6AA 3DXDA 5DHAB 1U5EA 1I2HA 2KUPA 5J3YA 2JP2A 3UZTA 2DA0A 4BBKA 3KRXA 1NI2A 2VSZA 2ELBA 2NMBA 1WI1A 4YONA 1RJ2A 1W1DA 5C6RA 3O96A 1W1GA 3T06A 1IRSA 2Z0OA 3GYPA 3SYXA 5C5BB 2K00A 1ZC4B 1GG3A 2LYDA 3SNHA 4F7HA 4NSWA 1M7RA 4HATB 5EFXA 1TQZA 4WJ7A 5JHHA 1AWEA 2J0JA 1J19A 1W1HA 2LOZA 3QBVB 3N7CA 2H7EA 3HK0A 4ZRIA 3ULCA 1DDMA 1XCGA 4DXAB 5D3YA 1UPRA 2I5FA 1QC6A 1WVHA 3SV1A 2H7DA 4WSFA 2W2XD 3AU5A 1MK9B 2RGNB 2Y7BA 2Z0QA 1ZVRA 5JHGA 3AJ4A 1UNQA 2J59M 5DHFB 5FI1A 2D9YA 2D9ZA 1PFJA 2Y8GA 2D9XA 3V5WA 1X1GA 5DH9B 2UZRA 2CY4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y5O A;  5HE2 A;  1WGQ A;  3BIN A;  2I1K A;  4C0A A;  2K2J A;  2COC A;  2RLO A;  2DYN A;  2W2W A;  2XQN M;  3KY9 A;  1U5F A;  1BAK A;  2HE7 A;  1FOE A;  2FJL A;  2D4Q A;  2AEH A;  1DBH A;  4A6F A;  2YSZ A;  1QQG A;  2G35 A;  1MIZ B;  1V5M A;  2GCL A;  4IFS A;  4XWX A;  2KCJ A;  2KGX B;  1NTV A;  2J0K A;  1EF1 A;  1FAO A;  1V5U A;  3DXE A;  4NY0 A;  1U27 A;  3TCA A;  4HDQ A;  4P7I A;  4Z2N A;  1OQN A;  4WVF B;  1XKE A;  2YT1 A;  3GYO A;  4HAW B;  1GC7 A;  1I7A A;  3OAN A;  2IYB A;  3D8E A;  2D9V A;  3F0W A;  3ODX A;  5L81 A;  3MDB C;  1Y19 B;  3TFM A;  3PZD A;  4L6E A;  5HE0 A;  5LOP B;  1XOD A;  2AL6 A;  1FB8 A;  5JP4 A;  1ZSQ A;  1X86 A;  3X23 A;  3RCP A;  3QWM A;  1FHW A;  1H10 A;  3ODW A;  2YVC A;  3BJI A;  1P5T A;  4Y94 A;  4A6H A;  5JLJ B;  1X05 A;  4CHM A;  4IOY X;  3KZ1 A;  4GXB A;  3PP2 A;  3CXB B;  2YS5 A;  4HAX B;  3A98 B;  2P0H A;  2R09 A;  2ROV A;  3A8P A;  2I5C A;  2CY5 A;  1MKE A;  1MK7 B;  3PG7 A;  5C5B A;  2K2U A;  1ZC3 B;  3ODO A;  4KHO A;  1BTK A;  4KAX B;  2QKL A;  1P6S A;  3D8D A;  3PSC A;  3U7D A;  1FHO A;  1NU2 A;  1MIX A;  1U2B A;  4EMO A;  3FSS A;  5DI9 B;  3M1I B;  2UZS A;  1J0W A;  1UNP A;  4D0N B;  3U8Z A;  3CIK A;  4CHJ A;  5CLQ B;  1LW3 A;  4KHB B;  2DHJ A;  2UVM A;  3HQC A;  2RSG A;  1H4R A;  5DIF B;  1OY2 A;  5KQ1 A;  2D10 A;  2Y8F A;  2BCJ A;  5D3X A;  3FM8 C;  1DDW A;  1XR0 B;  3A8Q A;  4GPT B;  1LB1 A;  3MPX A;  