2GS0A

Nmr structure of the complex between the ph domain of the tfb1 subunit from tfiih and the activation domain of p53
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
115
structure length
115
Chain Sequence
PSHSGAAIFEKVSGIIAINEDVSPAELTWRSTDGDKVHTVVLSTIDKLQATPASSEKMMLRLIGKVDESKKRKDNEGNEVVPKPQRHMFSFNNRTVMDNIKMTLQQIISRYKDAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the Tfb1/p53 complex: Insights into the interaction between the p62/Tfb1 subunit of TFIIH and the activation domain of p53.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
molecule keywords RNA polymerase II transcription factor B subunit 1
total genus 22
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2006-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08567 PH_TFIIH TFIIH p62 subunit, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2gs0A00
2DLWA 4C0AA 2YS1A 2ROVA 2K2UA 4GMVA 3PVUA 1WVHA 1GC7A 2M14A 1KZGA 3G9WA 1DROA 2P0HA 5KCVA 1BTNA 2W2XD 2KUPA 1U5GA 2DX5A 3TFMA 2UVMA 1SGHA 1RJ2A 4B6HA 4GN1A 1X86A 2P8VA 3FM8C 1W1DA 1X11A 3IVFA 4F7GA 1KI1B 5C5BB 2R0DA 3F5RA 4HB3B 4Y94A 3ML4A 2GCLA 1ZSQA 2K2JA 3ZDTA 2EC1A 3PEGA 1N3HA 2D11A 2D9WA 2Y7BA 1U29A 4F7HA 2PZ1A 2D9ZA 2JP2A 1EAZA 5J3QA 2D9VA 2M38A 2DYNA 2LKOA 2YT1A 4CYEA 4DXAB 3A8PA 2ZPYA 1TQZA 3CXBB 1SHCA 3D8EA 2D9XA 1W1GA 3MPXA 3QBVB 1DBHA 3ODXA 2Q13A 1PMSA 1FAOA 2YVCA 1X1FA 1X1GA 1P5TA 2DFKA 2Z0QA 1ISNA 2J0JA 5HE1A 1MAIA 3AU4A 1WJMA 3QIJA 1PFJA 2Z0OA 3D8FA 2ELBA 2BCJA 1TXDA 2EJ8A 2ELAA 3UZTA 1IRSA 1BTKA 4IFSA 5JLJB 2HTHB 2MDXA 2G35A 5CLQB 3DXEA 3PZDA 2R09A 5HE3A 1K5DB 3TCAA 5DHAB 5C5BA 2XQNM 2CAYA 1TJ6A 4KAXB 4TKNA 2VKIA 1GC6A 2N0YA 3BJIA 2COFA 3U8ZA 2DKPA 5JHGA 3N7CA 2RNRB 1LW3A 1E5WA 2X18A 2D10A 2E2XA 4HAUB 3U7DA 5JHHA 5KQ1A 4CHJA 3TW1A 3PP2A 3F0WA 1I7AA 3WA0A 3HK0A 2L2IA 1PLSA 3X23A 4KHOA 5DI9B 2UZSA 3T06A 4GMXB 1EGXA 3PVWA 4HATB 5LONB 4NSWA 2KGXB 2CY4A 2LOZA 2J0MA 2RSGA 3RCPA 2YF0A 2OTXA 3TO1A 1WI1A 2LG1A 1UEFA 2EMTA 1UPRA 1BAKA 1DDVA 1XKEA 4GXBA 2YRYA 4A6FA 4HHVA 2COAA 4IOYX 2DHKA 2I1KA 2ROZB 4K2OA 4GZUA 4DX8A 1FB8A 5LOPB 2YT0A 4WVFB 1WGUA 2DX1A 4A5KA 1LB1A 3A8QA 5D3VA 3ODOA 5C79A 1EVHA 2NMBA 1WJ1A 4K81A 4HAXB 3MDBC 2HE7A 4HB0B 2I1JA 4YL8A 3PSCA 4ZRJA 5J3TA 4EMOA 1Q67A 3V5WA 1FGZA 1M7RA 3BINA 2P0DA 5J3YA 2RUKB 1NU2A 3SNHA 5D3WA 1P3RA 4HDQA 1V5MA 2I5FA 1I2HA 4F7UP 4HAYB 3VIAA 3KSYA 1U5FA 3SV1A 2LYDA 2DA0A 1NTYA 1XD4A 4Z2MB 4HAWB 5D3YA 5DH9B 2V76A 4PNKA 5JP4A 5EFXA 2ADZA 1Z87A 3O96A 5C16A 2CODA 4H8SA 1MKEA 2DHJA 4A6KA 2EMSA 2LOXA 1Y5OA 4DBBA 4EJNA 1DDWA 3SUZA 1OMWA 3P6AA 1H4RA 1W1HA 3CIKA 4YONA 4HAZB 3KZ1A 4BBKA 1B55A 2VRWB 2K00A 2DHIA 2D4QA 1WG7A 2IYBA 1FHWA 2CRFA 1FGYA 3OANA 1Y19B 2H7EA 1MK7B 2D2QA 5HE0A 2YSZA 2CY5A 1FOEA 3AJ4A 3ZVRA 1UNPA 3HQCA 4KVGB 2D9YA 4KHAA 2N23A 1U5DA 2AEHA 4A6FB 1ZC4B 1MIXA 4ZRKA 2GJYA 3LJUX 4DX90 1V88A 3GYPA 1NI2A 4IAPA 4HAVB 2J0KA 1NTVA 2FJLA 2H7DA 2W2XC 1XX0A 2LULA 2VSZA 5D27A 3WYFB 2KCJA 1V89A 2P0FA 