2GS0A

Nmr structure of the complex between the ph domain of the tfb1 subunit from tfiih and the activation domain of p53
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
115
structure length
115
Chain Sequence
PSHSGAAIFEKVSGIIAINEDVSPAELTWRSTDGDKVHTVVLSTIDKLQATPASSEKMMLRLIGKVDESKKRKDNEGNEVVPKPQRHMFSFNNRTVMDNIKMTLQQIISRYKDAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords RNA polymerase II transcription factor B subunit 1
publication title Structure of the Tfb1/p53 complex: Insights into the interaction between the p62/Tfb1 subunit of TFIIH and the activation domain of p53.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 22
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2006-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08567 PH_TFIIH TFIIH p62 subunit, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2gs0A00
1FAOA 3PVWA 1WGQA 3OANA 1KZ7A 4A6HA 4KAXB 4BBKA 5HE1A 2LKOA 5HE0A 3SUZA 3QIJA 4DX90 2FJLA 2PZ1A 3IVFA 3A98B 3WA0A 1BTNA 1WVHA 2ROVA 1Z87A 3ODOA 3PEGA 1EF1A 1LW3A 2D9VA 2ROZB 2Y8GA 3A8QA 1H10A 1H4RA 1P5TA 2DHJA 4HAVB 4MY6A 1ZC4B 2EJ8A 3HW2B 1ZM0A 4F7UP 1U5EA 1MAIA 1KZGA 2GCLA 2GCJA 3WYFB 2NMBA 3ZDTA 4A6FA 2UZRA 4WJ7A 2Y7BA 3ULCA 1DYNA 1MK9B 2DHIA 3LJUX 1U5FA 3SV1A 1NTYA 3QBVB 4F7HA 5D3WA 2LG1A 1V5UA 2DYNA 3KY9A 2R09A 4HAYB 5DH9B 2MKRA 4GZUA 4K2OA 3VIAA 2W2XD 3KSYA 1UNPA 2I1KA 2COCA 2YS3A 3F0WA 3GYOA 4K17A 1X1FA 1N3HA 2D11A 2NZ8B 1XX0A 2E2XA 2Z0PA 4DX8A 3ODXA 5C16A 2LULA 4GMVA 1FGYA 1E5WA 1WJ1A 4KHOA 1SGHA 3PP2A 2YRYA 2M38A 2DKQA 3BINA 2CRFA 1EVHA 1Y19B 5JHGA 3SO6A 4K81A 4MT7A 2Z0QA 5HE2A 3DXDA 4Z2MB 1TJ6A 2MDXA 1X05A 2EC1A 2H7EA 4WSFA 2I1JA 1J19A 3FEHA 2P0FA 2RGNB 1FHXA 4WVFB 3N7CA 2DKPA 3U7DA 1M7EA 3G9WA 2G35A 2QKLA 4KHBB 2CODA 4HDQA 1FHOA 1V89A 1B55A 4MK0A 1GC7A 3T06A 3HQCA 4GN1A 1ISNA 5DI9B 2GJYA 2HTHB 2DYQA 4C0AA 1GC6A 3F5RA 1XCGA 1X11A 4GXBA 5JLJB 1OY2A 4KHAA 3DXCA 1ZVRA 2XQNM 1M7RA 2AEHA 3BJIA 1ZC3B 2VKIA 1U27A 1RRPB 2P8VA 1J0WA 2H7DA 3D8FA 1Y5OA 1PFJA 4ZRKA 4HAWB 3P6AA 3PVLA 1GG3A 4Z2NA 2D9XA 1MKEA 4A6KA 2J0KA 1I2HA 5DHFB 3HK0A 2DN6A 4K2PA 2Y8FA 1BTKA 2P0DA 5FI0A 3PG7A 1P6SA 1SHCA 3KZ1A 2BCJA 3AU5A 2KGXB 1AWEA 4A5KA 4HB3B 5KQ4A 2Z0OA 1BAKA 2RUKB 2YVCA 2ELAA 5LOPB 3KRWA 2W2WA 1V88A 4YONA 1NTVA 1OQNA 3TCAA 1FHWA 1MIXA 2J0MA 3RCPA 2YT0A 2ZPYA 1V5PA 5CLQB 1XODA 2I5CA 3GYPA 1EAZA 4CYEA 4IOYX 3PZDA 2N23A 1NU2A 1W1HA 3ODWA 5EFXA 4HHVA 3ML4A 2MWNB 5DHAB 2J0JA 2V76A 2R0DA 4A6FB 4XWXA 1OMWA 1MK7B 4ZRIA 2YS5A 3TFMA 3CIKA 1V61A 2AL6A 1AQCA 2L1CA 2K2JA 3X23A 4TKNA 2YS1A 3ULBA 1WGUA 2X18A 3TVVA 1DROA 2D2QA 3D8DA 5JHHA 4P7IA 3PSCA 4NY0A 2YT1A 5D3XA 5FI1A 1PMSA 5D27A 1XKEA 3O96A 2D9WA 2L2IA 3SYXA 2EMTA 3DXEA 2KCJA 1U2BA 1DBHA 2RNRB 4CHJA 1WJMA 2LYDA 4HAUB 4B6HA 4Y94A 2DX5A 2OQBA 4D0NB 2ELBA 2EMSA 4PNKA 2D10A 5DIFB 3UZTA 3V5WA 4HATB 1MPHA 2DX1A 2ADZA 5CLLB 1UNRA 2RSGA 2DFKA 4IFSA 1DDMA 2DA0A 4KVGB 4CHMA 2YSZA 1FOEA 2VSZA 2D4QA 2GS0A 1WG7A 1FGZA 