2GS0A

Nmr structure of the complex between the ph domain of the tfb1 subunit from tfiih and the activation domain of p53
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
115
structure length
115
Chain Sequence
PSHSGAAIFEKVSGIIAINEDVSPAELTWRSTDGDKVHTVVLSTIDKLQATPASSEKMMLRLIGKVDESKKRKDNEGNEVVPKPQRHMFSFNNRTVMDNIKMTLQQIISRYKDAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA polymerase II transcription factor B subunit 1
publication title Structure of the Tfb1/p53 complex: Insights into the interaction between the p62/Tfb1 subunit of TFIIH and the activation domain of p53.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 22
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2006-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08567 PH_TFIIH TFIIH p62 subunit, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2gs0A00
1M7EA 2RSGA 2YS1A 3KY9A 1FHXA 3TO1A 4EKUA 2RGNB 4IAPA 2D9ZA 4F7GA 1FGYA 5D3VA 1XD4A 4DXAB 1EF1A 2J0KA 2GS0A 1SGHA 2GCJA 1DYNA 2DHJA 2Z0OA 1Z87A 3D8DA 2ZPYA 5FI1A 4Z2NA 3TW1A 3N7CA 2KUPA 1PFJA 2RNRB 5GOWB 1B55A 1WJ1A 2Q13A 2UZSA 3D8EA 4ZRJA 1BWNA 2M14A 2NZ8B 5LOPB 2N0YA 1FAOA 1GC7A 2J59M 2Y8GA 1QQGA 2J0JA 1EAZA 4P7IA 1U2BA 5DI9B 1W1GA 1N3HA 2W2WA 2DA0A 3A8PA 1OY2A 3IVFA 2EMSA 2MKRA 1V5MA 3SNHA 2VSZA 4GN1A 1ZM0A 1XKEA 1EVHA 1WG7A 2COFA 4HDOA 2D10A 4KHBB 1UNPA 1ZVRA 2FJLA 4B6HA 1X05A 2COAA 5LONB 1BTNA 4TKNA 3OANA 4XWXA 3DXDA 1I2HA 3A8QA 3PVWA 1X1GA 4A6FB 2LG1A 1K5DB 3CXBB 4HB2B 3VOQA 3TFMA 4K81A 4WVFB 1LB1A 5EFXA 4KAXB 2P0FA 3SO6A 1IRSA 4KHAA 4F7HA 1NU2A 4HB0B 3WYFB 5JLJB 2DX5A 5HE0A 3O96A 4KHOA 4A6FA 2DKPA 3F5RA 5C79A 4YL8A 2COCA 4TYZA 3A98B 2AL6A 2KGXB 2Z0QA 3RCPA 1XCGA 2LYDA 2I1JA 3FEHA 3HK0A 4GPTB 1BTKA 1UPRA 2DYNA 5J3YA 1KI1B 3ODXA 1MAIA 1NTVA 4GMXB 3ULCA 1FOEA 3VIAA 3ULBA 2GCLA 1I7AA 2UZRA 1MIXA 1WJMA 2CRFA 3D8FA 3DXEA 2ROVA 3ODOA 5CLQB 3P7ZA 2K2UA 3PVLA 3PP2A 2VRWB 5CLLB 2I1KA 1MK9B 1W1HA 1E5WA 3AJ4A 1TXDA 1NTYA 1MPHA 1P3RA 3QIJA 1FGZA 2X18A 5DHAB 3SYXA 1P5TA 3GYPA 4EMOA 1Y19B 4HB4B 4GZUA 1RJ2A 3KRXA 4YONA 3ML4A 5DH9B 2YT1A 5L81A 5C5BB 1GC6A 1OMWA 1U5GA 1WI1A 1V88A 1ZC4B 2D11A 3M1IB 2M38A 1V5PA 2YVCA 1UPQA 5C16A 4A5KA 2RLOA 1OQNA 3ZDTA 1EGXA 2I5CA 3PEGA 3P6AA 2IFSA 4HHVA 1M7RA 2GJYA 4GXBA 5D3XA 1TQZA 2RVBB 2H7DA 2D9VA 5C6RA 1BAKA 4DX90 2P0HA 4K2PA 2D9WA 4D0NB 3TCAA 5HE3A 1X86A 4K17A 2P0DA 2D2QA 2ADZA 1SHCA 1UNRA 2OTXA 3PG7A 4HAYB 2R0DA 2DHKA 2OQBA 1RRPB 5KQ4A 2EJ8A 4GMVA 1V5UA 4L6EA 3G9WA 4A6KA 3U7DA 1ZSQA 3PSCA 2VKIA 2UVMA 2RUKB 2LOZA 4K2OA 2LULA 4PQ0A 5D27A 3ODWA 2H7EA 2D9XA 2K00A 2K2JA 3DXCA 3SUZA 2L2IA 1KZGA 1V89A 3V5WA 1NI2A 3KRWA 4HAUB 1XX0A 4HAXB 1AWEA 2MDXA 3HQCA 2LOXA 2P8VA 5J3QA 2R09A 2CY5A 2MFQA 1ISNA 4WSFA 5HE1A 2DN6A 1X1FA 4MK0A 1MIZB 1WGQA 1DDWA 2EC1A 3HW2B 5JP4A 3X23A 3KZ1A 5JHHA 4ZRIA 2PZ1A 2MWNB 1J19A 1DROA 2EMTA 2YT0A 1FHWA 1UNQA 2DYQA 5D3WA 4C0AA 2ROZB 4HATB 2BCJA 3PZDA 2YSZA 2JP2A 2Y7BA 2E2XA 1Y5OA 4H8SA 4HB3B 1PLSA 