2GS0A

Nmr structure of the complex between the ph domain of the tfb1 subunit from tfiih and the activation domain of p53
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
115
structure length
115
Chain Sequence
b'PSHSGAAIFEKVSGIIAINEDVSPAELTWRSTDGDKVHTVVLSTIDKLQATPASSEKMMLRLIGKVDESKKRKDNEGNEVVPKPQRHMFSFNNRTVMDNIKMTLQQIISRYKDAD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA polymerase II transcription factor B subunit 1
publication title Structure of the Tfb1/p53 complex: Insights into the interaction between the p62/Tfb1 subunit of TFIIH and the activation domain of p53.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 22
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2006-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08567 PH_TFIIH TFIIH p62 subunit, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2gs0A00
4HB2B 1ZM0A 2ADZA 2YF0A 5GOWB 2QKLA 2X18A 4HHVA 4CHJA 2COAA 4GZUA 3N7CA 2GJYA 4DX8A 3FM8C 2VKIA 1FGZA 4KHAA 2ZPYA 2M14A 4A6HA 1Z87A 2VSZA 5HE1A 3PG7A 4NY0A 4KHBB 4A6FA 2DYQA 4ZRJA 5JP4A 3OANA 3TO1A 5L81A 3GYPA 1P6SA 3PP2A 3AU4A 3KZ1A 2FJLA 1V5UA 3QBVB 4HAUB 4TKNA 1XX0A 5CLQB 2RUKB 1WVHA 4L6EA 2R09A 1UPQA 2I5FA 3T06A 4HAWB 4DBBA 3X23A 1DBHA 3M1IB 1AQCA 2DHIA 3ZDTA 4HB0B 1X86A 4GPTB 3MPXA 1MK9B 2CY5A 5JHGA 3FEHA 1MIXA 5J3TA 1FGYA 4GXBA 1V5PA 4A6KA 4K2PA 5FI0A 3GYOA 3KRXA 4MK0A 2V76A 2NZ8B 2D2QA 3QWMA 3ZVRA 2COCA 5C79A 1KZGA 1Y5OA 2KCJA 1ZC3B 1DDMA 2YS5A 1UNRA 4DXAB 3SYXA 4NSWA 2HTHB 5D3XA 2YS1A 3ODXA 2LULA 3WA0A 2I5CA 4KHOA 4Z2MB 2RGNB 3TCAA 1AWEA 3IVFA 1DROA 2DLWA 3KRWA 3TVVA 3ML4A 3DXDA 2D9VA 5HE3A 2M38A 2OQBA 3ULCA 4A5KA 2AEHA 2UZRA 1KI1B 1W1HA 2DTCA 2LOZA 4P7IA 2D9XA 3ULBA 5DH9B 2W2WA 3P7ZA 3AU5A 3O96A 2RLOA 2OTXA 4KAXB 2IYBA 4HAXB 1W1GA 2D9WA 3QIJA 1H4RA 3U8ZA 2D10A 2N23A 5D3WA 1MPHA 2HE7A 1XODA 3HQCA 1U5EA 2UVMA 4GMVA 4A6FB 1P5TA 5DIFB 4PNKA 2P0DA 3PVWA 4HAYB 4MT7A 3MDBC 1MKEA 3V5WA 2KGXB 4C0AA 4K2OA 4IFSA 5CLLB 2Y8FA 2J0JA 5C5BA 1GC7A 2P0FA 2W2XD 1MAIA 1Y19B 1WI1A 2J59M 2J0MA 5JHHA 5JLJB 3SV1A 2AL6A 2P8VA 1MK7B 3PVUA 3SO6A 1LW3A 1RJ2A 4TYZA 4EKUA 4F7HA 1PLSA 1SHCA 3ODOA 4YONA 1V61A 1WJ1A 2EJ8A 4CHMA 5J3QA 1TJ6A 2D11A 1W1DA 2H7DA 1ZSQA 1U27A 3ODWA 1QC6A 1WJMA 1OY2A 2QKMA 1XR0B 2ELBA 2Z0PA 4B6HA 3VOQA 3A8PA 4Y94A 1FAOA 3HW2B 3D8FA 3VIAA 5LOPB 1XD4A 2K2JA 3KY9A 4HAZB 2DYNA 5C16A 1FB8A 1NU2A 3P6AA 3PZDA 2L1CA 3NSUA 2Z0QA 4DX90 3A98B 3F5RA 5D3VA 2DX5A 1UNPA 1GC6A 4WVFB 1U5DA 4CYEA 1B55A 1MIZB 1OMWA 4HB4B 4WJ7A 1ZVRA 1EGXA 3PVLA 2D9YA 3UZTA 5C6RA 2BCJA 4YL8A 3PEGA 1FHOA 1NTYA 4F7UP 1PMSA 1TXDA 2N0YA 1X1GA 1E5WA 3RCPA 4EMOA 2ROZB 3A8QA 3G9WA 1U5FA 1BTKA 1UEFA 1GG3A 3PSCA 5HE0A 3AJ4A 2LKOA 1J19A 1EF1A 4HAVB 3F0WA 2RVBB 2CODA 1OQNA 4K81A 3SUZA 2R0DA 