2I1J A;  1U5G A;  1NTY A;  1V61 A;  1ZM0 A;  4HAZ B;  5J3T A;  2DYQ A;  1EGX A;  1X1F A;  1EVH A;  4HB4 B;  4B6H A;  2COD A;  5C79 A;  2E2X A;  2Q13 A;  1EAZ A;  2RVB B;  4MT7 A;  2EMT A;  3VIA A;  2COF A;  4PQ0 A;  1V88 A;  1V89 A;  2N23 A;  2DLW A;  5HE3 A;  4H8S A;  4TKN A;  3FEH A;  1V5P A;  4CYE A;  4IAP A;  2EJ8 A;  5HE1 A;  4HAY B;  2LUL A;  5GOW B;  4GMX B;  3NSU A;  5J3Q A;  3HW2 B;  2COA A;  1MPH A;  2P0D A;  4K17 A;  4KVG B;  4ZRK A;  2GS0 A;  5FI0 A;  2EC1 A;  1BWN A;  4GMV A;  2DX1 A;  4GN1 A;  3ZVR A;  1PLS A;  3KRW A;  1ISN A;  1K5G B;  4HHV A;  2GCJ A;  1OMW A;  2LG1 A;  1UPQ A;  5KCV A;  5KQ4 A;  2W2X C;  4HAU B;  2DX5 A;  4A5K A;  4MK0 A;  2PZ1 A;  1UNR A;  4KHA A;  2DKQ A;  5D27 A;  1TJ6 A;  4F7U P;  2ELA A;  2GJY A;  2P8V A;  2J0M A;  3ML4 A;  4TYZ A;  3PVU A;  2DFK A;  1KZG A;  5CLL B;  2M38 A;  4EJN A;  2N0Y A;  1P3R A;  1M7E A;  2HTH B;  1AQC A;  2R0D A;  2X18 A;  2CRF A;  1DDV A;  2MFQ A;  3WA0 A;  3QIJ A;  2D2Q A;  5C16 A;  2RUK B;  2Z0P A;  1GC6 A;  4HB3 B;  2ADZ A;  3PEG A;  1E5W A;  1MAI A;  4MY6 A;  3PVW A;  4A6K A;  1WJM A;  2M14 A;  1B55 A;  3VOQ A;  2LKO A;  3LJU X;  3ZDT A;  4HAV B;  4YL8 A;  5D3W A;  3TW1 A;  1WGU A;  2MKR A;  1N3H A;  1SHC A;  4HDO A;  2VKI A;  4K2O A;  2RNR B;  1K5D B;  4EKU A;  1DYN A;  1Z87 A;  3SUZ A;  2OQB A;  2IFS A;  3D8F A;  3TVV A;  3DXC A;  1X11 A;  1RRP B;  3F5R A;  2D11 A;  1WJ1 A;  4PNK A;  5LON B;  3WYF B;  2LOX A;  1DRO A;  2DHK A;  3G9W A;  5D3V A;  2D9W A;  1Q67 A;  1PMS A;  3TO1 A;  2YS1 A;  3KSY A;  2MWN B;  2ZPY A;  2VRW B;  4DX8 A;  2NZ8 B;  2EMS A;  4HB2 B;  1U5D A;  3PVL A;  4GZU A;  1FGZ A;  4DBB A;  2DKP A;  2OTX A;  2ROZ B;  1TXD A;  1SGH A;  3ULB A;  4K2P A;  2CAY A;  1FGY A;  4DX9 0;  3P7Z A;  2QKM A;  1FHX A;  2L1C A;  2DHI A;  2P0F A;  1KI1 B;  2YS3 A;  2DTC A;  2YT0 A;  2V76 A;  4F7G A;  4A6F B;  3IVF A;  2YRY A;  4K81 A;  2DN6 A;  1WG7 A;  4HB0 B;  2L2I A;  1XD4 A;  3AU4 A;  2YF0 A;  2MDX A;  1UEF A;  3SO6 A;  1KZ7 A;  1BTN A;  