3MPXA 4HAWB 1U5DA 4NY0A 2LKOA 1U29A 3QWMA 2DX1A 3AU5A 2YS3A 2ELAA 4NSWA 2QKMA 2CODA 3PVUA 4Y94A 3U8ZA 3ZVRA 2QKLA 3NSUA 4F7UP 2DHIA 4Z2MB 4CHJA 4MY6A 1H10A 1ZC3B 5KQ1A 4HAZB 2CY4A 2L1CA 1GG3A 2XQNM 3FSSA 5C5BA 5DHFB 4MT7A 1DBHA 2DTCA 4IOYX 4KVGB 2N23A 3QBVB 2YF0A 3UZTA 1LW3A 2Z0PA 2NMBA 4HAVB 4HDQA 2DLWA 3GYOA 3FM8C 2YS5A 3SV1A 1XR0B 1MKEA 5D3YA 4DBBA 3LJUX 2W2XC 1DDMA 1WGUA 4WJ7A 4DX8A 1UEFA 1FHOA 1XODA 4EJNA 1V61A 3TVVA 1FB8A 2Y8FA 3T06A 2V76A 3KSYA 1PMSA 1U5EA 1U5FA 5J3TA 1AQCA 1DDVA 4A6HA 2G35A 1TJ6A 1H4RA 1QC6A 1K5GB 3F0WA 3WA0A 4ZRKA 1KZ7A 2ELBA 1P6SA 4CHMA 1MK7B 1X11A 2D9YA 1WVHA 4CYEA 3AU4A 2I5FA 4IFSA 2J0MA 1Q67A 2AEHA 3BJIA 2YRYA 4BBKA 2CAYA 4PNKA 1U27A 2DKQA 3CIKA 5FI0A 2IYBA 2KCJA 3BINA 5HE2A 5KCVA 3MDBC 2DFKA 1J0WA 2HTHB 2W2XD 1W1DA 5DIFB 2D4QA 2HE7A 5JHGA
chains in the Genus database with same CATH superfamily
1M7EA 2RSGA 2K49A 2YS1A 3KY9A 1FHXA 3TO1A 4EKUA 2RGNB 4IAPA 2D9ZA 4F7GA 1FGYA 5D3VA 3OHMB 4QJ5B 1XD4A 4DXAB 1EF1A 2J0KA 2GS0A 1SGHA 2GCJA 1DYNA 2DHJA 2Z0OA 1Z87A 3D8DA 2ZPYA 5FI1A 4Z2NA 3TW1A 3N7CA 2KUPA 1PFJA 3NWDA 2RNRB 5GOWB 1B55A 1WJ1A 2Q13A 2UZSA 3D8EA 4ZRJA 1BWNA 2M14A 2NZ8B 5LOPB 2N0YA 1FAOA 1GC7A 2J59M 2Y8GA 1QQGA 2J0JA 1EAZA 4P7IA 1U2BA 5DI9B 1W1GA 1N3HA 2R2YA 2W2WA 2DA0A 3A8PA 3DCXA 5I2MA 1OY2A 3IVFA 2EMSA 2MKRA 1V5MA 3SNHA 2VSZA 4GN1A 1ZM0A 1XKEA 1EVHA 2KUQA 1WG7A 2COFA 4HDOA 2D10A 4KHBB 1UNPA 1ZVRA 2FJLA 4B6HA 4QJ4B 1X05A 2COAA 5LONB 1BTNA 4TKNA 3OANA 4XWXA 3DXDA 2Z14A 1I2HA 1ZYIA 3A8QA 3PVWA 1X1GA 4A6FB 2LG1A 4GNKB 1K5DB 3CXBB 4HB2B 3VOQA 3TFMA 4K81A 4WVFB 1LB1A 5EFXA 4KAXB 2P0FA 3SO6A 1IRSA 4KHAA 4F7HA 5M4YB 4KHBA 3B77A 1NU2A 4HB0B 3WYFB 5JLJB 2DX5A 2Z59A 5HE0A 2KIGA 3O96A 4KHOA 4A6FA 5I2SA 2DKPA 3F5RA 5C79A 4YL8A 4HSIA 2COCA 4TYZA 3A98B 2AL6A 2KGXB 1MI1A 2Z0QA 3RCPA 1XCGA 2LYDA 2I1JA 3FEHA 3HK0A 4GPTB 1BTKA 1UPRA 2DYNA 5J3YA 1KI1B 3ODXA 1MAIA 1NTVA 4GMXB 3ULCA 1FOEA 3VIAA 3ULBA 2GCLA 1I7AA 2UZRA 1MIXA 1WJMA 5IRSA 2CRFA 3D8FA 3DXEA 2ROVA 2KIEA 3ODOA 5CLQB 3P7ZA 2K2UA 3PVLA 3PP2A 2VRWB 5CLLB 2I1KA 1MK9B 3NWFA 1W1HA 1E5WA 3AJ4A 1TXDA 1NTYA 1MPHA 1P3RA 3QIJA 1FGZA 3U12A 2X18A 5DHAB 3SYXA 1P5TA 3GYPA 4EMOA 1Y19B 4HB4B 4GZUA 1RJ2A 3KRXA 4YONA 3ML4A 5DH9B 2YT1A 5L81A 2FJUB 1GC6A 1OMWA 5C5BB 1U5GA 1WI1A 2NBVA 1V88A 1ZC4B 2D11A 2M38A 3M1IB 1V5PA 3HSAA 2YVCA 1UPQA 5C16A 4A5KA 2RLOA 1OQNA 3ZDTA 1EGXA 2I5CA 3PEGA 3P6AA 2IFSA 2KR0A 4HHVA 1M7RA 2GJYA 4GXBA 5D3XA 1TQZA 2RVBB 2H7DA 2D9VA 2RRFA 5C6RA 1BAKA 4DX90 2P0HA 2YT2A 4QXAB 4K2PA 2D9WA 4D0NB 3TCAA 5HE3A 3FVCA 1X86A 4K17A 2P0DA 2D2QA 2ADZA 1SHCA 1UNRA 2OTXA 5LG4B 3PG7A 4HAYB 2R0DA 4QJ3B 2DHKA 2OQBA 1RRPB 5KQ4A 2EJ8A 4GMVA 1V5UA 4L6EA 3G9WA 4A6KA 3U7DA 1ZSQA 3PSCA 2VKIA 2UVMA 2RUKB 4OSNA 2LOZA 4K2OA 2LULA 4PQ0A 5D27A 3ODWA 2H7EA 2D9XA 2K00A 2K2JA 3DXCA 3SUZA 2L2IA 1KZGA 1V89A 3V5WA 1NI2A 3KRWA 4HAUB 1XX0A 4HAXB 1AWEA 2MDXA 3HQCA 2LOXA 2P8VA 5J3QA 2R09A 2CY5A 2MFQA 1ISNA 4WSFA 5HE1A 2DN6A 1X1FA 4MK0A 