1ISNA 2RNRB 2DKQA 5HE2A 3TFMA 2LYDA 1PFJA 3SNHA 2IFSA 5DI9B 2DA0A 3BJIA 4MY6A 2Y8GA 1FHXA 2VRWB 2K2UA 3D8EA 5C5BB 2COFA 2YT0A 4F7GA 1DDWA 1WGQA 1I7AA 2GCJA 5EFXA 4XWXA 1NI2A 1QQGA 5LONB 2CAYA 1WGUA 1KZ7A 1X05A 1EVHA 1K5DB 1K5GB 2Q13A 1P3RA 5FI1A 1U2BA 1V89A 2D9ZA 2L2IA 2YRYA 4KVGB 2DN6A 2GCLA 2PZ1A 3DXEA 4GMXB 4WSFA 1RRPB 3LJUX 5D3YA 1TQZA 4HDOA 1U5GA 2I1KA 2DX1A 1X1FA 2MDXA 5D27A 1UNQA 4IAPA 4Z2NA 5KCVA 4ZRKA 4EJNA 1ZC4B 1IRSA 1X11A 2EMSA 2LG1A 1M7EA 2E2XA 1V5MA 4K17A 5DHFB 2MKRA 2Z0OA 1BTNA 2ROVA 3BINA 4GN1A 2Y7BA 1DDVA 1XKEA 5J3YA 4H8SA 1BWNA 4IOYX 1BAKA 1FOEA 4PQ0A 1M7RA 1H10A 2YT1A 1N3HA 1FHWA 2P0HA 2DHJA 2DHKA 2GS0A 2ELAA 2RSGA 3HK0A 1U29A 2DKPA 2MWNB 3WYFB 2XQNM 1SGHA 2MFQA 3CXBB 1EAZA 5KQ4A 4HATB 3DXCA 2W2XC 2CRFA 1UPRA 1LB1A 1V88A 2J0KA 2EMTA 2NMBA 3KSYA 2CY4A 1NTVA 2KUPA 2JP2A 2YSZA 5DHAB 1WG7A 2EC1A 5KQ1A 1DYNA 1I2HA 1Q67A 2G35A 1XCGA 4ZRIA 2LOXA 3D8DA 3U7DA 4HB3B 2I1JA 2DFKA 4BBKA 4HDQA 2H7EA 2UZSA 2YVCA 3TW1A 2D4QA 3CIKA 2K00A 1J0WA 2YS3A 4D0NB 3FSSA
chains in the Genus database with same CATH superfamily
4HB2B 1ZM0A 2ADZA 2YF0A 5GOWB 2ZKMX 2QKLA 2X18A 4HHVA 4CHJA 2COAA 4GZUA 3N7CA 2GJYA 4DX8A 3FM8C 2VKIA 2KUQA 1FGZA 4KHAA 2ZPYA 2M14A 4A6HA 1Z87A 2VSZA 4L1RA 5HE1A 3PG7A 4NY0A 4KHBB 4A6FA 2DYQA 4ZRJA 5JP4A 3OANA 3TO1A 5L81A 3GYPA 1P6SA 3PP2A 3AU4A 3KZ1A 5I2MA 2FJLA 1V5UA 3QBVB 4HAUB 4TKNA 1XX0A 5CLQB 2RUKB 1WVHA 4L6EA 2R09A 1UPQA 2I5FA 3T06A 4HAWB 4DBBA 3X23A 1DBHA 3M1IB 1AQCA 2DHIA 3ZDTA 4HB0B 1X86A 4GPTB 2FJUB 3MPXA 1MK9B 2CY5A 5JHGA 3U12A 3FEHA 1MIXA 5J3TA 2RRFA 1FGYA 4QJ3B 4GXBA 1V5PA 4A6KA 4K2PA 2K49A 5FI0A 3GYOA 3KRXA 5M4YB 4MK0A 2V76A 2NZ8B 2D2QA 3QWMA 3ZVRA 2COCA 5C79A 1KZGA 1Y5OA 2K8EA 2KCJA 1ZC3B 1DDMA 2YS5A 1UNRA 4DXAB 3SYXA 4NSWA 2HTHB 1ZYIA 5D3XA 2YS1A 2KR0A 3ODXA 2LULA 2Z14A 3WA0A 2I5CA 4KHOA 4Z2MB 2RGNB 3TCAA 1AWEA 3IVFA 4QJ5B 1DROA 2DLWA 3KRWA 3TVVA 2NBVA 3ML4A 3DXDA 1MI1A 2D9VA 2YT2A 5HE3A 2M38A 2OQBA 3ULCA 4A5KA 2Z59A 2AEHA 2UZRA 1KI1B 1W1HA 2DTCA 2LOZA 2Z13A 4P7IA 2D9XA 3ULBA 4HSIA 5DH9B 2W2WA 3HIEA 3P7ZA 3AU5A 3O96A 2RLOA 2OTXA 4KAXB 2IYBA 4HAXB 1W1GA 2D9WA 3QIJA 1H4RA 3NWFA 3U8ZA 1T77A 2D10A 2N23A 5D3WA 1MPHA 2HE7A 1XODA 3HQCA 1U5EA 2UVMA 4GMVA 4A6FB 1P5TA 5DIFB 4PNKA 2P0DA 3PVWA 4HAYB 4MT7A 5LG4B 3MDBC 1MKEA 3V5WA 2KGXB 4C0AA 4K2OA 4IFSA 5CLLB 2Y8FA 2J0JA 5C5BA 1GC7A 2P0FA 3B77A 2W2XD 1MAIA 1Y19B 1WI1A 2J59M 2J0MA 5JHHA 5JLJB 3SV1A 2AL6A 2P8VA 4KHBA 1MK7B 3PVUA 3SO6A 1LW3A 1RJ2A 4TYZA 4EKUA 4F7HA 1PLSA 1SHCA 3ODOA 4YONA 1V61A 1WJ1A 2EJ8A 4CHMA 5J3QA 1TJ6A 2D11A 1W1DA 2H7DA 1ZSQA 1U27A 3ODWA 1QC6A 1WJMA 1OY2A 2QKMA 1XR0B 2ELBA 2Z0PA 4B6HA 3VOQA 3A8PA 4Y94A 1FAOA 3HW2B 3D8FA 3VIAA 5LOPB 1XD4A 2K2JA 3KY9A 4HAZB 2DYNA 5C16A 1FB8A 1NU2A 2KIGA 3P6AA 3PZDA 