4HB2B 1H10A 3A98B 2RVBB 2W2WA 3FEHA 3FSSA 2MWNB 2QKLA 3NSUA 1X05A 2DN6A 1P6SA 1U5EA 1UNRA 1U2BA 2DYQA 1J0WA 2Y8GA 4MY6A 1WGQA 1XR0B 2GCJA 1OQNA 4MT7A 1FHXA 1UNQA 4PQ0A 4ZRIA 2I5CA 2RLOA 3KRXA 3ULBA 1DDMA 3ULCA 1DYNA 5C6RA 1M7EA 5L81A 5GOWB 3DXCA 1QC6A 1XCGA 1KZ7A 4D0NB 4KHBB 2OQBA 3SYXA 1RRPB 4WJ7A 4NY0A 3P7ZA 3SO6A 1GG3A 3HW2B 1XODA 1ZVRA 2J59M 3DXDA 4A6HA 3M1IB 5DIFB 1V5PA 1UPQA 2YS3A 4P7IA 3GYOA 1V5UA 4HB4B 3PG7A 1BWNA 1MK9B 2MKRA 1J19A 2DTCA 1ZC3B 4MK0A 4HDOA 1AQCA 1EF1A 3D8DA 3TVVA 1ZM0A 2L1CA 1MIZB 4WSFA 5HE2A 2QKMA 4K17A 4Z2NA 3KRWA 4EKUA 1U27A 1MPHA 2RGNB 4XWXA 2GS0A 1V61A 5D3XA 4CHMA 2UZRA 5DHFB 1FHOA 3ODWA 3VOQA 5FI0A 3QWMA 5KQ4A 2MFQA 1K5GB 2Y8FA 1AWEA 4K2PA 1OY2A 2AL6A 4GPTB 4TYZA 4L6EA 3KY9A 2YS5A 3AU5A 2IFSA 2NZ8B 2COCA 1QQGA 5FI1A 3PVLA 5CLLB 2DKQA 2Z0PA
chains in the Genus database with same CATH superfamily
2DLWA 4C0AA 2YS1A 2ROVA 2K2UA 4GMVA 3PVUA 1WVHA 1GC7A 2M14A 2KR0A 1KZGA 3G9WA 1DROA 2P0HA 5KCVA 1BTNA 2W2XD 2KUPA 1U5GA 3DCXA 2DX5A 3TFMA 2UVMA 1SGHA 1RJ2A 4B6HA 4GN1A 1X86A 2P8VA 3FM8C 1W1DA 1X11A 3IVFA 4QXAB 4F7GA 1KI1B 5C5BB 2R0DA 3F5RA 4HB3B 4Y94A 3ML4A 2GCLA 1ZSQA 2K2JA 3ZDTA 2EC1A 3PEGA 4QJ5B 1N3HA 2Z14A 2D11A 2D9WA 2Y7BA 1U29A 4F7HA 2PZ1A 2D9ZA 2JP2A 1EAZA 5J3QA 2D9VA 2M38A 2DYNA 2LKOA 2YT1A 4CYEA 4DXAB 3A8PA 2ZPYA 1TQZA 4QJ4B 3CXBB 1SHCA 3D8EA 2D9XA 1W1GA 3MPXA 3HIEA 3QBVB 3ODXA 1DBHA 2Q13A 1PMSA 1FAOA 2YVCA 1X1FA 1X1GA 1P5TA 4GNKB 2DFKA 2Z13A 2Z0QA 1ISNA 2J0JA 5HE1A 1MAIA 3AU4A 1MI1A 1WJMA 3QIJA 1PFJA 4D6WA 2Z4DA 2KUQA 2Z0OA 3D8FA 2ELBA 2BCJA 1TXDA 2R2YA 2EJ8A 2ELAA 3UZTA 3OHMB 1IRSA 1BTKA 4IFSA 5JLJB 2HTHB 2MDXA 2G35A 5CLQB 3DXEA 3PZDA 2R09A 5HE3A 1K5DB 3TCAA 5DHAB 5C5BA 2XQNM 2CAYA 1TJ6A 4KAXB 4TKNA 2VKIA 1GC6A 2N0YA 3BJIA 2COFA 3U8ZA 2DKPA 5JHGA 3N7CA 2RNRB 1LW3A 4CSQA 1E5WA 2X18A 2D10A 2E2XA 4HAUB 3U7DA 5JHHA 5KQ1A 4CHJA 3TW1A 3PP2A 3F0WA 1I7AA 3WA0A 3FVCA 3HK0A 2L2IA 1PLSA 3X23A 4KHOA 5DI9B 2UZSA 3T06A 4GMXB 1EGXA 3PVWA 4HATB 5LONB 4NSWA 2KGXB 2CY4A 2LOZA 2J0MA 2RSGA 3RCPA 2YF0A 2OTXA 3TO1A 1WI1A 2LG1A 1UEFA 2EMTA 1UPRA 1BAKA 1DDVA 1XKEA 4GXBA 2YRYA 4A6FA 4HHVA 2COAA 4IOYX 4DIXA 2DHKA 2I1KA 2ROZB 2K49A 4K2OA 4GZUA 4DX8A 1FB8A 5LOPB 2YT0A 4WVFB 4L1RA 1WGUA 2DX1A 4A5KA 1LB1A 3A8QA 5D3VA 3ODOA 5C79A 1EVHA 2NMBA 1WJ1A 2Z59A 4K81A 4HAXB 3MDBC 2HE7A 4HB0B 2I1JA 4YL8A 3PSCA 4ZRJA 5J3TA 4EMOA 1Q67A 3V5WA 1FGZA 1M7RA 3BINA 2P0DA 5J3YA 2RUKB 1NU2A 3SNHA 5D3WA 1P3RA 3NWDA 4HDQA 1V5MA 2I5FA 1I2HA 4QJ3B 4F7UP 4HAYB 3VIAA 3KSYA 1U5FA 3SV1A 2LYDA 2DA0A 3NWAA 1NTYA 2FJUB 1XD4A 4Z2MB 4HAWB 5D3YA 5DH9B 2V76A 4PNKA 5I2MA 5JP4A 5EFXA 2ADZA 1Z87A 3O96A 5C16A 2CODA 4H8SA 1MKEA 2DHJA 4A6KA 2EMSA 2LOXA 1Y5OA 4DBBA 5LG4B 4EJNA 1DDWA 3SUZA 1OMWA 3P6AA 1H4RA 1W1HA 3CIKA 4YONA 4HAZB 3KZ1A 4BBKA 1B55A 2VRWB 2K00A 2DHIA 2D4QA 1WG7A 2IYBA 1FHWA 2CRFA 1FGYA 3OANA 1Y19B 2H7EA 1MK7B 2D2QA 5HE0A 2YSZA 2CY5A 1FOEA 3AJ4A 3B77A 1UNPA 3HQCA 4KVGB 3ZVRA 2D9YA 4KHAA 2N23A 1U5DA 