1MIZB 1WGQA 1DDWA 2EC1A 3HW2B 5JP4A 3X23A 3KZ1A 5JHHA 2ZKMX 4ZRIA 2PZ1A 4DIXA 2MWNB 1J19A 1DROA 2EMTA 2YT0A 1FHWA 1UNQA 2DYQA 5D3WA 4C0AA 2ROZB 4HATB 2BCJA 3PZDA 2YSZA 2JP2A 2Y7BA 2E2XA 1Y5OA 4H8SA 4HB3B 1PLSA 3MPXA 4HAWB 1U5DA 4NY0A 2LKOA 1U29A 3QWMA 2DX1A 3AU5A 2YS3A 2ELAA 4NSWA 2QKMA 2CODA 3PVUA 4Y94A 3U8ZA 3ZVRA 2QKLA 3NSUA 4F7UP 2DHIA 2Z13A 4L1RA 4Z2MB 4CHJA 4MY6A 1H10A 1ZC3B 5KQ1A 4HAZB 2CY4A 2L1CA 1GG3A 2XQNM 3FSSA 5C5BA 5DHFB 2K8EA 4MT7A 1DBHA 2DTCA 4IOYX 4KVGB 2N23A 3QBVB 2YF0A 3UZTA 1LW3A 2Z0PA 2NMBA 4HAVB 4HDQA 2DLWA 3GYOA 3FM8C 2YS5A 3SV1A 1XR0B 1MKEA 2Z4DA 5D3YA 4DBBA 3LJUX 2W2XC 1DDMA 1WGUA 4WJ7A 4DX8A 1UEFA 1FHOA 1XODA 4EJNA 4GOUA 1V61A 3TVVA 1FB8A 2Y8FA 3T06A 2V76A 3KSYA 1PMSA 1U5EA 1U5FA 5J3TA 1AQCA 1DDVA 4D6WA 4A6HA 2G35A 1TJ6A 1H4RA 3HIEA 1QC6A 1K5GB 3F0WA 3WA0A 4ZRKA 1KZ7A 2ELBA 1P6SA 3NWAA 4CHMA 1MK7B 3A58A 1X11A 2D9YA 1WVHA 4CYEA 3AU4A 2I5FA 4IFSA 2GUMA 2J0MA 1Q67A 2AEHA 4CSQA 3BJIA 2YRYA 1T77A 4BBKA 2CAYA 4PNKA 1U27A 2DKQA 3CIKA 5FI0A 2IYBA 2KCJA 3BINA 5HE2A 5KCVA 3MDBC 2DFKA 1J0WA 2HTHB 2W2XD 1W1DA 5DIFB 2D4QA 3NW8A 2HE7A 5JHGA 4OT1A
chains in the Genus database with same CATH topology
1M7EA 2RSGA 2YS1A 3KY9A 1FHXA 3TO1A 4EKUA 2RGNB 4IAPA 2D9ZA 4F7GA 1FGYA 5D3VA 1XD4A 4DXAB 1EF1A 2J0KA 2GS0A 1SGHA 2GCJA 1DYNA 2DHJA 2Z0OA 1Z87A 3D8DA 2ZPYA 5FI1A 4Z2NA 3TW1A 3N7CA 2KUPA 1PFJA 2RNRB 5GOWB 1B55A 1WJ1A 2Q13A 2UZSA 3D8EA 4ZRJA 1BWNA 2M14A 2NZ8B 5LOPB 2N0YA 1FAOA 1GC7A 2J59M 2Y8GA 1QQGA 2J0JA 1EAZA 4P7IA 1U2BA 5DI9B 1W1GA 1N3HA 2W2WA 2DA0A 3A8PA 1OY2A 3IVFA 2EMSA 2MKRA 1V5MA 3SNHA 2VSZA 4GN1A 1ZM0A 1XKEA 1EVHA 1WG7A 2COFA 4HDOA 2D10A 4KHBB 1UNPA 1ZVRA 2FJLA 4B6HA 1X05A 2COAA 5LONB 1BTNA 4TKNA 3OANA 4XWXA 3DXDA 1I2HA 3A8QA 3PVWA 1X1GA 4A6FB 2LG1A 1K5DB 3CXBB 4HB2B 3VOQA 3TFMA 4K81A 4WVFB 1LB1A 5EFXA 4KAXB 2P0FA 3SO6A 1IRSA 4KHAA 4F7HA 1NU2A 4HB0B 3WYFB 5JLJB 2DX5A 5HE0A 3O96A 4KHOA 4A6FA 2DKPA 3F5RA 5C79A 4YL8A 2COCA 4TYZA 3A98B 2AL6A 2KGXB 2Z0QA 3RCPA 1XCGA 2LYDA 2I1JA 3FEHA 3HK0A 4GPTB 1BTKA 1UPRA 2DYNA 5J3YA 1KI1B 3ODXA 1MAIA 1NTVA 4GMXB 3ULCA 1FOEA 3VIAA 3ULBA 2GCLA 1I7AA 2UZRA 1MIXA 1WJMA 2CRFA 3D8FA 3DXEA 2ROVA 3ODOA 5CLQB 3P7ZA 2K2UA 3PVLA 3PP2A 2VRWB 5CLLB 2I1KA 1MK9B 1W1HA 1E5WA 3AJ4A 1TXDA 1NTYA 1MPHA 1P3RA 3QIJA 1FGZA 2X18A 5DHAB 3SYXA 1P5TA 3GYPA 4EMOA 1Y19B 4HB4B 4GZUA 1RJ2A 3KRXA 4YONA 3ML4A 5DH9B 2YT1A 5L81A 5C5BB 1GC6A 1OMWA 1U5GA 1WI1A 1V88A 1ZC4B 2D11A 3M1IB 2M38A 1V5PA 2YVCA 1UPQA 5C16A 4A5KA 2RLOA 1OQNA 3ZDTA 1EGXA 2I5CA 3PEGA 3P6AA 2IFSA 4HHVA 1M7RA 2GJYA 4GXBA 5D3XA 1TQZA 2RVBB 2H7DA 2D9VA 5C6RA 1BAKA 4DX90 2P0HA 4K2PA 2D9WA 4D0NB 3TCAA 5HE3A 1X86A 4K17A 2P0DA 2D2QA 2ADZA 1SHCA 1UNRA 2OTXA 3PG7A 4HAYB 2R0DA 2DHKA 2OQBA 1RRPB 5KQ4A 2EJ8A 4GMVA 1V5UA 4L6EA 3G9WA 4A6KA 3U7DA 1ZSQA 3PSCA 2VKIA 2UVMA 2RUKB 2LOZA 4K2OA 2LULA 4PQ0A 5D27A 3ODWA 2H7EA 2D9XA 2K00A 2K2JA 3DXCA 3SUZA 2L2IA 1KZGA 1V89A 3V5WA 1NI2A 3KRWA 4HAUB 1XX0A 4HAXB 1AWEA 2MDXA 