4CSQA 2L1CA 3DCXA 3NSUA 4QJ4B 3NWAA 2Z0QA 4DX90 3A98B 3F5RA 5D3VA 2DX5A 1UNPA 1GC6A 4WVFB 1U5DA 4CYEA 1B55A 1MIZB 1OMWA 4HB4B 4WJ7A 1ZVRA 1EGXA 3PVLA 2D9YA 3UZTA 5C6RA 2BCJA 4YL8A 3PEGA 1FHOA 4DIXA 1NTYA 4F7UP 1PMSA 1TXDA 2N0YA 1X1GA 1E5WA 3RCPA 4EMOA 2ROZB 3A8QA 3G9WA 1U5FA 1BTKA 1UEFA 5IRSA 1GG3A 3PSCA 5HE0A 3AJ4A 2LKOA 3HSAA 3OHMB 1J19A 1EF1A 4HAVB 3F0WA 2RVBB 2CODA 1OQNA 4K81A 3SUZA 2R0DA 1ISNA 2RNRB 2DKQA 5HE2A 3TFMA 2LYDA 1PFJA 3SNHA 2IFSA 5DI9B 2DA0A 3BJIA 4MY6A 2Y8GA 1FHXA 2VRWB 2K2UA 3D8EA 5C5BB 2COFA 2YT0A 4F7GA 1DDWA 1WGQA 1I7AA 2GCJA 5EFXA 4XWXA 1NI2A 1QQGA 5LONB 2CAYA 1WGUA 1KZ7A 1X05A 1EVHA 1K5DB 1K5GB 2Q13A 1P3RA 5FI1A 1U2BA 1V89A 2D9ZA 3FVCA 3NWDA 4OT1A 2L2IA 4OSNA 2YRYA 4KVGB 2DN6A 2GCLA 2PZ1A 3DXEA 4GMXB 2Z4DA 4GOUA 4WSFA 1RRPB 3LJUX 5D3YA 1TQZA 4HDOA 1U5GA 2I1KA 2DX1A 2R2YA 1X1FA 2MDXA 5D27A 1UNQA 4IAPA 4Z2NA 5KCVA 4ZRKA 4EJNA 1ZC4B 1IRSA 1X11A 2EMSA 2LG1A 1M7EA 4GNKB 2E2XA 1V5MA 4K17A 5DHFB 2MKRA 2Z0OA 1BTNA 2ROVA 3BINA 4GN1A 2Y7BA 1DDVA 1XKEA 5J3YA 3NW8A 4H8SA 1BWNA 4IOYX 2GUMA 1BAKA 1FOEA 4PQ0A 1M7RA 1H10A 2YT1A 1N3HA 1FHWA 2P0HA 3A58A 2DHJA 2DHKA 2GS0A 2ELAA 2RSGA 3HK0A 1U29A 2DKPA 2MWNB 3WYFB 2XQNM 1SGHA 2MFQA 3CXBB 1EAZA 5KQ4A 4HATB 3DXCA 2W2XC 2CRFA 1UPRA 1LB1A 1V88A 2J0KA 2EMTA 2NMBA 3KSYA 2CY4A 4D6WA 1NTVA 2KUPA 2JP2A 2YSZA 5DHAB 1WG7A 2EC1A 5KQ1A 1DYNA 1I2HA 1Q67A 2G35A 1XCGA 4ZRIA 2LOXA 3D8DA 3U7DA 4HB3B 2I1JA 2DFKA 4BBKA 4HDQA 2H7EA 2UZSA 2KIEA 2YVCA 3TW1A 2D4QA 3CIKA 2K00A 5I2SA 1J0WA 2YS3A 4D0NB 4QXAB 3FSSA
chains in the Genus database with same CATH topology
4HB2B 1ZM0A 2ADZA 2YF0A 5GOWB 2QKLA 2X18A 4HHVA 4CHJA 2COAA 4GZUA 3N7CA 2GJYA 4DX8A 3FM8C 2VKIA 1FGZA 4KHAA 2ZPYA 2M14A 4A6HA 1Z87A 2VSZA 5HE1A 3PG7A 4NY0A 4KHBB 4A6FA 2DYQA 4ZRJA 5JP4A 3OANA 3TO1A 5L81A 3GYPA 1P6SA 3PP2A 3AU4A 3KZ1A 2FJLA 1V5UA 3QBVB 4HAUB 4TKNA 1XX0A 5CLQB 2RUKB 1WVHA 4L6EA 2R09A 1UPQA 2I5FA 3T06A 4HAWB 4DBBA 3X23A 1DBHA 3M1IB 1AQCA 2DHIA 3ZDTA 4HB0B 1X86A 4GPTB 3MPXA 1MK9B 2CY5A 5JHGA 3FEHA 1MIXA 5J3TA 1FGYA 4GXBA 1V5PA 4A6KA 4K2PA 5FI0A 3GYOA 3KRXA 4MK0A 2V76A 2NZ8B 2D2QA 3QWMA 3ZVRA 2COCA 5C79A 1KZGA 1Y5OA 2KCJA 1ZC3B 1DDMA 2YS5A 1UNRA 4DXAB 3SYXA 4NSWA 2HTHB 5D3XA 2YS1A 3ODXA 2LULA 3WA0A 2I5CA 4KHOA 4Z2MB 2RGNB 3TCAA 1AWEA 3IVFA 1DROA 2DLWA 3KRWA 3TVVA 3ML4A 3DXDA 2D9VA 5HE3A 2M38A 2OQBA 3ULCA 4A5KA 2AEHA 2UZRA 1KI1B 1W1HA 2DTCA 2LOZA 4P7IA 2D9XA 3ULBA 5DH9B 2W2WA 3P7ZA 3AU5A 3O96A 2RLOA 2OTXA 4KAXB 2IYBA 4HAXB 1W1GA 2D9WA 3QIJA 1H4RA 3U8ZA 2D10A 2N23A 5D3WA 1MPHA 2HE7A 1XODA 3HQCA 1U5EA 2UVMA 4GMVA 4A6FB 1P5TA 5DIFB 4PNKA 2P0DA 3PVWA 4HAYB 4MT7A 3MDBC 1MKEA 3V5WA 2KGXB 4C0AA 4K2OA 4IFSA 5CLLB 2Y8FA 2J0JA 5C5BA 1GC7A 2P0FA 2W2XD 1MAIA 1Y19B 1WI1A 2J59M 2J0MA 5JHHA 5JLJB 3SV1A 