1XX0 A;  1U29 A;  4ZRJ A;  4Z2M B;  3P6A A;  3DXD A;  5DHA B;  1U5E A;  1I2H A;  2KUP A;  5J3Y A;  2JP2 A;  3UZT A;  2DA0 A;  4BBK A;  3KRX A;  1NI2 A;  2VSZ A;  2ELB A;  2NMB A;  1WI1 A;  4YON A;  1RJ2 A;  1W1D A;  5C6R A;  3O96 A;  1W1G A;  3T06 A;  1IRS A;  2Z0O A;  3GYP A;  3SYX A;  5C5B B;  2K00 A;  1ZC4 B;  1GG3 A;  2LYD A;  3SNH A;  4F7H A;  4NSW A;  1M7R A;  4HAT B;  5EFX A;  1TQZ A;  4WJ7 A;  5JHH A;  1AWE A;  2J0J A;  1J19 A;  1W1H A;  2LOZ A;  3QBV B;  3N7C A;  2H7E A;  3HK0 A;  4ZRI A;  3ULC A;  1DDM A;  1XCG A;  4DXA B;  5D3Y A;  1UPR A;  2I5F A;  1QC6 A;  1WVH A;  3SV1 A;  2H7D A;  4WSF A;  2W2X D;  3AU5 A;  1MK9 B;  2RGN B;  2Y7B A;  2Z0Q A;  1ZVR A;  5JHG A;  3AJ4 A;  1UNQ A;  2J59 M;  5DHF B;  5FI1 A;  2D9Y A;  2D9Z A;  1PFJ A;  2Y8G A;  2D9X A;  3V5W A;  1X1G A;  5DH9 B;  2UZR A;  2CY4 A; 
#chains in the Genus database with same CATH topology
 1Y5O A;  5HE2 A;  1WGQ A;  3NW8 A;  3BIN A;  2I1K A;  4C0A A;  2K2J A;  2COC A;  2RLO A;  2DYN A;  2W2W A;  2XQN M;  3KY9 A;  1U5F A;  1BAK A;  2HE7 A;  1FOE A;  4L1R A;  2FJL A;  2D4Q A;  2RRF A;  2AEH A;  1DBH A;  4A6F A;  2YSZ A;  1QQG A;  2G35 A;  1MIZ B;  1V5M A;  3B77 A;  2GCL A;  4IFS A;  4XWX A;  2KCJ A;  2KGX B;  1NTV A;  2J0K A;  1EF1 A;  1FAO A;  3HIE A;  1V5U A;  3DXE A;  4NY0 A;  1U27 A;  3TCA A;  4HDQ A;  4P7I A;  4Z2N A;  1OQN A;  4WVF B;  1XKE A;  2YT1 A;  3GYO A;  4HAW B;  1GC7 A;  1I7A A;  3OAN A;  2IYB A;  3NWF A;  3D8E A;  2D9V A;  3F0W A;  3ODX A;  5L81 A;  3MDB C;  1Y19 B;  3TFM A;  4QJ5 B;  3PZD A;  4L6E A;  5HE0 A;  5LOP B;  1XOD A;  2AL6 A;  1FB8 A;  5JP4 A;  1ZSQ A;  1X86 A;  3X23 A;  3RCP A;  3QWM A;  1FHW A;  1H10 A;  3ODW A;  2YVC A;  3BJI A;  1P5T A;  4Y94 A;  4A6H A;  5JLJ B;  1X05 A;  4CHM A;  4IOY X;  3KZ1 A;  4GXB A;  3PP2 A;  3CXB B;  2YS5 A;  4HAX B;  3A98 B;  2P0H A;  2R09 A;  2ROV A;  3A8P A;  2I5C A;  2CY5 A;  1MKE A;  1MK7 B;  3PG7 A;  5C5B A;  2K2U A;  1ZC3 B;  3ODO A;  4KHO A;  1BTK A;  4KAX B;  2QKL A;  1P6S