2AEHA 4A6FB 1ZC4B 1MIXA 4ZRKA 2GUMA 2GJYA 3LJUX 4DX90 1V88A 4GOUA 3GYPA 1NI2A 4IAPA 4HAVB 2J0KA 1NTVA 2RRFA 2FJLA 2H7DA 2W2XC 2YT2A 1XX0A 2LULA 2VSZA 5D27A 3WYFB 2KCJA 1V89A 2P0FA 4HB2B 1H10A 3A98B 2RVBB 2W2WA 3FEHA 3FSSA 2MWNB 2QKLA 3NSUA 1X05A 2DN6A 1P6SA 1U5EA 1UNRA 1U2BA 2DYQA 3HSAA 1J0WA 5I2SA 2Y8GA 4MY6A 1WGQA 1XR0B 2GCJA 1OQNA 3A58A 4MT7A 1FHXA 1UNQA 1ZYIA 5IRSA 4PQ0A 4ZRIA 3NWFA 2I5CA 2RLOA 3KRXA 2NBVA 4OT1A 3ULCA 3ULBA 1DDMA 1DYNA 5C6RA 1M7EA 5L81A 5GOWB 3DXCA 1QC6A 1XCGA 1KZ7A 4D0NB 4KHBB 2OQBA 3SYXA 4OSNA 1RRPB 4WJ7A 4NY0A 3P7ZA 3SO6A 1GG3A 3HW2B 1XODA 2ZKMX 1ZVRA 2J59M 3DXDA 5M4YB 2KIGA 4A6HA 3M1IB 4HSIA 5DIFB 1V5PA 1UPQA 2YS3A 4P7IA 3GYOA 1V5UA 3NW8A 4HB4B 3PG7A 1BWNA 1MK9B 2MKRA 1J19A 2DTCA 1ZC3B 4MK0A 4HDOA 1AQCA 1EF1A 3D8DA 3TVVA 1ZM0A 2K8EA 2L1CA 1MIZB 2KIEA 4WSFA 5HE2A 2QKMA 4K17A 4Z2NA 3KRWA 4EKUA 1U27A 1MPHA 2RGNB 4XWXA 2GS0A 1V61A 5D3XA 1T77A 4CHMA 3U12A 2UZRA 5DHFB 1FHOA 3ODWA 4KHBA 5FI0A 3VOQA 3QWMA 5KQ4A 2MFQA 1K5GB 2Y8FA 1AWEA 4K2PA 1OY2A 2AL6A 4GPTB 4TYZA 4L6EA 3KY9A 2YS5A 3AU5A 2IFSA 2NZ8B 2COCA 1QQGA 5FI1A 3PVLA 5CLLB 2DKQA 2Z0PA
chains in the Genus database with same CATH topology
2DLWA 4C0AA 2YS1A 2ROVA 2K2UA 4GMVA 3PVUA 1WVHA 1GC7A 2M14A 1KZGA 3G9WA 1DROA 2P0HA 5KCVA 1BTNA 2W2XD 2KUPA 1U5GA 2DX5A 3TFMA 2UVMA 1SGHA 1RJ2A 4B6HA 4GN1A 1X86A 2P8VA 3FM8C 1W1DA 1X11A 3IVFA 4F7GA 1KI1B 5C5BB 2R0DA 3F5RA 4HB3B 4Y94A 3ML4A 2GCLA 1ZSQA 2K2JA 3ZDTA 2EC1A 3PEGA 1N3HA 2D11A 2D9WA 2Y7BA 1U29A 4F7HA 2PZ1A 2D9ZA 2JP2A 1EAZA 5J3QA 2D9VA 2M38A 2DYNA 2LKOA 2YT1A 4CYEA 4DXAB 3A8PA 2ZPYA 1TQZA 3CXBB 1SHCA 3D8EA 2D9XA 1W1GA 3MPXA 3QBVB 1DBHA 3ODXA 2Q13A 1PMSA 1FAOA 2YVCA 1X1FA 1X1GA 1P5TA 2DFKA 2Z0QA 1ISNA 2J0JA 5HE1A 1MAIA 3AU4A 1WJMA 3QIJA 1PFJA 2Z0OA 3D8FA 2ELBA 2BCJA 1TXDA 2EJ8A 2ELAA 3UZTA 1IRSA 1BTKA 4IFSA 5JLJB 2HTHB 2MDXA 2G35A 5CLQB 3DXEA 3PZDA 2R09A 5HE3A 1K5DB 3TCAA 5DHAB 5C5BA 2XQNM 2CAYA 1TJ6A 4KAXB 4TKNA 2VKIA 1GC6A 2N0YA 3BJIA 2COFA 3U8ZA 2DKPA 5JHGA 3N7CA 2RNRB 1LW3A 1E5WA 2X18A 2D10A 2E2XA 4HAUB 3U7DA 5JHHA 5KQ1A 4CHJA 3TW1A 3PP2A 3F0WA 1I7AA 3WA0A 3HK0A 2L2IA 1PLSA 3X23A 4KHOA 5DI9B 2UZSA 3T06A 4GMXB 1EGXA 3PVWA 4HATB 5LONB 4NSWA 2KGXB 2CY4A 2LOZA 2J0MA 2RSGA 3RCPA 2YF0A 2OTXA 3TO1A 1WI1A 2LG1A 1UEFA 2EMTA 1UPRA 1BAKA 1DDVA 1XKEA 4GXBA 2YRYA 4A6FA 4HHVA 2COAA 4IOYX 2DHKA 2I1KA 2ROZB 4K2OA 4GZUA 4DX8A 1FB8A 5LOPB 2YT0A 4WVFB 1WGUA 2DX1A 4A5KA 1LB1A 3A8QA 5D3VA 3ODOA 5C79A 1EVHA 2NMBA 1WJ1A 4K81A 4HAXB 3MDBC 2HE7A 4HB0B 2I1JA 4YL8A 3PSCA 4ZRJA 5J3TA 4EMOA 1Q67A 3V5WA 1FGZA 1M7RA 3BINA 2P0DA 5J3YA 2RUKB 1NU2A 3SNHA 5D3WA 1P3RA 4HDQA 1V5MA 2I5FA 1I2HA 4F7UP 4HAYB 3VIAA 3KSYA 1U5FA 3SV1A 2LYDA 2DA0A 1NTYA 1XD4A 4Z2MB 4HAWB 5D3YA 5DH9B 2V76A 4PNKA 5JP4A 5EFXA 2ADZA 1Z87A 3O96A 5C16A 2CODA 4H8SA 1MKEA 2DHJA 4A6KA 2EMSA 2LOXA 1Y5OA 4DBBA 4EJNA 1DDWA 3SUZA 1OMWA 3P6AA 1H4RA 1W1HA 3CIKA 4YONA 4HAZB 3KZ1A 4BBKA 1B55A 2VRWB 2K00A 2DHIA 2D4QA 1WG7A 2IYBA 1FHWA 