2AL6A 2P8VA 1MK7B 3PVUA 3SO6A 1LW3A 1RJ2A 4TYZA 4EKUA 4F7HA 1PLSA 1SHCA 3ODOA 4YONA 1V61A 1WJ1A 2EJ8A 4CHMA 5J3QA 1TJ6A 2D11A 1W1DA 2H7DA 1ZSQA 1U27A 3ODWA 1QC6A 1WJMA 1OY2A 2QKMA 1XR0B 2ELBA 2Z0PA 4B6HA 3VOQA 3A8PA 4Y94A 1FAOA 3HW2B 3D8FA 3VIAA 5LOPB 1XD4A 2K2JA 3KY9A 4HAZB 2DYNA 5C16A 1FB8A 1NU2A 3P6AA 3PZDA 2L1CA 3NSUA 2Z0QA 4DX90 3A98B 3F5RA 5D3VA 2DX5A 1UNPA 1GC6A 4WVFB 1U5DA 4CYEA 1B55A 1MIZB 1OMWA 4HB4B 4WJ7A 1ZVRA 1EGXA 3PVLA 2D9YA 3UZTA 5C6RA 2BCJA 4YL8A 3PEGA 1FHOA 1NTYA 4F7UP 1PMSA 1TXDA 2N0YA 1X1GA 1E5WA 3RCPA 4EMOA 2ROZB 3A8QA 3G9WA 1U5FA 1BTKA 1UEFA 1GG3A 3PSCA 5HE0A 3AJ4A 2LKOA 1J19A 1EF1A 4HAVB 3F0WA 2RVBB 2CODA 1OQNA 4K81A 3SUZA 2R0DA 1ISNA 2RNRB 2DKQA 5HE2A 3TFMA 2LYDA 1PFJA 3SNHA 2IFSA 5DI9B 2DA0A 3BJIA 4MY6A 2Y8GA 1FHXA 2VRWB 2K2UA 3D8EA 5C5BB 2COFA 2YT0A 4F7GA 1DDWA 1WGQA 1I7AA 2GCJA 5EFXA 4XWXA 1NI2A 1QQGA 5LONB 2CAYA 1WGUA 1KZ7A 1X05A 1EVHA 1K5DB 1K5GB 2Q13A 1P3RA 5FI1A 1U2BA 1V89A 2D9ZA 2L2IA 2YRYA 4KVGB 2DN6A 2GCLA 2PZ1A 3DXEA 4GMXB 4WSFA 1RRPB 3LJUX 5D3YA 1TQZA 4HDOA 1U5GA 2I1KA 2DX1A 1X1FA 2MDXA 5D27A 1UNQA 4IAPA 4Z2NA 5KCVA 4ZRKA 4EJNA 1ZC4B 1IRSA 1X11A 2EMSA 2LG1A 1M7EA 2E2XA 1V5MA 4K17A 5DHFB 2MKRA 2Z0OA 1BTNA 2ROVA 3BINA 4GN1A 2Y7BA 1DDVA 1XKEA 5J3YA 4H8SA 1BWNA 4IOYX 1BAKA 1FOEA 4PQ0A 1M7RA 1H10A 2YT1A 1N3HA 1FHWA 2P0HA 2DHJA 2DHKA 2GS0A 2ELAA 2RSGA 3HK0A 1U29A 2DKPA 2MWNB 3WYFB 2XQNM 1SGHA 2MFQA 3CXBB 1EAZA 5KQ4A 4HATB 3DXCA 2W2XC 2CRFA 1UPRA 1LB1A 1V88A 2J0KA 2EMTA 2NMBA 3KSYA 2CY4A 1NTVA 2KUPA 2JP2A 2YSZA 5DHAB 1WG7A 2EC1A 5KQ1A 1DYNA 1I2HA 1Q67A 2G35A 1XCGA 4ZRIA 2LOXA 3D8DA 3U7DA 4HB3B 2I1JA 2DFKA 4BBKA 4HDQA 2H7EA 2UZSA 2YVCA 3TW1A 2D4QA 3CIKA 2K00A 1J0WA 2YS3A 4D0NB 3FSSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HB2 B;  1ZM0 A;  2ADZ A;  2YF0 A;  5GOW B;  2QKL A;  2X18 A;  4HHV A;  4CHJ A;  2COA A;  4GZU A;  3N7C A;  2GJY A;  4DX8 A;  3FM8 C;  2VKI A;  1FGZ A;  4KHA A;  2ZPY A;  2M14 A;  4A6H A;  1Z87 A;  2VSZ A;  5HE1 A;  3PG7 A;  4NY0 A;  4KHB B;  4A6F A;  2DYQ A;  4ZRJ A;  5JP4 A;  3OAN A;  3TO1 A;  5L81 A;  3GYP A;  1P6S A;  3PP2 A;  3AU4 A;  3KZ1 A;  2FJL A;  1V5U A;  3QBV B;  4HAU B;  4TKN A;  1XX0 A;  5CLQ B;  2RUK B;  1WVH A;  4L6E A;  2R09 A;  1UPQ A;  2I5F A;  3T06 A;  4HAW B;  4DBB A;  3X23 A;  1DBH A;  3M1I B;  1AQC A;  2DHI A;  3ZDT A;  4HB0 B;  1X86 A;  4GPT B;  3MPX A;  1MK9 B;  2CY5 A;  5JHG A;  3FEH A;  1MIX A;  5J3T A;  1FGY A;  4GXB A;  1V5P A;  4A6K A;  4K2P A;  5FI0 A;  3GYO A;  3KRX A;  4MK0 A;  2V76 A;  2NZ8 B;  2D2Q A;  3QWM A;  3ZVR A;  2COC A;  5C79 A;  1KZG A;  1Y5O A;  2KCJ A;  1ZC3 B;  1DDM A;  2YS5 A;  1UNR A;  4DXA B;  3SYX A;  4NSW A;  2HTH B;  5D3X A;  2YS1 A;  3ODX A;  2LUL A;  3WA0 A;  2I5C A;  4KHO