A;  3D8D A;  2FJU B;  3PSC A;  3U7D A;  1FHO A;  1NU2 A;  1MIX A;  1U2B A;  4EMO A;  3FSS A;  5DI9 B;  3M1I B;  2UZS A;  1J0W A;  1UNP A;  4D0N B;  3U8Z A;  3CIK A;  4CHJ A;  5CLQ B;  1LW3 A;  4KHB B;  2DHJ A;  2UVM A;  3HQC A;  2RSG A;  1H4R A;  5DIF B;  1OY2 A;  5KQ1 A;  2D10 A;  2Y8F A;  2BCJ A;  5D3X A;  3FM8 C;  1DDW A;  2Z14 A;  5M4Y B;  1XR0 B;  3A8Q A;  4GPT B;  1LB1 A;  3MPX A;  2I1J A;  1U5G A;  1NTY A;  1V61 A;  1ZM0 A;  3U12 A;  4HAZ B;  5J3T A;  3A58 A;  2DYQ A;  1EGX A;  5I2M A;  1X1F A;  2KUQ A;  1EVH A;  4HB4 B;  4B6H A;  2COD A;  5C79 A;  2E2X A;  2Q13 A;  1EAZ A;  2RVB B;  4MT7 A;  2EMT A;  3VIA A;  2COF A;  4PQ0 A;  1V88 A;  1V89 A;  2N23 A;  2DLW A;  5HE3 A;  4H8S A;  4TKN A;  3FEH A;  1V5P A;  4CYE A;  4IAP A;  2EJ8 A;  2KR0 A;  5HE1 A;  4HAY B;  2LUL A;  5GOW B;  4GMX B;  3NSU A;  5J3Q A;  3HW2 B;  2COA A;  1MPH A;  2ZKM X;  3HSA A;  2P0D A;  4K17 A;  4KVG B;  4ZRK A;  2GS0 A;  5FI0 A;  2EC1 A;  1BWN A;  4GMV A;  2DX1 A;  4GN1 A;  2Z4D A;  3ZVR A;  4HSI A;  1PLS A;  3KRW A;  1ISN A;  1K5G B;  4HHV A;  2GCJ A;  1OMW A;  2LG1 A;  1UPQ A;  5KCV A;  5KQ4 A;  2W2X C;  4HAU B;  2DX5 A;  4A5K A;  2K49 A;  2Z59 A;  4MK0 A;  2PZ1 A;  1UNR A;  4KHA A;  2DKQ A;  5D27 A;  1TJ6 A;  4F7U P;  2ELA A;  2GJY A;  2P8V A;  2J0M A;  3ML4 A;  4TYZ A;  3PVU A;  2DFK A;  1KZG A;  5CLL B;  2M38 A;  4EJN A;  2N0Y A;  1P3R A;  4QXA B;  1M7E A;  2HTH B;  1AQC A;  2NBV A;  2R0D A;  2X18 A;  2CRF A;  1DDV A;  2MFQ A;  3WA0 A;  5I2S A;  3QIJ A;  2D2Q A;  5C16 A;  2RUK B;  2Z0P A;  1GC6 A;  4HB3 B;  2ADZ A;  4OSN A;  3PEG A;  1E5W A;  1MAI A;  4MY6 A;  3PVW A;  4A6K A;  3FVC A;  2KIE A;  1WJM A;  2M14 A;  1B55 A;  3VOQ A;  2LKO A;  3LJU X;  3ZDT A;  2GUM A;  4HAV B;  4YL8 A;  5D3W A;  3TW1 A;  4KHB A;  1WGU A;  2MKR A;  1N3H A;  1SHC A;  4HDO A;  2VKI A;  4K2O A;  2RNR B;  1K5D B;  4EKU A;  2K8E A;  2R2Y A;  1DYN A;  1Z87 A;  4OT1 A;  4DIX A;  3SUZ A;  2OQB A;  2IFS A;  3D8F A;  3TVV A;  3DXC A;  1X11 A;  1RRP B;  