2CRFA 1FGYA 3OANA 1Y19B 2H7EA 1MK7B 2D2QA 5HE0A 2YSZA 2CY5A 1FOEA 3AJ4A 3ZVRA 1UNPA 3HQCA 4KVGB 2D9YA 4KHAA 2N23A 1U5DA 2AEHA 4A6FB 1ZC4B 1MIXA 4ZRKA 2GJYA 3LJUX 4DX90 1V88A 3GYPA 1NI2A 4IAPA 4HAVB 2J0KA 1NTVA 2FJLA 2H7DA 2W2XC 1XX0A 2LULA 2VSZA 5D27A 3WYFB 2KCJA 1V89A 2P0FA 4HB2B 1H10A 3A98B 2RVBB 2W2WA 3FEHA 3FSSA 2MWNB 2QKLA 3NSUA 1X05A 2DN6A 1P6SA 1U5EA 1UNRA 1U2BA 2DYQA 1J0WA 2Y8GA 4MY6A 1WGQA 1XR0B 2GCJA 1OQNA 4MT7A 1FHXA 1UNQA 4PQ0A 4ZRIA 2I5CA 2RLOA 3KRXA 3ULBA 1DDMA 3ULCA 1DYNA 5C6RA 1M7EA 5L81A 5GOWB 3DXCA 1QC6A 1XCGA 1KZ7A 4D0NB 4KHBB 2OQBA 3SYXA 1RRPB 4WJ7A 4NY0A 3P7ZA 3SO6A 1GG3A 3HW2B 1XODA 1ZVRA 2J59M 3DXDA 4A6HA 3M1IB 5DIFB 1V5PA 1UPQA 2YS3A 4P7IA 3GYOA 1V5UA 4HB4B 3PG7A 1BWNA 1MK9B 2MKRA 1J19A 2DTCA 1ZC3B 4MK0A 4HDOA 1AQCA 1EF1A 3D8DA 3TVVA 1ZM0A 2L1CA 1MIZB 4WSFA 5HE2A 2QKMA 4K17A 4Z2NA 3KRWA 4EKUA 1U27A 1MPHA 2RGNB 4XWXA 2GS0A 1V61A 5D3XA 4CHMA 2UZRA 5DHFB 1FHOA 3ODWA 3VOQA 5FI0A 3QWMA 5KQ4A 2MFQA 1K5GB 2Y8FA 1AWEA 4K2PA 1OY2A 2AL6A 4GPTB 4TYZA 4L6EA 3KY9A 2YS5A 3AU5A 2IFSA 2NZ8B 2COCA 1QQGA 5FI1A 3PVLA 5CLLB 2DKQA 2Z0PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DLW A;  4C0A A;  2YS1 A;  2ROV A;  2K2U A;  4GMV A;  3PVU A;  1WVH A;  1GC7 A;  2M14 A;  1KZG A;  3G9W A;  1DRO A;  2P0H A;  5KCV A;  1BTN A;  2W2X D;  2KUP A;  1U5G A;  2DX5 A;  3TFM A;  2UVM A;  1SGH A;  1RJ2 A;  4B6H A;  4GN1 A;  1X86 A;  2P8V A;  3FM8 C;  1W1D A;  1X11 A;  3IVF A;  4F7G A;  1KI1 B;  5C5B B;  2R0D A;  3F5R A;  4HB3 B;  4Y94 A;  3ML4 A;  2GCL A;  1ZSQ A;  2K2J A;  3ZDT A;  2EC1 A;  3PEG A;  1N3H A;  2D11 A;  2D9W A;  2Y7B A;  1U29 A;  4F7H A;  2PZ1 A;  2D9Z A;  2JP2 A;  1EAZ A;  5J3Q A;  2D9V A;  2M38 A;  2DYN A;  2LKO A;  2YT1 A;  4CYE A;  4DXA B;  3A8P A;  2ZPY A;  1TQZ A;  3CXB B;  1SHC A;  3D8E A;  2D9X A;  1W1G A;  3MPX A;  3QBV B;  1DBH A;  3ODX A;  2Q13 A;  1PMS A;  1FAO A;  2YVC A;  1X1F A;  1X1G A;  1P5T A;  2DFK A;  2Z0Q A;  1ISN A;  2J0J A;  5HE1 A;  1MAI A;  3AU4 A;  1WJM A;  3QIJ A;  1PFJ A;  2Z0O A;  3D8F A;  2ELB A;  2BCJ A;  1TXD A;  2EJ8 A;  2ELA A;  3UZT A;  1IRS A;  1BTK A;  4IFS A;  5JLJ B;  2HTH B;  2MDX A;  2G35 A;  5CLQ B;  3DXE A;  3PZD A;  2R09 A;  5HE3 A;  1K5D B;  3TCA A;  5DHA B;  5C5B A;  2XQN M;  2CAY A;  1TJ6 A;  4KAX B;  4TKN A;  2VKI A;  1GC6 A;  2N0Y A;  3BJI A;  2COF A;  3U8Z A;  2DKP A;  5JHG A;  3N7C A;  2RNR B;  1LW3 A;  1E5W A;  2X18 A;  2D10 A;  2E2X A;  4HAU B;  3U7D A;  5JHH A;  5KQ1 A;  4CHJ A;  3TW1 A;  3PP2 A;  3F0W A;  1I7A A;  3WA0 A;  3HK0 A;  2L2I A;  1PLS A;  3X23 A;  4KHO A;  5DI9 B;  2UZS A;  3T06 A;  4GMX B;  1EGX A;  3PVW A;  4HAT B;  5LON B;  4NSW A;  2KGX B;  2CY4 A;  2LOZ A;  2J0M A;  2RSG A;  3RCP A;  2YF0 A;  2OTX A;  3TO1 A;  1WI1 A;  2LG1 A;  1UEF A;  2EMT A;  1UPR A;  1BAK A;  1DDV A;  1XKE A;  4GXB A;  2YRY A;  4A6F A;  4HHV A;  2COA A;  4IOY X;  2DHK A;  2I1K A;  2ROZ B;  4K2O A;  4GZU A;  4DX8 A;  1FB8 A;  