3HQCA 2LOXA 2P8VA 5J3QA 2R09A 2CY5A 2MFQA 1ISNA 4WSFA 5HE1A 2DN6A 1X1FA 4MK0A 1MIZB 1WGQA 1DDWA 2EC1A 3HW2B 5JP4A 3X23A 3KZ1A 5JHHA 4ZRIA 2PZ1A 2MWNB 1J19A 1DROA 2EMTA 2YT0A 1FHWA 1UNQA 2DYQA 5D3WA 4C0AA 2ROZB 4HATB 2BCJA 3PZDA 2YSZA 2JP2A 2Y7BA 2E2XA 1Y5OA 4H8SA 4HB3B 1PLSA 3MPXA 4HAWB 1U5DA 4NY0A 2LKOA 1U29A 3QWMA 2DX1A 3AU5A 2YS3A 2ELAA 4NSWA 2QKMA 2CODA 3PVUA 4Y94A 3U8ZA 3ZVRA 2QKLA 3NSUA 4F7UP 2DHIA 4Z2MB 4CHJA 4MY6A 1H10A 1ZC3B 5KQ1A 4HAZB 2CY4A 2L1CA 1GG3A 2XQNM 3FSSA 5C5BA 5DHFB 4MT7A 1DBHA 2DTCA 4IOYX 4KVGB 2N23A 3QBVB 2YF0A 3UZTA 1LW3A 2Z0PA 2NMBA 4HAVB 4HDQA 2DLWA 3GYOA 3FM8C 2YS5A 3SV1A 1XR0B 1MKEA 5D3YA 4DBBA 3LJUX 2W2XC 1DDMA 1WGUA 4WJ7A 4DX8A 1UEFA 1FHOA 1XODA 4EJNA 1V61A 3TVVA 1FB8A 2Y8FA 3T06A 2V76A 3KSYA 1PMSA 1U5EA 1U5FA 5J3TA 1AQCA 1DDVA 4A6HA 2G35A 1TJ6A 1H4RA 1QC6A 1K5GB 3F0WA 3WA0A 4ZRKA 1KZ7A 2ELBA 1P6SA 4CHMA 1MK7B 1X11A 2D9YA 1WVHA 4CYEA 3AU4A 2I5FA 4IFSA 2J0MA 1Q67A 2AEHA 3BJIA 2YRYA 4BBKA 2CAYA 4PNKA 1U27A 2DKQA 3CIKA 5FI0A 2IYBA 2KCJA 3BINA 5HE2A 5KCVA 3MDBC 2DFKA 1J0WA 2HTHB 2W2XD 1W1DA 5DIFB 2D4QA 2HE7A 5JHGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M7E A;  2RSG A;  2YS1 A;  3KY9 A;  1FHX A;  3TO1 A;  4EKU A;  2RGN B;  4IAP A;  2D9Z A;  4F7G A;  1FGY A;  5D3V A;  1XD4 A;  4DXA B;  1EF1 A;  2J0K A;  2GS0 A;  1SGH A;  2GCJ A;  1DYN A;  2DHJ A;  2Z0O A;  1Z87 A;  3D8D A;  2ZPY A;  5FI1 A;  4Z2N A;  3TW1 A;  3N7C A;  2KUP A;  1PFJ A;  2RNR B;  5GOW B;  1B55 A;  1WJ1 A;  2Q13 A;  2UZS A;  3D8E A;  4ZRJ A;  1BWN A;  2M14 A;  2NZ8 B;  5LOP B;  2N0Y A;  1FAO A;  1GC7 A;  2J59 M;  2Y8G A;  1QQG A;  2J0J A;  1EAZ A;  4P7I A;  1U2B A;  5DI9 B;  1W1G A;  1N3H A;  2W2W A;  2DA0 A;  3A8P A;  1OY2 A;  3IVF A;  2EMS A;  2MKR A;  1V5M A;  3SNH A;  2VSZ A;  4GN1 A;  1ZM0 A;  1XKE A;  1EVH A;  1WG7 A;  2COF A;  4HDO A;  2D10 A;  4KHB B;  1UNP A;  1ZVR A;  2FJL A;  4B6H A;  1X05 A;  2COA A;  5LON B;  1BTN A;  4TKN A;  3OAN A;  4XWX A;  3DXD A;  1I2H A;  3A8Q A;  3PVW A;  1X1G A;  4A6F B;  2LG1 A;  1K5D B;  3CXB B;  4HB2 B;  3VOQ A;  3TFM A;  4K81 A;  4WVF B;  1LB1 A;  5EFX A;  4KAX B;  2P0F A;  3SO6 A;  1IRS A;  4KHA A;  4F7H A;  1NU2 A;  4HB0 B;  3WYF B;  5JLJ B;  2DX5 A;  5HE0 A;  3O96 A;  4KHO A;  4A6F A;  2DKP A;  3F5R A;  5C79 A;  4YL8 A;  2COC A;  4TYZ A;  3A98 B;  2AL6 A;  2KGX B;  2Z0Q A;  3RCP A;  1XCG A;  2LYD A;  2I1J A;  3FEH A;  3HK0 A;  4GPT B;  1BTK A;  1UPR A;  2DYN A;  5J3Y A;  1KI1 B;  3ODX A;  1MAI A;  1NTV A;  4GMX B;  3ULC A;  1FOE A;  3VIA A;  3ULB A;  2GCL A;  1I7A A;  2UZR A;  1MIX A;  1WJM A;  2CRF A;  3D8F A;  3DXE A;  2ROV A;  3ODO A;  5CLQ B;  3P7Z A;  2K2U A;  3PVL A;  3PP2 A;  2VRW B;  5CLL B;  2I1K A;  1MK9 B;  1W1H A;  1E5W A;  3AJ4 A;  1TXD A;  1NTY A;  1MPH A;  1P3R A;  3QIJ A;  1FGZ A;  2X18 A;  5DHA B;  3SYX A;  1P5T A;  3GYP A;  4EMO A;  1Y19 B;  4HB4 B;  4GZU A;  1RJ2 A;  3KRX A;  4YON A;  3ML4 A;  5DH9 B;  2YT1 A;  