3F5R A;  2D11 A;  4D6W A;  1WJ1 A;  4PNK A;  5LON B;  3DCX A;  3WYF B;  2LOX A;  1DRO A;  3NWD A;  2DHK A;  3G9W A;  5D3V A;  2D9W A;  1Q67 A;  1PMS A;  3TO1 A;  2YS1 A;  3KSY A;  2MWN B;  2ZPY A;  2VRW B;  4DX8 A;  2NZ8 B;  2EMS A;  4HB2 B;  1U5D A;  3PVL A;  4GZU A;  1FGZ A;  4DBB A;  1T77 A;  2DKP A;  2OTX A;  2ROZ B;  1TXD A;  1SGH A;  3ULB A;  4K2P A;  2CAY A;  1FGY A;  4DX9 0;  3P7Z A;  2Z13 A;  2QKM A;  1ZYI A;  1FHX A;  3OHM B;  2L1C A;  2DHI A;  2P0F A;  1KI1 B;  2YS3 A;  2DTC A;  2YT0 A;  2V76 A;  4F7G A;  4A6F B;  3IVF A;  2YRY A;  4K81 A;  2DN6 A;  1WG7 A;  4HB0 B;  2L2I A;  1XD4 A;  3AU4 A;  2YF0 A;  2MDX A;  1UEF A;  3SO6 A;  1KZ7 A;  1BTN A;  1XX0 A;  1U29 A;  4ZRJ A;  4Z2M B;  3P6A A;  4GNK B;  3DXD A;  5LG4 B;  5DHA B;  1U5E A;  1I2H A;  2KUP A;  5IRS A;  5J3Y A;  2JP2 A;  3UZT A;  2DA0 A;  4BBK A;  3KRX A;  1NI2 A;  2VSZ A;  4CSQ A;  2ELB A;  2NMB A;  1WI1 A;  4YON A;  1RJ2 A;  1W1D A;  5C6R A;  3O96 A;  1W1G A;  3T06 A;  1IRS A;  2Z0O A;  3GYP A;  3SYX A;  5C5B B;  2K00 A;  1ZC4 B;  1GG3 A;  2LYD A;  3SNH A;  4F7H A;  4NSW A;  1M7R A;  4HAT B;  5EFX A;  2KIG A;  1TQZ A;  4WJ7 A;  5JHH A;  1AWE A;  2J0J A;  1J19 A;  1W1H A;  2LOZ A;  3NWA A;  3QBV B;  3N7C A;  2YT2 A;  2H7E A;  3HK0 A;  4ZRI A;  3ULC A;  1DDM A;  1XCG A;  4DXA B;  5D3Y A;  1UPR A;  4QJ3 B;  4QJ4 B;  2I5F A;  4GOU A;  1QC6 A;  1WVH A;  3SV1 A;  2H7D A;  4WSF A;  2W2X D;  3AU5 A;  1MK9 B;  2RGN B;  2Y7B A;  2Z0Q A;  1ZVR A;  5JHG A;  3AJ4 A;  1UNQ A;  2J59 M;  5DHF B;  5FI1 A;  1MI1 A;  2D9Y A;  2D9Z A;  1PFJ A;  2Y8G A;  2D9X A;  3V5W A;  1X1G A;  5DH9 B;  2UZR A;  2CY4 A; 
#chains in the Genus database with same CATH homology
 1Y5O A;  5HE2 A;  1WGQ A;  3BIN A;  2I1K A;  4C0A A;  2K2J A;  2COC A;  2RLO A;  2DYN A;  2W2W A;  2XQN M;  3KY9 A;  1U5F A;  1BAK A;  2HE7 A;  1FOE A;  2FJL A;  2D4Q A;  2AEH A;  1DBH A;  4A6F A;  2YSZ A;  1QQG A;  2G35 A;  1MIZ B;  1V5M A;  2GCL A;  4IFS A;  4XWX A;  2KCJ A;  2KGX B;  1NTV A;  2J0K