5LOP B;  2YT0 A;  4WVF B;  1WGU A;  2DX1 A;  4A5K A;  1LB1 A;  3A8Q A;  5D3V A;  3ODO A;  5C79 A;  1EVH A;  2NMB A;  1WJ1 A;  4K81 A;  4HAX B;  3MDB C;  2HE7 A;  4HB0 B;  2I1J A;  4YL8 A;  3PSC A;  4ZRJ A;  5J3T A;  4EMO A;  1Q67 A;  3V5W A;  1FGZ A;  1M7R A;  3BIN A;  2P0D A;  5J3Y A;  2RUK B;  1NU2 A;  3SNH A;  5D3W A;  1P3R A;  4HDQ A;  1V5M A;  2I5F A;  1I2H A;  4F7U P;  4HAY B;  3VIA A;  3KSY A;  1U5F A;  3SV1 A;  2LYD A;  2DA0 A;  1NTY A;  1XD4 A;  4Z2M B;  4HAW B;  5D3Y A;  5DH9 B;  2V76 A;  4PNK A;  5JP4 A;  5EFX A;  2ADZ A;  1Z87 A;  3O96 A;  5C16 A;  2COD A;  4H8S A;  1MKE A;  2DHJ A;  4A6K A;  2EMS A;  2LOX A;  1Y5O A;  4DBB A;  4EJN A;  1DDW A;  3SUZ A;  1OMW A;  3P6A A;  1H4R A;  1W1H A;  3CIK A;  4YON A;  4HAZ B;  3KZ1 A;  4BBK A;  1B55 A;  2VRW B;  2K00 A;  2DHI A;  2D4Q A;  1WG7 A;  2IYB A;  1FHW A;  2CRF A;  1FGY A;  3OAN A;  1Y19 B;  2H7E A;  1MK7 B;  2D2Q A;  5HE0 A;  2YSZ A;  2CY5 A;  1FOE A;  3AJ4 A;  3ZVR A;  1UNP A;  3HQC A;  4KVG B;  2D9Y A;  4KHA A;  2N23 A;  1U5D A;  2AEH A;  4A6F B;  1ZC4 B;  1MIX A;  4ZRK A;  2GJY A;  3LJU X;  4DX9 0;  1V88 A;  3GYP A;  1NI2 A;  4IAP A;  4HAV B;  2J0K A;  1NTV A;  2FJL A;  2H7D A;  2W2X C;  1XX0 A;  2LUL A;  2VSZ A;  5D27 A;  3WYF B;  2KCJ A;  1V89 A;  2P0F A;  4HB2 B;  1H10 A;  3A98 B;  2RVB B;  2W2W A;  3FEH A;  3FSS A;  2MWN B;  2QKL A;  3NSU A;  1X05 A;  2DN6 A;  1P6S A;  1U5E A;  1UNR A;  1U2B A;  2DYQ A;  1J0W A;  2Y8G A;  4MY6 A;  1WGQ A;  1XR0 B;  2GCJ A;  1OQN A;  4MT7 A;  1FHX A;  1UNQ A;  4PQ0 A;  4ZRI A;  2I5C A;  2RLO A;  3KRX A;  3ULB A;  1DDM A;  3ULC A;  1DYN A;  5C6R A;  1M7E A;  5L81 A;  5GOW B;  3DXC A;  1QC6 A;  1XCG A;  1KZ7 A;  4D0N B;  4KHB B;  2OQB A;  3SYX A;  1RRP B;  4WJ7 A;  4NY0 A;  3P7Z A;  3SO6 A;  1GG3 A;  3HW2 B;  1XOD A;  1ZVR A;  2J59 M;  3DXD A;  4A6H A;  3M1I B;  5DIF B;  1V5P A;  1UPQ A;  2YS3 A;  4P7I A;  3GYO A;  1V5U A;  4HB4 B;  3PG7 A;  1BWN A;  1MK9 B;  2MKR A;  1J19 A;  2DTC A;  1ZC3 B;  4MK0 A;  4HDO A;  1AQC A;  1EF1 A;  3D8D A;  3TVV A;  1ZM0 A;  2L1C A;  1MIZ B;  4WSF A;  5HE2 A;  2QKM A;  4K17 A;  4Z2N A;  3KRW A;  4EKU A;  1U27 A;  1MPH A;  2RGN B;  4XWX A;  2GS0 A;  1V61 A;  5D3X A;  4CHM A;  2UZR A;  5DHF B;  1FHO A;  3ODW A;  3VOQ A;  5FI0 A;  3QWM A;  5KQ4 A;  2MFQ A;  1K5G B;  2Y8F A;  1AWE A;  4K2P A;  1OY2 A;  2AL6 A;  4GPT B;  4TYZ A;  4L6E A;  3KY9 A;  2YS5 A;  3AU5 A;  2IFS A;  2NZ8 B;  2COC A;  1QQG A;  5FI1 A;  3PVL A;  5CLL B;  2DKQ A;  2Z0P A; 
#chains in the Genus database with same CATH topology