5L81 A;  5C5B B;  1GC6 A;  1OMW A;  1U5G A;  1WI1 A;  1V88 A;  1ZC4 B;  2D11 A;  3M1I B;  2M38 A;  1V5P A;  2YVC A;  1UPQ A;  5C16 A;  4A5K A;  2RLO A;  1OQN A;  3ZDT A;  1EGX A;  2I5C A;  3PEG A;  3P6A A;  2IFS A;  4HHV A;  1M7R A;  2GJY A;  4GXB A;  5D3X A;  1TQZ A;  2RVB B;  2H7D A;  2D9V A;  5C6R A;  1BAK A;  4DX9 0;  2P0H A;  4K2P A;  2D9W A;  4D0N B;  3TCA A;  5HE3 A;  1X86 A;  4K17 A;  2P0D A;  2D2Q A;  2ADZ A;  1SHC A;  1UNR A;  2OTX A;  3PG7 A;  4HAY B;  2R0D A;  2DHK A;  2OQB A;  1RRP B;  5KQ4 A;  2EJ8 A;  4GMV A;  1V5U A;  4L6E A;  3G9W A;  4A6K A;  3U7D A;  1ZSQ A;  3PSC A;  2VKI A;  2UVM A;  2RUK B;  2LOZ A;  4K2O A;  2LUL A;  4PQ0 A;  5D27 A;  3ODW A;  2H7E A;  2D9X A;  2K00 A;  2K2J A;  3DXC A;  3SUZ A;  2L2I A;  1KZG A;  1V89 A;  3V5W A;  1NI2 A;  3KRW A;  4HAU B;  1XX0 A;  4HAX B;  1AWE A;  2MDX A;  3HQC A;  2LOX A;  2P8V A;  5J3Q A;  2R09 A;  2CY5 A;  2MFQ A;  1ISN A;  4WSF A;  5HE1 A;  2DN6 A;  1X1F A;  4MK0 A;  1MIZ B;  1WGQ A;  1DDW A;  2EC1 A;  3HW2 B;  5JP4 A;  3X23 A;  3KZ1 A;  5JHH A;  4ZRI A;  2PZ1 A;  2MWN B;  1J19 A;  1DRO A;  2EMT A;  2YT0 A;  1FHW A;  1UNQ A;  2DYQ A;  5D3W A;  4C0A A;  2ROZ B;  4HAT B;  2BCJ A;  3PZD A;  2YSZ A;  2JP2 A;  2Y7B A;  2E2X A;  1Y5O A;  4H8S A;  4HB3 B;  1PLS A;  3MPX A;  4HAW B;  1U5D A;  4NY0 A;  2LKO A;  1U29 A;  3QWM A;  2DX1 A;  3AU5 A;  2YS3 A;  2ELA A;  4NSW A;  2QKM A;  2COD A;  3PVU A;  4Y94 A;  3U8Z A;  3ZVR A;  2QKL A;  3NSU A;  4F7U P;  2DHI A;  4Z2M B;  4CHJ A;  4MY6 A;  1H10 A;  1ZC3 B;  5KQ1 A;  4HAZ B;  2CY4 A;  2L1C A;  1GG3 A;  2XQN M;  3FSS A;  5C5B A;  5DHF B;  4MT7 A;  1DBH A;  2DTC A;  4IOY X;  4KVG B;  2N23 A;  3QBV B;  2YF0 A;  3UZT A;  1LW3 A;  2Z0P A;  2NMB A;  4HAV B;  4HDQ A;  2DLW A;  3GYO A;  3FM8 C;  2YS5 A;  3SV1 A;  1XR0 B;  1MKE A;  5D3Y A;  4DBB A;  3LJU X;  2W2X C;  1DDM A;  1WGU A;  4WJ7 A;  4DX8 A;  1UEF A;  1FHO A;  1XOD A;  4EJN A;  1V61 A;  3TVV A;  1FB8 A;  2Y8F A;  3T06 A;  2V76 A;  3KSY A;  1PMS A;  1U5E A;  1U5F A;  5J3T A;  1AQC A;  1DDV A;  4A6H A;  2G35 A;  1TJ6 A;  1H4R A;  1QC6 A;  1K5G B;  3F0W A;  3WA0 A;  4ZRK A;  1KZ7 A;  2ELB A;  1P6S A;  4CHM A;  1MK7 B;  1X11 A;  2D9Y A;  1WVH A;  4CYE A;  3AU4 A;  2I5F A;  4IFS A;  2J0M A;  1Q67 A;  2AEH A;  3BJI A;  2YRY A;  4BBK A;  2CAY A;  4PNK A;  1U27 A;  2DKQ A;  3CIK A;  5FI0 A;  2IYB A;  2KCJ A;  3BIN A;  5HE2 A;  5KCV A;  3MDB C;  2DFK A;  1J0W A;  2HTH B;  2W2X D;  1W1D A;  5DIF B;  2D4Q A;  2HE7 A;  5JHG A; 
#chains in the Genus database with same CATH topology