A;  4Z2M B;  2RGN B;  3TCA A;  1AWE A;  3IVF A;  1DRO A;  2DLW A;  3KRW A;  3TVV A;  3ML4 A;  3DXD A;  2D9V A;  5HE3 A;  2M38 A;  2OQB A;  3ULC A;  4A5K A;  2AEH A;  2UZR A;  1KI1 B;  1W1H A;  2DTC A;  2LOZ A;  4P7I A;  2D9X A;  3ULB A;  5DH9 B;  2W2W A;  3P7Z A;  3AU5 A;  3O96 A;  2RLO A;  2OTX A;  4KAX B;  2IYB A;  4HAX B;  1W1G A;  2D9W A;  3QIJ A;  1H4R A;  3U8Z A;  2D10 A;  2N23 A;  5D3W A;  1MPH A;  2HE7 A;  1XOD A;  3HQC A;  1U5E A;  2UVM A;  4GMV A;  4A6F B;  1P5T A;  5DIF B;  4PNK A;  2P0D A;  3PVW A;  4HAY B;  4MT7 A;  3MDB C;  1MKE A;  3V5W A;  2KGX B;  4C0A A;  4K2O A;  4IFS A;  5CLL B;  2Y8F A;  2J0J A;  5C5B A;  1GC7 A;  2P0F A;  2W2X D;  1MAI A;  1Y19 B;  1WI1 A;  2J59 M;  2J0M A;  5JHH A;  5JLJ B;  3SV1 A;  2AL6 A;  2P8V A;  1MK7 B;  3PVU A;  3SO6 A;  1LW3 A;  1RJ2 A;  4TYZ A;  4EKU A;  4F7H A;  1PLS A;  1SHC A;  3ODO A;  4YON A;  1V61 A;  1WJ1 A;  2EJ8 A;  4CHM A;  5J3Q A;  1TJ6 A;  2D11 A;  1W1D A;  2H7D A;  1ZSQ A;  1U27 A;  3ODW A;  1QC6 A;  1WJM A;  1OY2 A;  2QKM A;  1XR0 B;  2ELB A;  2Z0P A;  4B6H A;  3VOQ A;  3A8P A;  4Y94 A;  1FAO A;  3HW2 B;  3D8F A;  3VIA A;  5LOP B;  1XD4 A;  2K2J A;  3KY9 A;  4HAZ B;  2DYN A;  5C16 A;  1FB8 A;  1NU2 A;  3P6A A;  3PZD A;  2L1C A;  3NSU A;  2Z0Q A;  4DX9 0;  3A98 B;  3F5R A;  5D3V A;  2DX5 A;  1UNP A;  1GC6 A;  4WVF B;  1U5D A;  4CYE A;  1B55 A;  1MIZ B;  1OMW A;  4HB4 B;  4WJ7 A;  1ZVR A;  1EGX A;  3PVL A;  2D9Y A;  3UZT A;  5C6R A;  2BCJ A;  4YL8 A;  3PEG A;  1FHO A;  1NTY A;  4F7U P;  1PMS A;  1TXD A;  2N0Y A;  1X1G A;  1E5W A;  3RCP A;  4EMO A;  2ROZ B;  3A8Q A;  3G9W A;  1U5F A;  1BTK A;  1UEF A;  1GG3 A;  3PSC A;  5HE0 A;  3AJ4 A;  2LKO A;  1J19 A;  1EF1 A;  4HAV B;  3F0W A;  2RVB B;  2COD A;  1OQN A;  4K81 A;  3SUZ A;  2R0D A;  1ISN A;  2RNR B;  2DKQ A;  5HE2 A;  3TFM A;  2LYD A;  1PFJ A;  3SNH A;  2IFS A;  5DI9 B;  2DA0 A;  3BJI A;  4MY6 A;  2Y8G A;  1FHX A;  2VRW B;  2K2U A;  3D8E A;  5C5B B;  2COF A;  2YT0 A;  4F7G A;  1DDW A;  1WGQ A;  1I7A A;  2GCJ A;  5EFX A;  4XWX A;  1NI2 A;  1QQG A;  5LON B;  2CAY A;  1WGU A;  1KZ7 A;  1X05 A;  1EVH A;  1K5D B;  1K5G B;  2Q13 A;  1P3R A;  5FI1 A;  1U2B A;  1V89 A;  2D9Z A;  2L2I A;  2YRY A;  4KVG B;  2DN6 A;  2GCL A;  2PZ1 A;  3DXE A;  4GMX B;  4WSF A;  1RRP B;  3LJU X;  5D3Y A;  1TQZ A;  4HDO A;  1U5G A;  2I1K A;  2DX1 A;  1X1F A;  2MDX A;  5D27 A;  1UNQ A;  4IAP A;  4Z2N A;  5KCV A;  4ZRK A;  4EJN A;  1ZC4 B;  1IRS A;  1X11 A;  2EMS A;  2LG1 A;  1M7E A;  2E2X A;  1V5M A;  4K17 A;  5DHF B;  2MKR A;  2Z0O A;  1BTN A;  2ROV A;  3BIN A;  4GN1 A;  2Y7B A;  1DDV A;  1XKE A;  5J3Y A;  4H8S A;  1BWN A;  4IOY X;  1BAK A;  1FOE A;  4PQ0 A;  1M7R A;  1H10 A;  2YT1 A;  1N3H A;  1FHW