2CAYA 5C5BA 1K5GB 2DTCA 2RLOA 1LB1A 2W2XC 3TO1A 3MPXA 1I7AA 1ZSQA 2P0HA 1Q67A 3KRXA 1DDWA 5D3YA 1U29A 1KI1B 2LOZA 4YL8A 2J59M 5J3YA 5C6RA 2YF0A 4PQ0A 5HE3A 2CY4A 2IYBA 4ZRJA 1PLSA 1TXDA 5KQ1A 3AJ4A 2DHKA 1UEFA 3MDBC 2COFA 2JP2A 3TW1A 4TYZA 1EGXA 3P7ZA 1DDVA 1XR0B 2COAA 1U5GA 5J3TA 2IFSA 4NSWA 1IRSA 2UVMA 1QC6A 3SNHA 2Q13A 4EMOA 3PVUA 1X86A 2K00A 2LOXA 1FB8A 4GMXB 5C5BB 1QQGA 2UZSA 2D9ZA 2D9YA 1W1DA 4EJNA 2QKMA 2DLWA 3ZVRA 1BWNA 3AU4A 1NI2A 4HAZB 3VOQA 2RVBB 4F7GA 4DXAB 5J3QA 2N0YA 2I5FA 2CY5A 5LONB 1RJ2A 1V5MA 1W1GA 1P3RA 4HDOA 2M14A 3NSUA 1K5DB 1MIZB 4DBBA 1UPRA 4EKUA 3QWMA 2K2UA 4HB4B 3FM8C 4IAPA 5C79A 5L81A 5D3VA 1U5DA 4H8SA 3M1IB 4HB2B 3A8PA 1XD4A 1X1GA 3CXBB 3D8EA 2HE7A 3FSSA 4L6EA 5KCVA 2OTXA 4HB0B 4GPTB 3U8ZA 1WI1A 1TQZA 2MFQA 2KUPA 2VRWB 1UPQA 1UNQA 5GOWB 4HAXB 5JP4A
chains in the Genus database with same CATH superfamily
1FAOA 3PVWA 1WGQA 3OANA 1KZ7A 4A6HA 4KAXB 4BBKA 4CSQA 5HE1A 2LKOA 5HE0A 3SUZA 3QIJA 4DX90 2FJLA 2PZ1A 3IVFA 3A98B 3WA0A 1BTNA 1WVHA 2ROVA 1Z87A 3DCXA 3ODOA 3PEGA 1EF1A 1LW3A 2D9VA 2ROZB 2Y8GA 3A8QA 1H10A 1H4RA 1P5TA 2DHJA 4HAVB 4MY6A 1ZC4B 2EJ8A 3HW2B 1ZM0A 4F7UP 1U5EA 1MAIA 1KZGA 2GCLA 3B77A 2GCJA 3WYFB 2Z14A 2NMBA 3ZDTA 4A6FA 2UZRA 2Z13A 4WJ7A 2Y7BA 3ULCA 1DYNA 1MK9B 2DHIA 3LJUX 1U5FA 3SV1A 4D6WA 1NTYA 3QBVB 4F7HA 5D3WA 2LG1A 1V5UA 2DYNA 3KY9A 2R09A 2FJUB 4HAYB 5DH9B 2MKRA 4GZUA 4K2OA 3VIAA 2W2XD 3KSYA 1UNPA 2I1KA 2COCA 2YS3A 3F0WA 3GYOA 4K17A 1X1FA 1N3HA 2D11A 2NZ8B 1XX0A 2E2XA 2Z0PA 4DX8A 3ODXA 5C16A 2LULA 4GMVA 1FGYA 1E5WA 1WJ1A 4KHOA 1SGHA 3PP2A 4QJ5B 2YRYA 2M38A 2DKQA 3BINA 3NWAA 2CRFA 1EVHA 1Y19B 5JHGA 3SO6A 3HIEA 4K81A 4MT7A 2Z0QA 5HE2A 3DXDA 2NBVA 1MI1A 1TJ6A 4Z2MB 2MDXA 1X05A 2EC1A 2H7EA 4GNKB 4WSFA 2I1JA 4L1RA 1J19A 3FEHA 2P0FA 2RGNB 1FHXA 4WVFB 3N7CA 2DKPA 2KIEA 3U7DA 1M7EA 3G9WA 2G35A 2QKLA 4KHBB 2CODA 4HDQA 1FHOA 1V89A 1B55A 4MK0A 1GC7A 3T06A 3HQCA 4GN1A 1ISNA 5DI9B 4QJ4B 2GJYA 2HTHB 1T77A 2DYQA 4C0AA 1GC6A 3F5RA 1XCGA 1X11A 4GXBA 5JLJB 1OY2A 4KHAA 3DXCA 1ZVRA 2XQNM 1M7RA 3FVCA 2AEHA 3BJIA 1ZC3B 2VKIA 1U27A 1RRPB 2P8VA 1J0WA 2H7DA 5IRSA 3D8FA 1Y5OA 1PFJA 4ZRKA 4HAWB 2K8EA 3P6AA 3PVLA 1GG3A 4Z2NA 2D9XA 1MKEA 4A6KA 2J0KA 1I2HA 5DHFB 3HK0A 2DN6A 4K2PA 2Y8FA 1BTKA 2P0DA 5FI0A 1P6SA 1SHCA 3PG7A 3KZ1A 2BCJA 3AU5A 4DIXA 2KGXB 1AWEA 4A5KA 4HB3B 5KQ4A 2GUMA 2Z0OA 1BAKA 2RUKB 2YVCA 2ELAA 5LOPB 3KRWA 4OT1A 2W2WA 1V88A 4YONA 1NTVA 2R2YA 1OQNA 3TCAA 1FHWA 1MIXA 2J0MA 3RCPA 2YT0A 2ZPYA 1V5PA 5CLQB 1XODA 2I5CA 5M4YB 3GYPA 1EAZA 2KR0A 4CYEA 4IOYX 3PZDA 2N23A 2YT2A 3NWDA 1NU2A 1W1HA 3ODWA 5EFXA 4HHVA 3ML4A 2MWNB 5DHAB 2J0JA 2V76A 2R0DA 4A6FB 4XWXA 1OMWA 1MK7B 4ZRIA 2YS5A 3TFMA 3CIKA 1ZYIA 1V61A 2AL6A 2K49A 1AQCA 2L1CA 2K2JA 3X23A 4TKNA 2YS1A 3ULBA 1WGUA 2X18A 3TVVA 1DROA 2D2QA 2Z59A 3D8DA 5JHHA 4P7IA 2Z4DA 3PSCA 4NY0A 2YT1A 5D3XA 5FI1A 1PMSA 5D27A 1XKEA 3O96A 2D9WA 2L2IA 3SYXA 2EMTA 2ZKMX 3DXEA 2KCJA 1U2BA 1DBHA 5I2SA 2RNRB 4CHJA 1WJMA 2LYDA 4GOUA 4HAUB 