A;  1EF1 A;  1FAO A;  1V5U A;  3DXE A;  4NY0 A;  1U27 A;  3TCA A;  4HDQ A;  4P7I A;  4Z2N A;  1OQN A;  4WVF B;  1XKE A;  2YT1 A;  3GYO A;  4HAW B;  1GC7 A;  1I7A A;  3OAN A;  2IYB A;  3D8E A;  2D9V A;  3F0W A;  3ODX A;  5L81 A;  3MDB C;  1Y19 B;  3TFM A;  3PZD A;  4L6E A;  5HE0 A;  5LOP B;  1XOD A;  2AL6 A;  1FB8 A;  5JP4 A;  1ZSQ A;  1X86 A;  3X23 A;  3RCP A;  3QWM A;  1FHW A;  1H10 A;  3ODW A;  2YVC A;  3BJI A;  1P5T A;  4Y94 A;  4A6H A;  5JLJ B;  1X05 A;  4CHM A;  4IOY X;  3KZ1 A;  4GXB A;  3PP2 A;  3CXB B;  2YS5 A;  4HAX B;  3A98 B;  2P0H A;  2R09 A;  2ROV A;  3A8P A;  2I5C A;  2CY5 A;  1MKE A;  1MK7 B;  3PG7 A;  5C5B A;  2K2U A;  1ZC3 B;  3ODO A;  4KHO A;  1BTK A;  4KAX B;  2QKL A;  1P6S A;  3D8D A;  3PSC A;  3U7D A;  1FHO A;  1NU2 A;  1MIX A;  1U2B A;  4EMO A;  3FSS A;  5DI9 B;  3M1I B;  2UZS A;  1J0W A;  1UNP A;  4D0N B;  3U8Z A;  3CIK A;  4CHJ A;  5CLQ B;  1LW3 A;  4KHB B;  2DHJ A;  2UVM A;  3HQC A;  2RSG A;  1H4R A;  5DIF B;  1OY2 A;  5KQ1 A;  2D10 A;  2Y8F A;  2BCJ A;  5D3X A;  3FM8 C;  1DDW A;  1XR0 B;  3A8Q A;  4GPT B;  1LB1 A;  3MPX A;  2I1J A;  1U5G A;  1NTY A;  1V61 A;  1ZM0 A;  4HAZ B;  5J3T A;  2DYQ A;  1EGX A;  1X1F A;  1EVH A;  4HB4 B;  4B6H A;  2COD A;  5C79 A;  2E2X A;  2Q13 A;  1EAZ A;  2RVB B;  4MT7 A;  2EMT A;  3VIA A;  2COF A;  4PQ0 A;  1V88 A;  1V89 A;  2N23 A;  2DLW A;  5HE3 A;  4H8S A;  4TKN A;  3FEH A;  1V5P A;  4CYE A;  4IAP A;  2EJ8 A;  5HE1 A;  4HAY B;  2LUL A;  5GOW B;  4GMX B;  3NSU A;  5J3Q A;  3HW2 B;  2COA A;  1MPH A;  2P0D A;  4K17 A;  4KVG B;  4ZRK A;  2GS0 A;  5FI0 A;  2EC1 A;  1BWN A;  4GMV A;  2DX1 A;  4GN1 A;  3ZVR A;  1PLS A;  3KRW A;  1ISN A;  1K5G B;  4HHV A;  2GCJ A;  1OMW A;  2LG1 A;  1UPQ A;  5KCV A;  5KQ4 A;  2W2X C;  4HAU B;  2DX5 A;  4A5K A;  4MK0 A;  2PZ1 A;  1UNR A;  4KHA A;  2DKQ A;  5D27 A;  1TJ6 A;  4F7U P;  2ELA A;  2GJY A;  2P8V A;  2J0M A;  3ML4 A;  4TYZ A;  3PVU A;  2DFK A;  1KZG A;  5CLL B;  2M38 A;  4EJN A;  2N0Y A;  1P3R A;  1M7E A;  2HTH B;  