A;  2P0H A;  2DHJ A;  2DHK A;  2GS0 A;  2ELA A;  2RSG A;  3HK0 A;  1U29 A;  2DKP A;  2MWN B;  3WYF B;  2XQN M;  1SGH A;  2MFQ A;  3CXB B;  1EAZ A;  5KQ4 A;  4HAT B;  3DXC A;  2W2X C;  2CRF A;  1UPR A;  1LB1 A;  1V88 A;  2J0K A;  2EMT A;  2NMB A;  3KSY A;  2CY4 A;  1NTV A;  2KUP A;  2JP2 A;  2YSZ A;  5DHA B;  1WG7 A;  2EC1 A;  5KQ1 A;  1DYN A;  1I2H A;  1Q67 A;  2G35 A;  1XCG A;  4ZRI A;  2LOX A;  3D8D A;  3U7D A;  4HB3 B;  2I1J A;  2DFK A;  4BBK A;  4HDQ A;  2H7E A;  2UZS A;  2YVC A;  3TW1 A;  2D4Q A;  3CIK A;  2K00 A;  1J0W A;  2YS3 A;  4D0N B;  3FSS A; 
#chains in the Genus database with same CATH topology
 4HB2 B;  1ZM0 A;  2ADZ A;  2YF0 A;  5GOW B;  2ZKM X;  2QKL A;  2X18 A;  4HHV A;  4CHJ A;  2COA A;  4GZU A;  3N7C A;  2GJY A;  4DX8 A;  3FM8 C;  2VKI A;  2KUQ A;  1FGZ A;  4KHA A;  2ZPY A;  2M14 A;  4A6H A;  1Z87 A;  2VSZ A;  4L1R A;  5HE1 A;  3PG7 A;  4NY0 A;  4KHB B;  4A6F A;  2DYQ A;  4ZRJ A;  5JP4 A;  3OAN A;  3TO1 A;  5L81 A;  3GYP A;  1P6S A;  3PP2 A;  3AU4 A;  3KZ1 A;  5I2M A;  2FJL A;  1V5U A;  3QBV B;  4HAU B;  4TKN A;  1XX0 A;  5CLQ B;  2RUK B;  1WVH A;  4L6E A;  2R09 A;  1UPQ A;  2I5F A;  3T06 A;  4HAW B;  4DBB A;  3X23 A;  1DBH A;  3M1I B;  1AQC A;  2DHI A;  3ZDT A;  4HB0 B;  1X86 A;  4GPT B;  2FJU B;  3MPX A;  1MK9 B;  2CY5 A;  5JHG A;  3U12 A;  3FEH A;  1MIX A;  5J3T A;  2RRF A;  1FGY A;  4QJ3 B;  4GXB A;  1V5P A;  4A6K A;  4K2P A;  2K49 A;  5FI0 A;  3GYO A;  3KRX A;  5M4Y B;  4MK0 A;  2V76 A;  2NZ8 B;  2D2Q A;  3QWM A;  3ZVR A;  2COC A;  5C79 A;  1KZG A;  1Y5O A;  2K8E A;  2KCJ A;  1ZC3 B;  1DDM A;  2YS5 A;  1UNR A;  4DXA B;  3SYX A;  4NSW A;  2HTH B;  1ZYI A;  5D3X A;  2YS1 A;  2KR0 A;  3ODX A;  2LUL A;  2Z14 A;  3WA0 A;  2I5C A;  4KHO A;  4Z2M B;  2RGN B;  3TCA A;  1AWE A;  3IVF A;  4QJ5 B;  1DRO A;  2DLW A;  3KRW A;  3TVV A;  2NBV A;  3ML4 A;  3DXD A;  1MI1 A;  2D9V A;  2YT2 A;  5HE3 A;  2M38 A;  2OQB A;  3ULC A;  4A5K A;  2Z59 A;  2AEH A;  2UZR A;  1KI1 B;  1W1H A;  2DTC A;  2LOZ A;  2Z13 A;  4P7I A;  2D9X A;  3ULB A;  4HSI A;  5DH9 B;  2W2W A;  3HIE A;  3P7Z A;  3AU5 A;  3O96 A;  2RLO A;  2OTX A;  4KAX B;  2IYB A;  4HAX B;  1W1G A;  2D9W A;  3QIJ A;  1H4R A;  3NWF A;  3U8Z A;  1T77 A;  2D10 A;  2N23 A;  5D3W A;  1MPH A;  2HE7 A;  1XOD A;  3HQC A;  1U5E A;  2UVM A;  4GMV A;  4A6F B;  1P5T A;  5DIF B;  4PNK A;  2P0D A;  3PVW A;  4HAY B;  4MT7 A;  5LG4 B;  3MDB C;  1MKE A;  3V5W A;  2KGX B;  4C0A A;  4K2O A;  4IFS A;  5CLL B;  2Y8F A;  2J0J A;  5C5B A;  1GC7 A;  2P0F A;  3B77 A;  2W2X D;  1MAI A;  1Y19 B;  1WI1 A;  2J59 M;  2J0M A;  5JHH A;  5JLJ B;  3SV1 A;  2AL6 A;  2P8V A;  4KHB A;  1MK7 B;  3PVU A;  3SO6 A;  1LW3 A;  1RJ2 A;  4TYZ A;  4EKU A;  4F7H A;  1PLS