 2DLW A;  4C0A A;  2YS1 A;  2ROV A;  2K2U A;  4GMV A;  3PVU A;  1WVH A;  1GC7 A;  2M14 A;  2KR0 A;  1KZG A;  3G9W A;  1DRO A;  2P0H A;  5KCV A;  1BTN A;  2W2X D;  2KUP A;  1U5G A;  3DCX A;  2DX5 A;  3TFM A;  2UVM A;  1SGH A;  1RJ2 A;  4B6H A;  4GN1 A;  1X86 A;  2P8V A;  3FM8 C;  1W1D A;  1X11 A;  3IVF A;  4QXA B;  4F7G A;  1KI1 B;  5C5B B;  2R0D A;  3F5R A;  4HB3 B;  4Y94 A;  3ML4 A;  2GCL A;  1ZSQ A;  2K2J A;  3ZDT A;  2EC1 A;  3PEG A;  4QJ5 B;  1N3H A;  2Z14 A;  2D11 A;  2D9W A;  2Y7B A;  1U29 A;  4F7H A;  2PZ1 A;  2D9Z A;  2JP2 A;  1EAZ A;  5J3Q A;  2D9V A;  2M38 A;  2DYN A;  2LKO A;  2YT1 A;  4CYE A;  4DXA B;  3A8P A;  2ZPY A;  1TQZ A;  4QJ4 B;  3CXB B;  1SHC A;  3D8E A;  2D9X A;  1W1G A;  3MPX A;  3HIE A;  3QBV B;  3ODX A;  1DBH A;  2Q13 A;  1PMS A;  1FAO A;  2YVC A;  1X1F A;  1X1G A;  1P5T A;  4GNK B;  2DFK A;  2Z13 A;  2Z0Q A;  1ISN A;  2J0J A;  5HE1 A;  1MAI A;  3AU4 A;  1MI1 A;  1WJM A;  3QIJ A;  1PFJ A;  4D6W A;  2Z4D A;  2KUQ A;  2Z0O A;  3D8F A;  2ELB A;  2BCJ A;  1TXD A;  2R2Y A;  2EJ8 A;  2ELA A;  3UZT A;  3OHM B;  1IRS A;  1BTK A;  4IFS A;  5JLJ B;  2HTH B;  2MDX A;  2G35 A;  5CLQ B;  3DXE A;  3PZD A;  2R09 A;  5HE3 A;  1K5D B;  3TCA A;  5DHA B;  5C5B A;  2XQN M;  2CAY A;  1TJ6 A;  4KAX B;  4TKN A;  2VKI A;  1GC6 A;  2N0Y A;  3BJI A;  2COF A;  3U8Z A;  2DKP A;  5JHG A;  3N7C A;  2RNR B;  1LW3 A;  4CSQ A;  1E5W A;  2X18 A;  2D10 A;  2E2X A;  4HAU B;  3U7D A;  5JHH A;  5KQ1 A;  4CHJ A;  3TW1 A;  3PP2 A;  3F0W A;  1I7A A;  3WA0 A;  3FVC A;  3HK0 A;  2L2I A;  1PLS A;  3X23 A;  4KHO A;  5DI9 B;  2UZS A;  3T06 A;  4GMX B;  1EGX A;  3PVW A;  4HAT B;  5LON B;  4NSW A;  2KGX B;  2CY4 A;  2LOZ A;  2J0M A;  2RSG A;  3RCP A;  2YF0 A;  2OTX A;  3TO1 A;  1WI1 A;  2LG1 A;  1UEF A;  2EMT A;  1UPR A;  1BAK A;  1DDV A;  1XKE A;  4GXB A;  2YRY A;  4A6F A;  4HHV A;  2COA A;  4IOY X;  4DIX A;  2DHK A;  2I1K A;  2ROZ B;  2K49 A;  4K2O A;  4GZU A;  4DX8 A;  1FB8 A;  5LOP B;  2YT0 A;  4WVF B;  4L1R A;  1WGU A;  2DX1 A;  4A5K A;  1LB1 A;  3A8Q A;  5D3V A;  3ODO A;  5C79 A;  1EVH A;  2NMB A;  1WJ1 A;  2Z59 A;  4K81 A;  4HAX B;  3MDB C;  2HE7 A;  4HB0 B;  2I1J A;  4YL8 A;  3PSC A;  4ZRJ A;  5J3T A;  4EMO A;  1Q67 A;  3V5W A;  1FGZ A;  1M7R A;  3BIN A;  2P0D A;  5J3Y A;  2RUK B;  1NU2 A;  3SNH A;  5D3W A;  1P3R A;  3NWD A;  4HDQ A;  1V5M A;  2I5F A;  1I2H A;  4QJ3 B;  4F7U P;  4HAY B;  3VIA A;  3KSY A;  1U5F A;  3SV1 A;  2LYD A;  2DA0 A;  3NWA A;  1NTY A;  2FJU B;  1XD4 A;  4Z2M B;  4HAW B;  5D3Y A;  5DH9 B;  2V76 A;  4PNK A;  5I2M A;  5JP4 A;  5EFX A;  2ADZ A;  1Z87 A;  3O96 A;  5C16 A;  2COD A;  4H8S A;  1MKE A;  2DHJ A;  4A6K A;  2EMS A;  2LOX A;  1Y5O A;  4DBB A;  5LG4 B;  4EJN A;  1DDW A;  3SUZ A;  1OMW A;  3P6A A;  1H4R A;  1W1H A;  3CIK A;  4YON A;  4HAZ B;  3KZ1 A;  4BBK A;  1B55 A;  2VRW B;  2K00 A;  2DHI A;  2D4Q A;  1WG7 A;  2IYB A;  1FHW A;  2CRF A;  1FGY A;  3OAN A;  1Y19 B;  2H7E A;  1MK7 B;  2D2Q A;  5HE0 A;  2YSZ A;  2CY5 A;  1FOE A;  3AJ4 A;  3B77 A;  1UNP A;  3HQC A;  4KVG B;  3ZVR A;  2D9Y A;  4KHA A;  2N23 A;  1U5D A;  2AEH A;  4A6F B;  1ZC4 B;  1MIX A;  4ZRK A;  2GUM A;  2GJY A;  3LJU X;  4DX9 0;  1V88 A;  4GOU A;  3GYP A;  1NI2 A;  4IAP A;  4HAV B;  2J0K A;  1NTV A;  2RRF A;  2FJL A;  2H7D A;  2W2X C;  2YT2 A;  1XX0 