1AQC A;  2R0D A;  2X18 A;  2CRF A;  1DDV A;  2MFQ A;  3WA0 A;  3QIJ A;  2D2Q A;  5C16 A;  2RUK B;  2Z0P A;  1GC6 A;  4HB3 B;  2ADZ A;  3PEG A;  1E5W A;  1MAI A;  4MY6 A;  3PVW A;  4A6K A;  1WJM A;  2M14 A;  1B55 A;  3VOQ A;  2LKO A;  3LJU X;  3ZDT A;  4HAV B;  4YL8 A;  5D3W A;  3TW1 A;  1WGU A;  2MKR A;  1N3H A;  1SHC A;  4HDO A;  2VKI A;  4K2O A;  2RNR B;  1K5D B;  4EKU A;  1DYN A;  1Z87 A;  3SUZ A;  2OQB A;  2IFS A;  3D8F A;  3TVV A;  3DXC A;  1X11 A;  1RRP B;  3F5R A;  2D11 A;  1WJ1 A;  4PNK A;  5LON B;  3WYF B;  2LOX A;  1DRO A;  2DHK A;  3G9W A;  5D3V A;  2D9W A;  1Q67 A;  1PMS A;  3TO1 A;  2YS1 A;  3KSY A;  2MWN B;  2ZPY A;  2VRW B;  4DX8 A;  2NZ8 B;  2EMS A;  4HB2 B;  1U5D A;  3PVL A;  4GZU A;  1FGZ A;  4DBB A;  2DKP A;  2OTX A;  2ROZ B;  1TXD A;  1SGH A;  3ULB A;  4K2P A;  2CAY A;  1FGY A;  4DX9 0;  3P7Z A;  2QKM A;  1FHX A;  2L1C A;  2DHI A;  2P0F A;  1KI1 B;  2YS3 A;  2DTC A;  2YT0 A;  2V76 A;  4F7G A;  4A6F B;  3IVF A;  2YRY A;  4K81 A;  2DN6 A;  1WG7 A;  4HB0 B;  2L2I A;  1XD4 A;  3AU4 A;  2YF0 A;  2MDX A;  1UEF A;  3SO6 A;  1KZ7 A;  1BTN A;  1XX0 A;  1U29 A;  4ZRJ A;  4Z2M B;  3P6A A;  3DXD A;  5DHA B;  1U5E A;  1I2H A;  2KUP A;  5J3Y A;  2JP2 A;  3UZT A;  2DA0 A;  4BBK A;  3KRX A;  1NI2 A;  2VSZ A;  2ELB A;  2NMB A;  1WI1 A;  4YON A;  1RJ2 A;  1W1D A;  5C6R A;  3O96 A;  1W1G A;  3T06 A;  1IRS A;  2Z0O A;  3GYP A;  3SYX A;  5C5B B;  2K00 A;  1ZC4 B;  1GG3 A;  2LYD A;  3SNH A;  4F7H A;  4NSW A;  1M7R A;  4HAT B;  5EFX A;  1TQZ A;  4WJ7 A;  5JHH A;  1AWE A;  2J0J A;  1J19 A;  1W1H A;  2LOZ A;  3QBV B;  3N7C A;  2H7E A;  3HK0 A;  4ZRI A;  3ULC A;  1DDM A;  1XCG A;  4DXA B;  5D3Y A;  1UPR A;  2I5F A;  1QC6 A;  1WVH A;  3SV1 A;  2H7D A;  4WSF A;  2W2X D;  3AU5 A;  1MK9 B;  2RGN B;  2Y7B A;  2Z0Q A;  1ZVR A;  5JHG A;  3AJ4 A;  1UNQ A;  2J59 M;  5DHF B;  5FI1 A;  2D9Y A;  2D9Z A;  1PFJ A;  2Y8G A;  2D9X A;  3V5W A;  1X1G A;  5DH9 B;  2UZR A;  2CY4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...