A;  1SHC A;  3ODO A;  4YON A;  1V61 A;  1WJ1 A;  2EJ8 A;  4CHM A;  5J3Q A;  1TJ6 A;  2D11 A;  1W1D A;  2H7D A;  1ZSQ A;  1U27 A;  3ODW A;  1QC6 A;  1WJM A;  1OY2 A;  2QKM A;  1XR0 B;  2ELB A;  2Z0P A;  4B6H A;  3VOQ A;  3A8P A;  4Y94 A;  1FAO A;  3HW2 B;  3D8F A;  3VIA A;  5LOP B;  1XD4 A;  2K2J A;  3KY9 A;  4HAZ B;  2DYN A;  5C16 A;  1FB8 A;  1NU2 A;  2KIG A;  3P6A A;  3PZD A;  4CSQ A;  2L1C A;  3DCX A;  3NSU A;  4QJ4 B;  3NWA A;  2Z0Q A;  4DX9 0;  3A98 B;  3F5R A;  5D3V A;  2DX5 A;  1UNP A;  1GC6 A;  4WVF B;  1U5D A;  4CYE A;  1B55 A;  1MIZ B;  1OMW A;  4HB4 B;  4WJ7 A;  1ZVR A;  1EGX A;  3PVL A;  2D9Y A;  3UZT A;  5C6R A;  2BCJ A;  4YL8 A;  3PEG A;  1FHO A;  4DIX A;  1NTY A;  4F7U P;  1PMS A;  1TXD A;  2N0Y A;  1X1G A;  1E5W A;  3RCP A;  4EMO A;  2ROZ B;  3A8Q A;  3G9W A;  1U5F A;  1BTK A;  1UEF A;  5IRS A;  1GG3 A;  3PSC A;  5HE0 A;  3AJ4 A;  2LKO A;  3HSA A;  3OHM B;  1J19 A;  1EF1 A;  4HAV B;  3F0W A;  2RVB B;  2COD A;  1OQN A;  4K81 A;  3SUZ A;  2R0D A;  1ISN A;  2RNR B;  2DKQ A;  5HE2 A;  3TFM A;  2LYD A;  1PFJ A;  3SNH A;  2IFS A;  5DI9 B;  2DA0 A;  3BJI A;  4MY6 A;  2Y8G A;  1FHX A;  2VRW B;  2K2U A;  3D8E A;  5C5B B;  2COF A;  2YT0 A;  4F7G A;  1DDW A;  1WGQ A;  1I7A A;  2GCJ A;  5EFX A;  4XWX A;  1NI2 A;  1QQG A;  5LON B;  2CAY A;  1WGU A;  1KZ7 A;  1X05 A;  1EVH A;  1K5D B;  1K5G B;  2Q13 A;  1P3R A;  5FI1 A;  1U2B A;  1V89 A;  2D9Z A;  3FVC A;  3NWD A;  4OT1 A;  2L2I A;  4OSN A;  2YRY A;  4KVG B;  2DN6 A;  2GCL A;  2PZ1 A;  3DXE A;  4GMX B;  2Z4D A;  4GOU A;  4WSF A;  1RRP B;  3LJU X;  5D3Y A;  1TQZ A;  4HDO A;  1U5G A;  2I1K A;  2DX1 A;  2R2Y A;  1X1F A;  2MDX A;  5D27 A;  1UNQ A;  4IAP A;  4Z2N A;  5KCV A;  4ZRK A;  4EJN A;  1ZC4 B;  1IRS A;  1X11 A;  2EMS A;  2LG1 A;  1M7E A;  4GNK B;  2E2X A;  1V5M A;  4K17 A;  5DHF B;  2MKR A;  2Z0O A;  1BTN A;  2ROV A;  3BIN A;  4GN1 A;  2Y7B A;  1DDV A;  1XKE A;  5J3Y A;  3NW8 A;  4H8S A;  1BWN A;  4IOY X;  2GUM A;  1BAK A;  1FOE A;  4PQ0 A;  1M7R A;  1H10 A;  2YT1 A;  1N3H A;  1FHW A;  2P0H A;  3A58 A;  2DHJ A;  2DHK A;  2GS0 A;  2ELA A;  2RSG A;  3HK0 A;  1U29 A;  2DKP A;  2MWN B;  3WYF B;  2XQN M;  1SGH A;  2MFQ A;  3CXB B;  1EAZ A;  5KQ4 A;  4HAT B;  3DXC A;  2W2X C;  2CRF A;  1UPR A;  1LB1 A;  1V88 A;  2J0K A;  2EMT A;  2NMB A;  3KSY A;  2CY4 A;  4D6W A;  1NTV A;  2KUP A;  2JP2 A;  2YSZ A;  5DHA B;  1WG7 A;  2EC1 A;  5KQ1 A;  1DYN A;  1I2H A;  1Q67 A;  2G35 A;  1XCG A;  4ZRI A;  2LOX A;  3D8D A;  3U7D A;  4HB3 B;  2I1J A;  2DFK A;  4BBK A;  4HDQ A;  2H7E A;  2UZS A;  2KIE A;  2YVC A;  3TW1 A;  2D4Q A;  3CIK A;  2K00 A;  5I2S A;  1J0W A;  2YS3 A;  4D0N B;  4QXA B;  3FSS A; 
#chains in the Genus database with same CATH homology