4B6HA 4Y94A 2DX5A 2OQBA 4D0NB 2ELBA 2EMSA 5LG4B 4PNKA 2D10A 5DIFB 3UZTA 3V5WA 4HATB 1MPHA 2DX1A 2ADZA 5CLLB 1UNRA 2RSGA 2DFKA 4IFSA 3U12A 1DDMA 2DA0A 4KVGB 4CHMA 2YSZA 1FOEA 2VSZA 2D4QA 2GS0A 1WG7A 1FGZA 2CAYA 5C5BA 1K5GB 2DTCA 2RLOA 1LB1A 2W2XC 3TO1A 3MPXA 1I7AA 4QJ3B 1ZSQA 2P0HA 1Q67A 3KRXA 1DDWA 5D3YA 1U29A 1KI1B 2LOZA 4YL8A 2J59M 5J3YA 3A58A 2YF0A 5C6RA 4PQ0A 5HE3A 2CY4A 2IYBA 3OHMB 4ZRJA 1PLSA 1TXDA 5KQ1A 3NWFA 3AJ4A 2DHKA 1UEFA 4OSNA 3MDBC 2RRFA 2COFA 2JP2A 3TW1A 4TYZA 1EGXA 3P7ZA 1DDVA 1XR0B 2COAA 1U5GA 5J3TA 2IFSA 4NSWA 1IRSA 2UVMA 1QC6A 2KUQA 3SNHA 2Q13A 4EMOA 3PVUA 1X86A 2K00A 2LOXA 1FB8A 4GMXB 5C5BB 1QQGA 2UZSA 2D9ZA 3NW8A 4KHBA 2D9YA 1W1DA 4EJNA 4HSIA 2QKMA 2DLWA 3ZVRA 1BWNA 3AU4A 1NI2A 4HAZB 3VOQA 2KIGA 2RVBB 4F7GA 4DXAB 5J3QA 2N0YA 2I5FA 2CY5A 3HSAA 5LONB 1RJ2A 1V5MA 1W1GA 1P3RA 4HDOA 2M14A 3NSUA 1K5DB 1MIZB 4DBBA 1UPRA 4QXAB 4EKUA 3QWMA 2K2UA 4HB4B 3FM8C 4IAPA 5C79A 5L81A 5D3VA 1U5DA 4H8SA 3M1IB 4HB2B 5I2MA 3A8PA 1XD4A 1X1GA 3CXBB 3D8EA 2HE7A 3FSSA 4L6EA 5KCVA 2OTXA 4HB0B 4GPTB 3U8ZA 1WI1A 1TQZA 2MFQA 2KUPA 2VRWB 1UPQA 1UNQA 5GOWB 4HAXB 5JP4A
chains in the Genus database with same CATH topology
1FAOA 3PVWA 1WGQA 3OANA 1KZ7A 4A6HA 4KAXB 4BBKA 5HE1A 2LKOA 5HE0A 3SUZA 3QIJA 4DX90 2FJLA 2PZ1A 3IVFA 3A98B 3WA0A 1BTNA 1WVHA 2ROVA 1Z87A 3ODOA 3PEGA 1EF1A 1LW3A 2D9VA 2ROZB 2Y8GA 3A8QA 1H10A 1H4RA 1P5TA 2DHJA 4HAVB 4MY6A 1ZC4B 2EJ8A 3HW2B 1ZM0A 4F7UP 1U5EA 1MAIA 1KZGA 2GCLA 2GCJA 3WYFB 2NMBA 3ZDTA 4A6FA 2UZRA 4WJ7A 2Y7BA 3ULCA 1DYNA 1MK9B 2DHIA 3LJUX 1U5FA 3SV1A 1NTYA 3QBVB 4F7HA 5D3WA 2LG1A 1V5UA 2DYNA 3KY9A 2R09A 4HAYB 5DH9B 2MKRA 4GZUA 4K2OA 3VIAA 2W2XD 3KSYA 1UNPA 2I1KA 2COCA 2YS3A 3F0WA 3GYOA 4K17A 1X1FA 1N3HA 2D11A 2NZ8B 1XX0A 2E2XA 2Z0PA 4DX8A 3ODXA 5C16A 2LULA 4GMVA 1FGYA 1E5WA 1WJ1A 4KHOA 1SGHA 3PP2A 2YRYA 2M38A 2DKQA 3BINA 2CRFA 1EVHA 1Y19B 5JHGA 3SO6A 4K81A 4MT7A 2Z0QA 5HE2A 3DXDA 4Z2MB 1TJ6A 2MDXA 1X05A 2EC1A 2H7EA 4WSFA 2I1JA 1J19A 3FEHA 2P0FA 2RGNB 1FHXA 4WVFB 3N7CA 2DKPA 3U7DA 1M7EA 3G9WA 2G35A 2QKLA 4KHBB 2CODA 4HDQA 1FHOA 1V89A 1B55A 4MK0A 1GC7A 3T06A 3HQCA 4GN1A 1ISNA 5DI9B 2GJYA 2HTHB 2DYQA 4C0AA 1GC6A 3F5RA 1XCGA 1X11A 4GXBA 5JLJB 1OY2A 4KHAA 3DXCA 1ZVRA 2XQNM 1M7RA 2AEHA 3BJIA 1ZC3B 2VKIA 1U27A 1RRPB 2P8VA 1J0WA 2H7DA 3D8FA 1Y5OA 1PFJA 4ZRKA 4HAWB 3P6AA 3PVLA 1GG3A 4Z2NA 2D9XA 1MKEA 4A6KA 2J0KA 1I2HA 5DHFB 3HK0A 2DN6A 4K2PA 2Y8FA 1BTKA 2P0DA 5FI0A 3PG7A 1P6SA 1SHCA 3KZ1A 2BCJA 3AU5A 2KGXB 1AWEA 4A5KA 4HB3B 5KQ4A 2Z0OA 1BAKA 2RUKB 2YVCA 2ELAA 5LOPB 3KRWA 2W2WA 1V88A 4YONA 1NTVA 1OQNA 3TCAA 1FHWA 1MIXA 2J0MA 3RCPA 2YT0A 2ZPYA 1V5PA 5CLQB 1XODA 2I5CA 3GYPA 1EAZA 4CYEA 4IOYX 3PZDA 2N23A 1NU2A 1W1HA 3ODWA 5EFXA 4HHVA 3ML4A 2MWNB 5DHAB 2J0JA 2V76A 2R0DA 4A6FB 4XWXA 1OMWA 1MK7B 4ZRIA 2YS5A 3TFMA 3CIKA 1V61A 2AL6A 1AQCA 2L1CA 2K2JA 3X23A 4TKNA 2YS1A 3ULBA 1WGUA 2X18A 3TVVA 1DROA 2D2QA 3D8DA 5JHHA 4P7IA 3PSCA 4NY0A 2YT1A 5D3XA 5FI1A 1PMSA 5D27A 1XKEA 3O96A 