 1M7E A;  2RSG A;  2K49 A;  2YS1 A;  3KY9 A;  1FHX A;  3TO1 A;  4EKU A;  2RGN B;  4IAP A;  2D9Z A;  4F7G A;  1FGY A;  5D3V A;  3OHM B;  4QJ5 B;  1XD4 A;  4DXA B;  1EF1 A;  2J0K A;  2GS0 A;  1SGH A;  2GCJ A;  1DYN A;  2DHJ A;  2Z0O A;  1Z87 A;  3D8D A;  2ZPY A;  5FI1 A;  4Z2N A;  3TW1 A;  3N7C A;  2KUP A;  1PFJ A;  3NWD A;  2RNR B;  5GOW B;  1B55 A;  1WJ1 A;  2Q13 A;  2UZS A;  3D8E A;  4ZRJ A;  1BWN A;  2M14 A;  2NZ8 B;  5LOP B;  2N0Y A;  1FAO A;  1GC7 A;  2J59 M;  2Y8G A;  1QQG A;  2J0J A;  1EAZ A;  4P7I A;  1U2B A;  5DI9 B;  1W1G A;  1N3H A;  2R2Y A;  2W2W A;  2DA0 A;  3A8P A;  3DCX A;  5I2M A;  1OY2 A;  3IVF A;  2EMS A;  2MKR A;  1V5M A;  3SNH A;  2VSZ A;  4GN1 A;  1ZM0 A;  1XKE A;  1EVH A;  2KUQ A;  1WG7 A;  2COF A;  4HDO A;  2D10 A;  4KHB B;  1UNP A;  1ZVR A;  2FJL A;  4B6H A;  4QJ4 B;  1X05 A;  2COA A;  5LON B;  1BTN A;  4TKN A;  3OAN A;  4XWX A;  3DXD A;  2Z14 A;  1I2H A;  1ZYI A;  3A8Q A;  3PVW A;  1X1G A;  4A6F B;  2LG1 A;  4GNK B;  1K5D B;  3CXB B;  4HB2 B;  3VOQ A;  3TFM A;  4K81 A;  4WVF B;  1LB1 A;  5EFX A;  4KAX B;  2P0F A;  3SO6 A;  1IRS A;  4KHA A;  4F7H A;  5M4Y B;  4KHB A;  3B77 A;  1NU2 A;  4HB0 B;  3WYF B;  5JLJ B;  2DX5 A;  2Z59 A;  5HE0 A;  2KIG A;  3O96 A;  4KHO A;  4A6F A;  5I2S A;  2DKP A;  3F5R A;  5C79 A;  4YL8 A;  4HSI A;  2COC A;  4TYZ A;  3A98 B;  2AL6 A;  2KGX B;  1MI1 A;  2Z0Q A;  3RCP A;  1XCG A;  2LYD A;  2I1J A;  3FEH A;  3HK0 A;  4GPT B;  1BTK A;  1UPR A;  2DYN A;  5J3Y A;  1KI1 B;  3ODX A;  1MAI A;  1NTV A;  4GMX B;  3ULC A;  1FOE A;  3VIA A;  3ULB A;  2GCL A;  1I7A A;  2UZR A;  1MIX A;  1WJM A;  5IRS A;  2CRF A;  3D8F A;  3DXE A;  2ROV A;  2KIE A;  3ODO A;  5CLQ B;  3P7Z A;  2K2U A;  3PVL A;  3PP2 A;  2VRW B;  5CLL B;  2I1K A;  1MK9 B;  3NWF A;  1W1H A;  1E5W A;  3AJ4 A;  1TXD A;  1NTY A;  1MPH A;  1P3R A;  3QIJ A;  1FGZ A;  3U12 A;  2X18 A;  5DHA B;  3SYX A;  1P5T A;  3GYP A;  4EMO A;  1Y19 B;  4HB4 B;  4GZU A;  1RJ2 A;  3KRX A;  4YON A;  3ML4 A;  5DH9 B;  2YT1 A;  5L81 A;  2FJU B;  1GC6 A;  1OMW A;  5C5B B;  1U5G A;  1WI1 A;  2NBV A;  1V88 A;  1ZC4 B;  2D11 A;  2M38 A;  3M1I B;  1V5P A;  3HSA A;  2YVC A;  1UPQ A;  5C16 A;  4A5K A;  2RLO A;  1OQN A;  3ZDT A;  1EGX A;  2I5C A;  3PEG A;  3P6A A;  2IFS A;  2KR0 A;  4HHV A;  1M7R A;  2GJY A;  4GXB A;  5D3X A;  1TQZ A;  2RVB B;  2H7D A;  2D9V A;  2RRF A;  5C6R A;  1BAK A;  4DX9 0;  2P0H A;  2YT2 A;  4QXA B;  4K2P A;  2D9W A;  4D0N B;  3TCA A;  5HE3 A;  3FVC A;  1X86 A;  4K17 A;  2P0D A;  2D2Q A;  2ADZ A;  1SHC A;  1UNR A;  2OTX A;  5LG4 B;  3PG7 A;  4HAY B;  2R0D A;  4QJ3 B;  2DHK A;  2OQB A;  1RRP B;  5KQ4 A;  2EJ8 A;  4GMV A;  1V5U A;  4L6E A;  3G9W A;  4A6K A;  3U7D A;  1ZSQ A;  3PSC A;  2VKI A;  2UVM A;  2RUK B;  4OSN A;  2LOZ A;  4K2O A;  2LUL A;  4PQ0 A;  5D27 A;  3ODW A;  2H7E A;  2D9X A;  2K00 A;  2K2J A;  3DXC A;  3SUZ A;  2L2I A;  1KZG A;  1V89 A;  3V5W A;  1NI2 A;  3KRW A;  4HAU B;  1XX0 A;  4HAX B;  1AWE A;  2MDX A;  3HQC A;  2LOX A;  2P8V A;  5J3Q A;  2R09 A;  2CY5 A;  2MFQ A;  1ISN A;  4WSF A;  5HE1 A;  2DN6 A;  1X1F A;  4MK0 A;  1MIZ B;  1WGQ A;  1DDW A;  2EC1 A;  3HW2 B;  5JP4 A;  3X23 A;  3KZ1 A;  5JHH A;  2ZKM X;  4ZRI A;  2PZ1 A;  4DIX A;  2MWN B;  1J19 A;  1DRO A;  2EMT A;  2YT0 A;  1FHW A;  1UNQ A;  2DYQ A;  5D3W A;  4C0A