A;  2LUL A;  2VSZ A;  5D27 A;  3WYF B;  2KCJ A;  1V89 A;  2P0F A;  4HB2 B;  1H10 A;  3A98 B;  2RVB B;  2W2W A;  3FEH A;  3FSS A;  2MWN B;  2QKL A;  3NSU A;  1X05 A;  2DN6 A;  1P6S A;  1U5E A;  1UNR A;  1U2B A;  2DYQ A;  3HSA A;  1J0W A;  5I2S A;  2Y8G A;  4MY6 A;  1WGQ A;  1XR0 B;  2GCJ A;  1OQN A;  3A58 A;  4MT7 A;  1FHX A;  1UNQ A;  1ZYI A;  5IRS A;  4PQ0 A;  4ZRI A;  3NWF A;  2I5C A;  2RLO A;  3KRX A;  2NBV A;  4OT1 A;  3ULC A;  3ULB A;  1DDM A;  1DYN A;  5C6R A;  1M7E A;  5L81 A;  5GOW B;  3DXC A;  1QC6 A;  1XCG A;  1KZ7 A;  4D0N B;  4KHB B;  2OQB A;  3SYX A;  4OSN A;  1RRP B;  4WJ7 A;  4NY0 A;  3P7Z A;  3SO6 A;  1GG3 A;  3HW2 B;  1XOD A;  2ZKM X;  1ZVR A;  2J59 M;  3DXD A;  5M4Y B;  2KIG A;  4A6H A;  3M1I B;  4HSI A;  5DIF B;  1V5P A;  1UPQ A;  2YS3 A;  4P7I A;  3GYO A;  1V5U A;  3NW8 A;  4HB4 B;  3PG7 A;  1BWN A;  1MK9 B;  2MKR A;  1J19 A;  2DTC A;  1ZC3 B;  4MK0 A;  4HDO A;  1AQC A;  1EF1 A;  3D8D A;  3TVV A;  1ZM0 A;  2K8E A;  2L1C A;  1MIZ B;  2KIE A;  4WSF A;  5HE2 A;  2QKM A;  4K17 A;  4Z2N A;  3KRW A;  4EKU A;  1U27 A;  1MPH A;  2RGN B;  4XWX A;  2GS0 A;  1V61 A;  5D3X A;  1T77 A;  4CHM A;  3U12 A;  2UZR A;  5DHF B;  1FHO A;  3ODW A;  4KHB A;  5FI0 A;  3VOQ A;  3QWM A;  5KQ4 A;  2MFQ A;  1K5G B;  2Y8F A;  1AWE A;  4K2P A;  1OY2 A;  2AL6 A;  4GPT B;  4TYZ A;  4L6E A;  3KY9 A;  2YS5 A;  3AU5 A;  2IFS A;  2NZ8 B;  2COC A;  1QQG A;  5FI1 A;  3PVL A;  5CLL B;  2DKQ A;  2Z0P A; 
#chains in the Genus database with same CATH homology
 2DLW A;  4C0A A;  2YS1 A;  2ROV A;  2K2U A;  4GMV A;  3PVU A;  1WVH A;  1GC7 A;  2M14 A;  1KZG A;  3G9W A;  1DRO A;  2P0H A;  5KCV A;  1BTN A;  2W2X D;  2KUP A;  1U5G A;  2DX5 A;  3TFM A;  2UVM A;  1SGH A;  1RJ2 A;  4B6H A;  4GN1 A;  1X86 A;  2P8V A;  3FM8 C;  1W1D A;  1X11 A;  3IVF A;  4F7G A;  1KI1 B;  5C5B B;  2R0D A;  3F5R A;  4HB3 B;  4Y94 A;  3ML4 A;  2GCL A;  1ZSQ A;  2K2J A;  3ZDT A;  2EC1 A;  3PEG A;  1N3H A;  2D11 A;  2D9W A;  2Y7B A;  1U29 A;  4F7H A;  2PZ1 A;  2D9Z A;  2JP2 A;  1EAZ A;  5J3Q A;  2D9V A;  2M38 A;  2DYN A;  2LKO A;  2YT1 A;  4CYE A;  4DXA B;  3A8P A;  2ZPY A;  1TQZ A;  3CXB B;  1SHC A;  3D8E A;  2D9X A;  1W1G A;  3MPX A;  3QBV B;  1DBH A;  3ODX A;  2Q13 A;  1PMS A;  1FAO A;  2YVC A;  1X1F A;  1X1G A;  1P5T A;  2DFK A;  2Z0Q A;  1ISN A;  2J0J A;  5HE1 A;  1MAI A;  3AU4 A;  1WJM A;  3QIJ A;  1PFJ A;  2Z0O A;  3D8F A;  2ELB A;  2BCJ A;  1TXD A;  2EJ8 A;  2ELA A;  3UZT A;  1IRS A;  1BTK A;  4IFS A;  5JLJ B;  2HTH B;  2MDX A;  2G35 A;  5CLQ B;  3DXE A;  3PZD A;  2R09 A;  5HE3 A;  1K5D B;  3TCA A;  5DHA B;  5C5B A;  2XQN M;  2CAY A;  1TJ6 A;  4KAX B;  4TKN A;  2VKI A;  1GC6 A;  2N0Y A;  3BJI A;  2COF A;  3U8Z A;  2DKP A;  5JHG A;  3N7C A;  2RNR B;  1LW3 A;  1E5W A;  2X18 A;  2D10 A;  2E2X A;  4HAU B;  3U7D A;  5JHH A;  5KQ1 A;  4CHJ A;  3TW1 A;  3PP2 A;  3F0W A;  1I7A A;  3WA0 A;  3HK0 A;  2L2I A;  1PLS A;  3X23 A;  