2D9WA 2L2IA 3SYXA 2EMTA 3DXEA 2KCJA 1U2BA 1DBHA 2RNRB 4CHJA 1WJMA 2LYDA 4HAUB 4B6HA 4Y94A 2DX5A 2OQBA 4D0NB 2ELBA 2EMSA 4PNKA 2D10A 5DIFB 3UZTA 3V5WA 4HATB 1MPHA 2DX1A 2ADZA 5CLLB 1UNRA 2RSGA 2DFKA 4IFSA 1DDMA 2DA0A 4KVGB 4CHMA 2YSZA 1FOEA 2VSZA 2D4QA 2GS0A 1WG7A 1FGZA 2CAYA 5C5BA 1K5GB 2DTCA 2RLOA 1LB1A 2W2XC 3TO1A 3MPXA 1I7AA 1ZSQA 2P0HA 1Q67A 3KRXA 1DDWA 5D3YA 1U29A 1KI1B 2LOZA 4YL8A 2J59M 5J3YA 5C6RA 2YF0A 4PQ0A 5HE3A 2CY4A 2IYBA 4ZRJA 1PLSA 1TXDA 5KQ1A 3AJ4A 2DHKA 1UEFA 3MDBC 2COFA 2JP2A 3TW1A 4TYZA 1EGXA 3P7ZA 1DDVA 1XR0B 2COAA 1U5GA 5J3TA 2IFSA 4NSWA 1IRSA 2UVMA 1QC6A 3SNHA 2Q13A 4EMOA 3PVUA 1X86A 2K00A 2LOXA 1FB8A 4GMXB 5C5BB 1QQGA 2UZSA 2D9ZA 2D9YA 1W1DA 4EJNA 2QKMA 2DLWA 3ZVRA 1BWNA 3AU4A 1NI2A 4HAZB 3VOQA 2RVBB 4F7GA 4DXAB 5J3QA 2N0YA 2I5FA 2CY5A 5LONB 1RJ2A 1V5MA 1W1GA 1P3RA 4HDOA 2M14A 3NSUA 1K5DB 1MIZB 4DBBA 1UPRA 4EKUA 3QWMA 2K2UA 4HB4B 3FM8C 4IAPA 5C79A 5L81A 5D3VA 1U5DA 4H8SA 3M1IB 4HB2B 3A8PA 1XD4A 1X1GA 3CXBB 3D8EA 2HE7A 3FSSA 4L6EA 5KCVA 2OTXA 4HB0B 4GPTB 3U8ZA 1WI1A 1TQZA 2MFQA 2KUPA 2VRWB 1UPQA 1UNQA 5GOWB 4HAXB 5JP4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FAO A;  3PVW A;  1WGQ A;  3OAN A;  1KZ7 A;  4A6H A;  4KAX B;  4BBK A;  5HE1 A;  2LKO A;  5HE0 A;  3SUZ A;  3QIJ A;  4DX9 0;  2FJL A;  2PZ1 A;  3IVF A;  3A98 B;  3WA0 A;  1BTN A;  1WVH A;  2ROV A;  1Z87 A;  3ODO A;  3PEG A;  1EF1 A;  1LW3 A;  2D9V A;  2ROZ B;  2Y8G A;  3A8Q A;  1H10 A;  1H4R A;  1P5T A;  2DHJ A;  4HAV B;  4MY6 A;  1ZC4 B;  2EJ8 A;  3HW2 B;  1ZM0 A;  4F7U P;  1U5E A;  1MAI A;  1KZG A;  2GCL A;  2GCJ A;  3WYF B;  2NMB A;  3ZDT A;  4A6F A;  2UZR A;  4WJ7 A;  2Y7B A;  3ULC A;  1DYN A;  1MK9 B;  2DHI A;  3LJU X;  1U5F A;  3SV1 A;  1NTY A;  3QBV B;  4F7H A;  5D3W A;  2LG1 A;  1V5U A;  2DYN A;  3KY9 A;  2R09 A;  4HAY B;  5DH9 B;  2MKR A;  4GZU A;  4K2O A;  3VIA A;  2W2X D;  3KSY A;  1UNP A;  2I1K A;  2COC A;  2YS3 A;  3F0W A;  3GYO A;  4K17 A;  1X1F A;  1N3H A;  2D11 A;  2NZ8 B;  1XX0 A;  2E2X A;  2Z0P A;  4DX8 A;  3ODX A;  5C16 A;  2LUL A;  4GMV A;  1FGY A;  1E5W A;  1WJ1 A;  4KHO A;  1SGH A;  3PP2 A;  2YRY A;  2M38 A;  2DKQ A;  3BIN A;  2CRF A;  1EVH A;  1Y19 B;  5JHG A;  3SO6 A;  4K81 A;  4MT7 A;  2Z0Q A;  5HE2 A;  3DXD A;  4Z2M B;  1TJ6 A;  2MDX A;  1X05 A;  2EC1 A;  2H7E A;  4WSF A;  2I1J A;  1J19 A;  3FEH A;  2P0F A;  2RGN B;  1FHX A;  4WVF B;  3N7C A;  2DKP A;  3U7D A;  1M7E A;  3G9W A;  2G35 A;  2QKL A;  4KHB B;  2COD A;  4HDQ A;  1FHO A;  1V89 A;  1B55 A;  4MK0 A;  1GC7 A;  3T06 A;  3HQC A;  4GN1 A;  1ISN A;  5DI9 B;  2GJY A;  2HTH B;  2DYQ A;  4C0A A;  1GC6 A;  3F5R A;  1XCG A;  1X11 A;  4GXB A;  5JLJ B;  1OY2 A;  4KHA A;  3DXC A;  1ZVR A;  2XQN M;  1M7R A;  2AEH A;  3BJI A;  1ZC3 B;  2VKI A;  1U27 A;  1RRP B;  2P8V A;  1J0W A;  2H7D A;  3D8F A;  1Y5O A;  1PFJ A;  4ZRK A;  4HAW B;  3P6A A;  3PVL A;  1GG3 A;  4Z2N A;  2D9X A;  1MKE A;  4A6K A;  2J0K A;  1I2H A;  5DHF