A;  2ROZ B;  4HAT B;  2BCJ A;  3PZD A;  2YSZ A;  2JP2 A;  2Y7B A;  2E2X A;  1Y5O A;  4H8S A;  4HB3 B;  1PLS A;  3MPX A;  4HAW B;  1U5D A;  4NY0 A;  2LKO A;  1U29 A;  3QWM A;  2DX1 A;  3AU5 A;  2YS3 A;  2ELA A;  4NSW A;  2QKM A;  2COD A;  3PVU A;  4Y94 A;  3U8Z A;  3ZVR A;  2QKL A;  3NSU A;  4F7U P;  2DHI A;  2Z13 A;  4L1R A;  4Z2M B;  4CHJ A;  4MY6 A;  1H10 A;  1ZC3 B;  5KQ1 A;  4HAZ B;  2CY4 A;  2L1C A;  1GG3 A;  2XQN M;  3FSS A;  5C5B A;  5DHF B;  2K8E A;  4MT7 A;  1DBH A;  2DTC A;  4IOY X;  4KVG B;  2N23 A;  3QBV B;  2YF0 A;  3UZT A;  1LW3 A;  2Z0P A;  2NMB A;  4HAV B;  4HDQ A;  2DLW A;  3GYO A;  3FM8 C;  2YS5 A;  3SV1 A;  1XR0 B;  1MKE A;  2Z4D A;  5D3Y A;  4DBB A;  3LJU X;  2W2X C;  1DDM A;  1WGU A;  4WJ7 A;  4DX8 A;  1UEF A;  1FHO A;  1XOD A;  4EJN A;  4GOU A;  1V61 A;  3TVV A;  1FB8 A;  2Y8F A;  3T06 A;  2V76 A;  3KSY A;  1PMS A;  1U5E A;  1U5F A;  5J3T A;  1AQC A;  1DDV A;  4D6W A;  4A6H A;  2G35 A;  1TJ6 A;  1H4R A;  3HIE A;  1QC6 A;  1K5G B;  3F0W A;  3WA0 A;  4ZRK A;  1KZ7 A;  2ELB A;  1P6S A;  3NWA A;  4CHM A;  1MK7 B;  3A58 A;  1X11 A;  2D9Y A;  1WVH A;  4CYE A;  3AU4 A;  2I5F A;  4IFS A;  2GUM A;  2J0M A;  1Q67 A;  2AEH A;  4CSQ A;  3BJI A;  2YRY A;  1T77 A;  4BBK A;  2CAY A;  4PNK A;  1U27 A;  2DKQ A;  3CIK A;  5FI0 A;  2IYB A;  2KCJ A;  3BIN A;  5HE2 A;  5KCV A;  3MDB C;  2DFK A;  1J0W A;  2HTH B;  2W2X D;  1W1D A;  5DIF B;  2D4Q A;  3NW8 A;  2HE7 A;  5JHG A;  4OT1 A; 
#chains in the Genus database with same CATH homology
 1M7E A;  2RSG A;  2YS1 A;  3KY9 A;  1FHX A;  3TO1 A;  4EKU A;  2RGN B;  4IAP A;  2D9Z A;  4F7G A;  1FGY A;  5D3V A;  1XD4 A;  4DXA B;  1EF1 A;  2J0K A;  2GS0 A;  1SGH A;  2GCJ A;  1DYN A;  2DHJ A;  2Z0O A;  1Z87 A;  3D8D A;  2ZPY A;  5FI1 A;  4Z2N A;  3TW1 A;  3N7C A;  2KUP A;  1PFJ A;  2RNR B;  5GOW B;  1B55 A;  1WJ1 A;  2Q13 A;  2UZS A;  3D8E A;  4ZRJ A;  1BWN A;  2M14 A;  2NZ8 B;  5LOP B;  2N0Y A;  1FAO A;  1GC7 A;  2J59 M;  2Y8G A;  1QQG A;  2J0J A;  1EAZ A;  4P7I A;  1U2B A;  5DI9 B;  1W1G A;  1N3H A;  2W2W A;  2DA0 A;  3A8P A;  1OY2 A;  3IVF A;  2EMS A;  2MKR A;  1V5M A;  3SNH A;  2VSZ A;  4GN1 A;  1ZM0 A;  1XKE A;  1EVH A;  1WG7 A;  2COF A;  4HDO A;  2D10 A;  4KHB B;  1UNP A;  1ZVR A;  2FJL A;  4B6H A;  1X05 A;  2COA A;  5LON B;  1BTN A;  4TKN A;  3OAN A;  4XWX A;  3DXD A;  1I2H A;  3A8Q A;  3PVW A;  1X1G A;  4A6F B;  2LG1 A;  1K5D B;  3CXB B;  4HB2 B;  3VOQ A;  3TFM A;  4K81 A;  4WVF B;  1LB1 A;  5EFX A;  4KAX B;  2P0F A;  3SO6 A;  1IRS A;  4KHA A;  4F7H A;  1NU2 A;  4HB0 B;  3WYF B;  5JLJ B;  2DX5 A;  5HE0 A;  3O96 A;  4KHO A;  4A6F A;  2DKP A;  3F5R A;  5C79 A;  4YL8 A;  2COC A;  4TYZ A;  3A98 B;  2AL6 A;  2KGX B;  2Z0Q A;  3RCP A;  1XCG A;  2LYD A;  2I1J A;  3FEH A;  3HK0 A;  4GPT B;  1BTK A;  1UPR A;  2DYN A;  5J3Y A;  1KI1 B;  3ODX A;  1MAI A;  1NTV A;  4GMX B;  3ULC A;  1FOE A;  3VIA A;  3ULB A;  2GCL A;  1I7A A;  2UZR A;  