4KHO A;  5DI9 B;  2UZS A;  3T06 A;  4GMX B;  1EGX A;  3PVW A;  4HAT B;  5LON B;  4NSW A;  2KGX B;  2CY4 A;  2LOZ A;  2J0M A;  2RSG A;  3RCP A;  2YF0 A;  2OTX A;  3TO1 A;  1WI1 A;  2LG1 A;  1UEF A;  2EMT A;  1UPR A;  1BAK A;  1DDV A;  1XKE A;  4GXB A;  2YRY A;  4A6F A;  4HHV A;  2COA A;  4IOY X;  2DHK A;  2I1K A;  2ROZ B;  4K2O A;  4GZU A;  4DX8 A;  1FB8 A;  5LOP B;  2YT0 A;  4WVF B;  1WGU A;  2DX1 A;  4A5K A;  1LB1 A;  3A8Q A;  5D3V A;  3ODO A;  5C79 A;  1EVH A;  2NMB A;  1WJ1 A;  4K81 A;  4HAX B;  3MDB C;  2HE7 A;  4HB0 B;  2I1J A;  4YL8 A;  3PSC A;  4ZRJ A;  5J3T A;  4EMO A;  1Q67 A;  3V5W A;  1FGZ A;  1M7R A;  3BIN A;  2P0D A;  5J3Y A;  2RUK B;  1NU2 A;  3SNH A;  5D3W A;  1P3R A;  4HDQ A;  1V5M A;  2I5F A;  1I2H A;  4F7U P;  4HAY B;  3VIA A;  3KSY A;  1U5F A;  3SV1 A;  2LYD A;  2DA0 A;  1NTY A;  1XD4 A;  4Z2M B;  4HAW B;  5D3Y A;  5DH9 B;  2V76 A;  4PNK A;  5JP4 A;  5EFX A;  2ADZ A;  1Z87 A;  3O96 A;  5C16 A;  2COD A;  4H8S A;  1MKE A;  2DHJ A;  4A6K A;  2EMS A;  2LOX A;  1Y5O A;  4DBB A;  4EJN A;  1DDW A;  3SUZ A;  1OMW A;  3P6A A;  1H4R A;  1W1H A;  3CIK A;  4YON A;  4HAZ B;  3KZ1 A;  4BBK A;  1B55 A;  2VRW B;  2K00 A;  2DHI A;  2D4Q A;  1WG7 A;  2IYB A;  1FHW A;  2CRF A;  1FGY A;  3OAN A;  1Y19 B;  2H7E A;  1MK7 B;  2D2Q A;  5HE0 A;  2YSZ A;  2CY5 A;  1FOE A;  3AJ4 A;  3ZVR A;  1UNP A;  3HQC A;  4KVG B;  2D9Y A;  4KHA A;  2N23 A;  1U5D A;  2AEH A;  4A6F B;  1ZC4 B;  1MIX A;  4ZRK A;  2GJY A;  3LJU X;  4DX9 0;  1V88 A;  3GYP A;  1NI2 A;  4IAP A;  4HAV B;  2J0K A;  1NTV A;  2FJL A;  2H7D A;  2W2X C;  1XX0 A;  2LUL A;  2VSZ A;  5D27 A;  3WYF B;  2KCJ A;  1V89 A;  2P0F A;  4HB2 B;  1H10 A;  3A98 B;  2RVB B;  2W2W A;  3FEH A;  3FSS A;  2MWN B;  2QKL A;  3NSU A;  1X05 A;  2DN6 A;  1P6S A;  1U5E A;  1UNR A;  1U2B A;  2DYQ A;  1J0W A;  2Y8G A;  4MY6 A;  1WGQ A;  1XR0 B;  2GCJ A;  1OQN A;  4MT7 A;  1FHX A;  1UNQ A;  4PQ0 A;  4ZRI A;  2I5C A;  2RLO A;  3KRX A;  3ULB A;  1DDM A;  3ULC A;  1DYN A;  5C6R A;  1M7E A;  5L81 A;  5GOW B;  3DXC A;  1QC6 A;  1XCG A;  1KZ7 A;  4D0N B;  4KHB B;  2OQB A;  3SYX A;  1RRP B;  4WJ7 A;  4NY0 A;  3P7Z A;  3SO6 A;  1GG3 A;  3HW2 B;  1XOD A;  1ZVR A;  2J59 M;  3DXD A;  4A6H A;  3M1I B;  5DIF B;  1V5P A;  1UPQ A;  2YS3 A;  4P7I A;  3GYO A;  1V5U A;  4HB4 B;  3PG7 A;  1BWN A;  1MK9 B;  2MKR A;  1J19 A;  2DTC A;  1ZC3 B;  4MK0 A;  4HDO A;  1AQC A;  1EF1 A;  3D8D A;  3TVV A;  1ZM0 A;  2L1C A;  1MIZ B;  4WSF A;  5HE2 A;  2QKM A;  4K17 A;  4Z2N A;  3KRW A;  4EKU A;  1U27 A;  1MPH A;  2RGN B;  4XWX A;  2GS0 A;  1V61 A;  5D3X A;  4CHM A;  2UZR A;  5DHF B;  1FHO A;  3ODW A;  3VOQ A;  5FI0 A;  3QWM A;  5KQ4 A;  2MFQ A;  1K5G B;  2Y8F A;  1AWE A;  4K2P A;  1OY2 A;  2AL6 A;  4GPT B;  4TYZ A;  4L6E A;  3KY9 A;  2YS5 A;  3AU5 A;  2IFS A;  2NZ8 B;  2COC A;  1QQG A;  5FI1 A;  3PVL A;  5CLL B;  2DKQ A;  2Z0P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...