B;  3HK0 A;  2DN6 A;  4K2P A;  2Y8F A;  1BTK A;  2P0D A;  5FI0 A;  3PG7 A;  1P6S A;  1SHC A;  3KZ1 A;  2BCJ A;  3AU5 A;  2KGX B;  1AWE A;  4A5K A;  4HB3 B;  5KQ4 A;  2Z0O A;  1BAK A;  2RUK B;  2YVC A;  2ELA A;  5LOP B;  3KRW A;  2W2W A;  1V88 A;  4YON A;  1NTV A;  1OQN A;  3TCA A;  1FHW A;  1MIX A;  2J0M A;  3RCP A;  2YT0 A;  2ZPY A;  1V5P A;  5CLQ B;  1XOD A;  2I5C A;  3GYP A;  1EAZ A;  4CYE A;  4IOY X;  3PZD A;  2N23 A;  1NU2 A;  1W1H A;  3ODW A;  5EFX A;  4HHV A;  3ML4 A;  2MWN B;  5DHA B;  2J0J A;  2V76 A;  2R0D A;  4A6F B;  4XWX A;  1OMW A;  1MK7 B;  4ZRI A;  2YS5 A;  3TFM A;  3CIK A;  1V61 A;  2AL6 A;  1AQC A;  2L1C A;  2K2J A;  3X23 A;  4TKN A;  2YS1 A;  3ULB A;  1WGU A;  2X18 A;  3TVV A;  1DRO A;  2D2Q A;  3D8D A;  5JHH A;  4P7I A;  3PSC A;  4NY0 A;  2YT1 A;  5D3X A;  5FI1 A;  1PMS A;  5D27 A;  1XKE A;  3O96 A;  2D9W A;  2L2I A;  3SYX A;  2EMT A;  3DXE A;  2KCJ A;  1U2B A;  1DBH A;  2RNR B;  4CHJ A;  1WJM A;  2LYD A;  4HAU B;  4B6H A;  4Y94 A;  2DX5 A;  2OQB A;  4D0N B;  2ELB A;  2EMS A;  4PNK A;  2D10 A;  5DIF B;  3UZT A;  3V5W A;  4HAT B;  1MPH A;  2DX1 A;  2ADZ A;  5CLL B;  1UNR A;  2RSG A;  2DFK A;  4IFS A;  1DDM A;  2DA0 A;  4KVG B;  4CHM A;  2YSZ A;  1FOE A;  2VSZ A;  2D4Q A;  2GS0 A;  1WG7 A;  1FGZ A;  2CAY A;  5C5B A;  1K5G B;  2DTC A;  2RLO A;  1LB1 A;  2W2X C;  3TO1 A;  3MPX A;  1I7A A;  1ZSQ A;  2P0H A;  1Q67 A;  3KRX A;  1DDW A;  5D3Y A;  1U29 A;  1KI1 B;  2LOZ A;  4YL8 A;  2J59 M;  5J3Y A;  5C6R A;  2YF0 A;  4PQ0 A;  5HE3 A;  2CY4 A;  2IYB A;  4ZRJ A;  1PLS A;  1TXD A;  5KQ1 A;  3AJ4 A;  2DHK A;  1UEF A;  3MDB C;  2COF A;  2JP2 A;  3TW1 A;  4TYZ A;  1EGX A;  3P7Z A;  1DDV A;  1XR0 B;  2COA A;  1U5G A;  5J3T A;  2IFS A;  4NSW A;  1IRS A;  2UVM A;  1QC6 A;  3SNH A;  2Q13 A;  4EMO A;  3PVU A;  1X86 A;  2K00 A;  2LOX A;  1FB8 A;  4GMX B;  5C5B B;  1QQG A;  2UZS A;  2D9Z A;  2D9Y A;  1W1D A;  4EJN A;  2QKM A;  2DLW A;  3ZVR A;  1BWN A;  3AU4 A;  1NI2 A;  4HAZ B;  3VOQ A;  2RVB B;  4F7G A;  4DXA B;  5J3Q A;  2N0Y A;  2I5F A;  2CY5 A;  5LON B;  1RJ2 A;  1V5M A;  1W1G A;  1P3R A;  4HDO A;  2M14 A;  3NSU A;  1K5D B;  1MIZ B;  4DBB A;  1UPR A;  4EKU A;  3QWM A;  2K2U A;  4HB4 B;  3FM8 C;  4IAP A;  5C79 A;  5L81 A;  5D3V A;  1U5D A;  4H8S A;  3M1I B;  4HB2 B;  3A8P A;  1XD4 A;  1X1G A;  3CXB B;  3D8E A;  2HE7 A;  3FSS A;  4L6E A;  5KCV A;  2OTX A;  4HB0 B;  4GPT B;  3U8Z A;  1WI1 A;  1TQZ A;  2MFQ A;  2KUP A;  2VRW B;  1UPQ A;  1UNQ A;  5GOW B;  4HAX B;  5JP4 A; 
#chains in the Genus database with same CATH topology