1MIX A;  1WJM A;  2CRF A;  3D8F A;  3DXE A;  2ROV A;  3ODO A;  5CLQ B;  3P7Z A;  2K2U A;  3PVL A;  3PP2 A;  2VRW B;  5CLL B;  2I1K A;  1MK9 B;  1W1H A;  1E5W A;  3AJ4 A;  1TXD A;  1NTY A;  1MPH A;  1P3R A;  3QIJ A;  1FGZ A;  2X18 A;  5DHA B;  3SYX A;  1P5T A;  3GYP A;  4EMO A;  1Y19 B;  4HB4 B;  4GZU A;  1RJ2 A;  3KRX A;  4YON A;  3ML4 A;  5DH9 B;  2YT1 A;  5L81 A;  5C5B B;  1GC6 A;  1OMW A;  1U5G A;  1WI1 A;  1V88 A;  1ZC4 B;  2D11 A;  3M1I B;  2M38 A;  1V5P A;  2YVC A;  1UPQ A;  5C16 A;  4A5K A;  2RLO A;  1OQN A;  3ZDT A;  1EGX A;  2I5C A;  3PEG A;  3P6A A;  2IFS A;  4HHV A;  1M7R A;  2GJY A;  4GXB A;  5D3X A;  1TQZ A;  2RVB B;  2H7D A;  2D9V A;  5C6R A;  1BAK A;  4DX9 0;  2P0H A;  4K2P A;  2D9W A;  4D0N B;  3TCA A;  5HE3 A;  1X86 A;  4K17 A;  2P0D A;  2D2Q A;  2ADZ A;  1SHC A;  1UNR A;  2OTX A;  3PG7 A;  4HAY B;  2R0D A;  2DHK A;  2OQB A;  1RRP B;  5KQ4 A;  2EJ8 A;  4GMV A;  1V5U A;  4L6E A;  3G9W A;  4A6K A;  3U7D A;  1ZSQ A;  3PSC A;  2VKI A;  2UVM A;  2RUK B;  2LOZ A;  4K2O A;  2LUL A;  4PQ0 A;  5D27 A;  3ODW A;  2H7E A;  2D9X A;  2K00 A;  2K2J A;  3DXC A;  3SUZ A;  2L2I A;  1KZG A;  1V89 A;  3V5W A;  1NI2 A;  3KRW A;  4HAU B;  1XX0 A;  4HAX B;  1AWE A;  2MDX A;  3HQC A;  2LOX A;  2P8V A;  5J3Q A;  2R09 A;  2CY5 A;  2MFQ A;  1ISN A;  4WSF A;  5HE1 A;  2DN6 A;  1X1F A;  4MK0 A;  1MIZ B;  1WGQ A;  1DDW A;  2EC1 A;  3HW2 B;  5JP4 A;  3X23 A;  3KZ1 A;  5JHH A;  4ZRI A;  2PZ1 A;  2MWN B;  1J19 A;  1DRO A;  2EMT A;  2YT0 A;  1FHW A;  1UNQ A;  2DYQ A;  5D3W A;  4C0A A;  2ROZ B;  4HAT B;  2BCJ A;  3PZD A;  2YSZ A;  2JP2 A;  2Y7B A;  2E2X A;  1Y5O A;  4H8S A;  4HB3 B;  1PLS A;  3MPX A;  4HAW B;  1U5D A;  4NY0 A;  2LKO A;  1U29 A;  3QWM A;  2DX1 A;  3AU5 A;  2YS3 A;  2ELA A;  4NSW A;  2QKM A;  2COD A;  3PVU A;  4Y94 A;  3U8Z A;  3ZVR A;  2QKL A;  3NSU A;  4F7U P;  2DHI A;  4Z2M B;  4CHJ A;  4MY6 A;  1H10 A;  1ZC3 B;  5KQ1 A;  4HAZ B;  2CY4 A;  2L1C A;  1GG3 A;  2XQN M;  3FSS A;  5C5B A;  5DHF B;  4MT7 A;  1DBH A;  2DTC A;  4IOY X;  4KVG B;  2N23 A;  3QBV B;  2YF0 A;  3UZT A;  1LW3 A;  2Z0P A;  2NMB A;  4HAV B;  4HDQ A;  2DLW A;  3GYO A;  3FM8 C;  2YS5 A;  3SV1 A;  1XR0 B;  1MKE A;  5D3Y A;  4DBB A;  3LJU X;  2W2X C;  1DDM A;  1WGU A;  4WJ7 A;  4DX8 A;  1UEF A;  1FHO A;  1XOD A;  4EJN A;  1V61 A;  3TVV A;  1FB8 A;  2Y8F A;  3T06 A;  2V76 A;  3KSY A;  1PMS A;  1U5E A;  1U5F A;  5J3T A;  1AQC A;  1DDV A;  4A6H A;  2G35 A;  1TJ6 A;  1H4R A;  1QC6 A;  1K5G B;  3F0W A;  3WA0 A;  4ZRK A;  1KZ7 A;  2ELB A;  1P6S A;  4CHM A;  1MK7 B;  1X11 A;  2D9Y A;  1WVH A;  4CYE A;  3AU4 A;  2I5F A;  4IFS A;  2J0M A;  1Q67 A;  2AEH A;  3BJI A;  2YRY A;  4BBK A;  2CAY A;  4PNK A;  1U27 A;  2DKQ A;  3CIK A;  5FI0 A;  2IYB A;  2KCJ A;  3BIN A;  5HE2 A;  5KCV A;  3MDB C;  2DFK A;  1J0W A;  2HTH B;  2W2X D;  1W1D A;  5DIF B;  2D4Q A;  2HE7 A;  5JHG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...