 1FAO A;  3PVW A;  1WGQ A;  3OAN A;  1KZ7 A;  4A6H A;  4KAX B;  4BBK A;  4CSQ A;  5HE1 A;  2LKO A;  5HE0 A;  3SUZ A;  3QIJ A;  4DX9 0;  2FJL A;  2PZ1 A;  3IVF A;  3A98 B;  3WA0 A;  1BTN A;  1WVH A;  2ROV A;  1Z87 A;  3DCX A;  3ODO A;  3PEG A;  1EF1 A;  1LW3 A;  2D9V A;  2ROZ B;  2Y8G A;  3A8Q A;  1H10 A;  1H4R A;  1P5T A;  2DHJ A;  4HAV B;  4MY6 A;  1ZC4 B;  2EJ8 A;  3HW2 B;  1ZM0 A;  4F7U P;  1U5E A;  1MAI A;  1KZG A;  2GCL A;  3B77 A;  2GCJ A;  3WYF B;  2Z14 A;  2NMB A;  3ZDT A;  4A6F A;  2UZR A;  2Z13 A;  4WJ7 A;  2Y7B A;  3ULC A;  1DYN A;  1MK9 B;  2DHI A;  3LJU X;  1U5F A;  3SV1 A;  4D6W A;  1NTY A;  3QBV B;  4F7H A;  5D3W A;  2LG1 A;  1V5U A;  2DYN A;  3KY9 A;  2R09 A;  2FJU B;  4HAY B;  5DH9 B;  2MKR A;  4GZU A;  4K2O A;  3VIA A;  2W2X D;  3KSY A;  1UNP A;  2I1K A;  2COC A;  2YS3 A;  3F0W A;  3GYO A;  4K17 A;  1X1F A;  1N3H A;  2D11 A;  2NZ8 B;  1XX0 A;  2E2X A;  2Z0P A;  4DX8 A;  3ODX A;  5C16 A;  2LUL A;  4GMV A;  1FGY A;  1E5W A;  1WJ1 A;  4KHO A;  1SGH A;  3PP2 A;  4QJ5 B;  2YRY A;  2M38 A;  2DKQ A;  3BIN A;  3NWA A;  2CRF A;  1EVH A;  1Y19 B;  5JHG A;  3SO6 A;  3HIE A;  4K81 A;  4MT7 A;  2Z0Q A;  5HE2 A;  3DXD A;  2NBV A;  1MI1 A;  1TJ6 A;  4Z2M B;  2MDX A;  1X05 A;  2EC1 A;  2H7E A;  4GNK B;  4WSF A;  2I1J A;  4L1R A;  1J19 A;  3FEH A;  2P0F A;  2RGN B;  1FHX A;  4WVF B;  3N7C A;  2DKP A;  2KIE A;  3U7D A;  1M7E A;  3G9W A;  2G35 A;  2QKL A;  4KHB B;  2COD A;  4HDQ A;  1FHO A;  1V89 A;  1B55 A;  4MK0 A;  1GC7 A;  3T06 A;  3HQC A;  4GN1 A;  1ISN A;  5DI9 B;  4QJ4 B;  2GJY A;  2HTH B;  1T77 A;  2DYQ A;  4C0A A;  1GC6 A;  3F5R A;  1XCG A;  1X11 A;  4GXB A;  5JLJ B;  1OY2 A;  4KHA A;  3DXC A;  1ZVR A;  2XQN M;  1M7R A;  3FVC A;  2AEH A;  3BJI A;  1ZC3 B;  2VKI A;  1U27 A;  1RRP B;  2P8V A;  1J0W A;  2H7D A;  5IRS A;  3D8F A;  1Y5O A;  1PFJ A;  4ZRK A;  4HAW B;  2K8E A;  3P6A A;  3PVL A;  1GG3 A;  4Z2N A;  2D9X A;  1MKE A;  4A6K A;  2J0K A;  1I2H A;  5DHF B;  3HK0 A;  2DN6 A;  4K2P A;  2Y8F A;  1BTK A;  2P0D A;  5FI0 A;  1P6S A;  1SHC A;  3PG7 A;  3KZ1 A;  2BCJ A;  3AU5 A;  4DIX A;  2KGX B;  1AWE A;  4A5K A;  4HB3 B;  5KQ4 A;  2GUM A;  2Z0O A;  1BAK A;  2RUK B;  2YVC A;  2ELA A;  5LOP B;  3KRW A;  4OT1 A;  2W2W A;  1V88 A;  4YON A;  1NTV A;  2R2Y A;  1OQN A;  3TCA A;  1FHW A;  1MIX A;  2J0M A;  3RCP A;  2YT0 A;  2ZPY A;  1V5P A;  5CLQ B;  1XOD A;  2I5C A;  5M4Y B;  3GYP A;  1EAZ A;  2KR0 A;  4CYE A;  4IOY X;  3PZD A;  2N23 A;  2YT2 A;  3NWD A;  1NU2 A;  1W1H A;  3ODW A;  5EFX A;  4HHV A;  3ML4 A;  2MWN B;  5DHA B;  2J0J A;  2V76 A;  2R0D A;  4A6F B;  4XWX A;  1OMW A;  1MK7 B;  4ZRI A;  2YS5 A;  3TFM A;  3CIK A;  1ZYI A;  1V61 A;  2AL6 A;  2K49 A;  1AQC A;  2L1C A;  2K2J A;  3X23 A;  4TKN A;  2YS1 A;  3ULB A;  1WGU A;  2X18 A;  3TVV A;  1DRO A;  2D2Q A;  2Z59 A;  3D8D A;  5JHH A;  4P7I A;  2Z4D A;  3PSC A;  4NY0 A;  2YT1 A;  5D3X A;  5FI1 A;  1PMS A;  5D27 A;  1XKE A;  3O96 A;  2D9W A;  2L2I A;  3SYX A;  2EMT A;  2ZKM X;  3DXE A;  2KCJ A;  1U2B A;  1DBH A;  5I2S A;  2RNR B;  4CHJ A;  1WJM A;  2LYD A;  4GOU A;  4HAU B;  4B6H A;  4Y94 A;  2DX5 A;  2OQB A;  4D0N B;  2ELB A;  2EMS A;  5LG4 B;  4PNK A;  2D10 A;  5DIF B;  3UZT A;  3V5W A;  4HAT B;  1MPH A;  2DX1 A;  2ADZ A;  5CLL B;  1UNR A;  2RSG A;  2DFK A;  4IFS A;  3U12 A;  1DDM A;  2DA0 A;  4KVG B;  4CHM A;  2YSZ A;  1FOE A;  2VSZ A;  2D4Q A;  2GS0 A;  1WG7 A;  1FGZ A;  2CAY A;  5C5B A;  1K5G B;  2DTC A;  2RLO A;  1LB1 A;  2W2X C;  3TO1 A;  3MPX A;  1I7A A;  4QJ3 B;  1ZSQ A;  2P0H A;  1Q67 A;  3KRX A;  1DDW A;  5D3Y A;  1U29 A;  1KI1 B;  2LOZ A;  4YL8 A;  2J59 M;  5J3Y A;  3A58 A;  2YF0 A;  5C6R A;  4PQ0 A;  5HE3 A;  2CY4 A;  2IYB A;  3OHM B;  4ZRJ A;  1PLS A;  1TXD A;  5KQ1 A;  3NWF A;  3AJ4 A;  2DHK A;  1UEF A;  4OSN A;  3MDB C;  2RRF A;  2COF A;  2JP2 A;  3TW1 A;  4TYZ A;  1EGX A;  3P7Z A;  1DDV A;  1XR0 B;  2COA A;  1U5G A;  5J3T A;  2IFS A;  4NSW A;  1IRS A;  2UVM A;  1QC6 A;  2KUQ A;  3SNH A;  2Q13 A;  4EMO A;  3PVU A;  1X86 A;  2K00 A;  2LOX A;  1FB8 A;  4GMX B;  5C5B B;  1QQG A;  2UZS A;  2D9Z A;  3NW8 A;  4KHB A;  2D9Y A;  1W1D A;  4EJN A;  4HSI A;  2QKM A;  2DLW A;  3ZVR A;  1BWN A;  3AU4 A;  1NI2 A;  4HAZ B;  3VOQ A;  2KIG A;  2RVB B;  4F7G A;  4DXA B;  5J3Q A;  2N0Y A;  2I5F A;  2CY5 A;  3HSA A;  5LON B;  1RJ2 A;  1V5M A;  1W1G A;  1P3R A;  4HDO A;  2M14 A;  3NSU A;  1K5D B;  1MIZ B;  4DBB A;  1UPR A;  4QXA B;  4EKU A;  3QWM A;  2K2U A;  4HB4 B;  3FM8 C;  4IAP A;  5C79 A;  5L81 A;  5D3V A;  1U5D A;  4H8S A;  3M1I B;  4HB2 B;  5I2M A;  3A8P A;  1XD4 A;  1X1G A;  3CXB B;  3D8E A;  2HE7 A;  3FSS A;  4L6E A;  5KCV A;  2OTX A;  4HB0 B;  4GPT B;  3U8Z A;  1WI1 A;  1TQZ A;  2MFQ A;  2KUP A;  2VRW B;  1UPQ A;  1UNQ A;  5GOW B;  4HAX B;  5JP4 A; 
#chains in the Genus database with same CATH homology
 1FAO A;  3PVW A;  1WGQ A;  3OAN A;  1KZ7 A;  4A6H A;  4KAX B;  4BBK A;  5HE1 A;  2LKO A;  5HE0 A;  3SUZ A;  3QIJ A;  4DX9 0;  2FJL A;  2PZ1 A;  3IVF A;  3A98 B;  3WA0 A;  1BTN A;  1WVH A;  2ROV A;  1Z87 A;  3ODO A;  3PEG A;  1EF1 A;  1LW3 A;  2D9V A;  2ROZ B;  2Y8G A;  3A8Q A;  1H10 A;  1H4R A;  1P5T A;  2DHJ A;  4HAV B;  4MY6 A;  1ZC4 B;  2EJ8 A;  3HW2 B;  1ZM0 A;  4F7U P;  1U5E A;  1MAI A;  1KZG A;  2GCL A;  2GCJ A;  3WYF B;  2NMB A;  3ZDT A;  4A6F A;  2UZR A;  4WJ7 A;  2Y7B A;  3ULC A;  1DYN A;  1MK9 B;  2DHI A;  3LJU X;  1U5F A;  3SV1 A;  1NTY A;  3QBV B;  4F7H A;  5D3W A;  2LG1 A;  1V5U A;  2DYN A;  3KY9 A;  2R09 A;  4HAY B;  5DH9 B;  2MKR A;  4GZU A;  4K2O A;  3VIA A;  2W2X D;  3KSY A;  1UNP A;  2I1K A;  2COC A;  2YS3 A;  3F0W A;  3GYO A;  4K17 A;  1X1F A;  1N3H A;  2D11 A;  2NZ8 B;  1XX0 A;  2E2X A;  2Z0P A;  4DX8 A;  3ODX A;  5C16 A;  2LUL A;  4GMV A;  1FGY A;  1E5W A;  1WJ1 A;  4KHO A;  1SGH A;  3PP2 A;  2YRY A;  2M38 A;  2DKQ A;  3BIN A;  2CRF A;  1EVH A;  1Y19 B;  5JHG A;  3SO6 A;  4K81 A;  4MT7 A;  2Z0Q A;  5HE2 A;  3DXD A;  4Z2M B;  1TJ6 A;  2MDX A;  1X05 A;  2EC1 A;  2H7E A;  4WSF A;  2I1J A;  1J19 A;  3FEH A;  2P0F A;  2RGN B;  1FHX A;  4WVF B;  3N7C A;  2DKP A;  3U7D A;  1M7E A;  3G9W A;  2G35 A;  2QKL A;  4KHB B;  2COD A;  4HDQ A;  1FHO A;  1V89 A;  1B55 A;  4MK0 A;  1GC7 A;  3T06 A;  3HQC A;  4GN1 A;  1ISN A;  5DI9 B;  2GJY A;  2HTH B;  2DYQ A;  4C0A A;  1GC6 A;  3F5R A;  1XCG A;  1X11 A;  4GXB A;  5JLJ B;  1OY2 A;  4KHA A;  3DXC A;  1ZVR A;  2XQN M;  1M7R A;  2AEH A;  3BJI A;  1ZC3 B;  2VKI A;  1U27 A;  1RRP B;  2P8V A;  1J0W A;  2H7D A;  3D8F A;  1Y5O A;  1PFJ A;  4ZRK A;  4HAW B;  3P6A A;  3PVL A;  1GG3 A;  4Z2N A;  2D9X A;  1MKE A;  4A6K A;  2J0K A;  1I2H A;  5DHF B;  3HK0 A;  2DN6 A;  4K2P A;  2Y8F A;  1BTK A;  2P0D A;  5FI0 A;  3PG7 A;  1P6S A;  1SHC A;  3KZ1 A;  2BCJ A;  3AU5 A;  2KGX B;  1AWE A;  4A5K A;  4HB3 B;  5KQ4 A;  2Z0O A;  1BAK A;  2RUK B;  2YVC A;  2ELA A;  5LOP B;  3KRW A;  2W2W A;  1V88 A;  4YON A;  1NTV A;  1OQN A;  3TCA A;  1FHW A;  1MIX A;  2J0M A;  3RCP A;  2YT0 A;  2ZPY A;  1V5P A;  5CLQ B;  1XOD A;  2I5C A;  3GYP A;  1EAZ A;  4CYE A;  4IOY X;  3PZD A;  2N23 A;  1NU2 A;  1W1H A;  3ODW A;  5EFX A;  4HHV A;  3ML4 A;  2MWN B;  5DHA B;  2J0J A;  2V76 A;  2R0D A;  4A6F B;  4XWX A;  1OMW A;  1MK7 B;  4ZRI A;  2YS5 A;  3TFM A;  3CIK A;  1V61 A;  2AL6 A;  1AQC A;  2L1C A;  2K2J A;  3X23 A;  4TKN A;  2YS1 A;  3ULB A;  1WGU A;  2X18 A;  3TVV A;  1DRO A;  2D2Q A;  3D8D A;  5JHH A;  4P7I A;  3PSC A;  4NY0 A;  2YT1 A;  5D3X A;  5FI1 A;  1PMS A;  5D27 A;  1XKE A;  3O96 A;  2D9W A;  2L2I A;  3SYX A;  2EMT A;  3DXE A;  2KCJ A;  1U2B A;  1DBH A;  2RNR B;  4CHJ A;  1WJM A;  2LYD A;  4HAU B;  4B6H A;  4Y94 A;  2DX5 A;  2OQB A;  4D0N B;  2ELB A;  2EMS A;  4PNK A;  2D10 A;  5DIF B;  3UZT A;  3V5W A;  4HAT B;  1MPH A;  2DX1 A;  2ADZ A;  5CLL B;  1UNR A;  2RSG A;  2DFK A;  4IFS A;  1DDM A;  2DA0 A;  4KVG B;  4CHM A;  2YSZ A;  1FOE A;  2VSZ A;  2D4Q A;  2GS0 A;  1WG7 A;  1FGZ A;  2CAY A;  5C5B A;  1K5G B;  2DTC A;  2RLO A;  1LB1 A;  2W2X C;  3TO1 A;  3MPX A;  1I7A A;  1ZSQ A;  2P0H A;  1Q67 A;  3KRX A;  1DDW A;  5D3Y A;  1U29 A;  1KI1 B;  2LOZ A;  4YL8 A;  2J59 M;  5J3Y A;  5C6R A;  2YF0 A;  4PQ0 A;  5HE3 A;  2CY4 A;  2IYB A;  4ZRJ A;  1PLS A;  1TXD A;  5KQ1 A;  3AJ4 A;  2DHK A;  1UEF A;  3MDB C;  2COF A;  2JP2 A;  3TW1 A;  4TYZ A;  1EGX A;  3P7Z A;  1DDV A;  1XR0 B;  2COA A;  1U5G A;  5J3T A;  2IFS A;  4NSW A;  1IRS A;  2UVM A;  1QC6 A;  3SNH A;  2Q13 A;  4EMO A;  3PVU A;  1X86 A;  2K00 A;  2LOX A;  1FB8 A;  4GMX B;  5C5B B;  1QQG A;  2UZS A;  2D9Z A;  2D9Y A;  1W1D A;  4EJN A;  2QKM A;  2DLW A;  3ZVR A;  1BWN A;  3AU4 A;  1NI2 A;  4HAZ B;  3VOQ A;  2RVB B;  4F7G A;  4DXA B;  5J3Q A;  2N0Y A;  2I5F A;  2CY5 A;  5LON B;  1RJ2 A;  1V5M A;  1W1G A;  1P3R A;  4HDO A;  2M14 A;  3NSU A;  1K5D B;  1MIZ B;  4DBB A;  1UPR A;  4EKU A;  3QWM A;  2K2U A;  4HB4 B;  3FM8 C;  4IAP A;  5C79 A;  5L81 A;  5D3V A;  1U5D A;  4H8S A;  3M1I B;  4HB2 B;  3A8P A;  1XD4 A;  1X1G A;  3CXB B;  3D8E A;  2HE7 A;  3FSS A;  4L6E A;  5KCV A;  2OTX A;  4HB0 B;  4GPT B;  3U8Z A;  1WI1 A;  1TQZ A;  2MFQ A;  2KUP A;  2VRW B;  1UPQ A;  1UNQ A;  5GOW B;  4HAX B;  5JP4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...