 4HB2 B;  1ZM0 A;  2ADZ A;  2YF0 A;  5GOW B;  2QKL A;  2X18 A;  4HHV A;  4CHJ A;  2COA A;  4GZU A;  3N7C A;  2GJY A;  4DX8 A;  3FM8 C;  2VKI A;  1FGZ A;  4KHA A;  2ZPY A;  2M14 A;  4A6H A;  1Z87 A;  2VSZ A;  5HE1 A;  3PG7 A;  4NY0 A;  4KHB B;  4A6F A;  2DYQ A;  4ZRJ A;  5JP4 A;  3OAN A;  3TO1 A;  5L81 A;  3GYP A;  1P6S A;  3PP2 A;  3AU4 A;  3KZ1 A;  2FJL A;  1V5U A;  3QBV B;  4HAU B;  4TKN A;  1XX0 A;  5CLQ B;  2RUK B;  1WVH A;  4L6E A;  2R09 A;  1UPQ A;  2I5F A;  3T06 A;  4HAW B;  4DBB A;  3X23 A;  1DBH A;  3M1I B;  1AQC A;  2DHI A;  3ZDT A;  4HB0 B;  1X86 A;  4GPT B;  3MPX A;  1MK9 B;  2CY5 A;  5JHG A;  3FEH A;  1MIX A;  5J3T A;  1FGY A;  4GXB A;  1V5P A;  4A6K A;  4K2P A;  5FI0 A;  3GYO A;  3KRX A;  4MK0 A;  2V76 A;  2NZ8 B;  2D2Q A;  3QWM A;  3ZVR A;  2COC A;  5C79 A;  1KZG A;  1Y5O A;  2KCJ A;  1ZC3 B;  1DDM A;  2YS5 A;  1UNR A;  4DXA B;  3SYX A;  4NSW A;  2HTH B;  5D3X A;  2YS1 A;  3ODX A;  2LUL A;  3WA0 A;  2I5C A;  4KHO A;  4Z2M B;  2RGN B;  3TCA A;  1AWE A;  3IVF A;  1DRO A;  2DLW A;  3KRW A;  3TVV A;  3ML4 A;  3DXD A;  2D9V A;  5HE3 A;  2M38 A;  2OQB A;  3ULC A;  4A5K A;  2AEH A;  2UZR A;  1KI1 B;  1W1H A;  2DTC A;  2LOZ A;  4P7I A;  2D9X A;  3ULB A;  5DH9 B;  2W2W A;  3P7Z A;  3AU5 A;  3O96 A;  2RLO A;  2OTX A;  4KAX B;  2IYB A;  4HAX B;  1W1G A;  2D9W A;  3QIJ A;  1H4R A;  3U8Z A;  2D10 A;  2N23 A;  5D3W A;  1MPH A;  2HE7 A;  1XOD A;  3HQC A;  1U5E A;  2UVM A;  4GMV A;  4A6F B;  1P5T A;  5DIF B;  4PNK A;  2P0D A;  3PVW A;  4HAY B;  4MT7 A;  3MDB C;  1MKE A;  3V5W A;  2KGX B;  4C0A A;  4K2O A;  4IFS A;  5CLL B;  2Y8F A;  2J0J A;  5C5B A;  1GC7 A;  2P0F A;  2W2X D;  1MAI A;  1Y19 B;  1WI1 A;  2J59 M;  2J0M A;  5JHH A;  5JLJ B;  3SV1 A;  2AL6 A;  2P8V A;  1MK7 B;  3PVU A;  3SO6 A;  1LW3 A;  1RJ2 A;  4TYZ A;  4EKU A;  4F7H A;  1PLS A;  1SHC A;  3ODO A;  4YON A;  1V61 A;  1WJ1 A;  2EJ8 A;  4CHM A;  5J3Q A;  1TJ6 A;  2D11 A;  1W1D A;  2H7D A;  1ZSQ A;  1U27 A;  3ODW A;  1QC6 A;  1WJM A;  1OY2 A;  2QKM A;  1XR0 B;  2ELB A;  2Z0P A;  4B6H A;  3VOQ A;  3A8P A;  4Y94 A;  1FAO A;  3HW2 B;  3D8F A;  3VIA A;  5LOP B;  1XD4 A;  2K2J A;  3KY9 A;  4HAZ B;  2DYN A;  5C16 A;  1FB8 A;  1NU2 A;  3P6A A;  3PZD A;  2L1C A;  3NSU A;  2Z0Q A;  4DX9 0;  3A98 B;  3F5R A;  5D3V A;  2DX5 A;  1UNP A;  1GC6 A;  4WVF B;  1U5D A;  4CYE A;  1B55 A;  1MIZ B;  1OMW A;  4HB4 B;  4WJ7 A;  1ZVR A;  1EGX A;  3PVL A;  2D9Y A;  3UZT A;  5C6R A;  2BCJ A;  4YL8 A;  3PEG A;  1FHO A;  1NTY A;  4F7U P;  1PMS A;  1TXD A;  2N0Y A;  1X1G A;  1E5W A;  3RCP A;  4EMO A;  2ROZ B;  3A8Q A;  3G9W A;  1U5F A;  1BTK A;  1UEF A;  1GG3 A;  3PSC A;  5HE0 A;  3AJ4 A;  2LKO A;  1J19 A;  1EF1 A;  4HAV B;  3F0W A;  2RVB B;  2COD A;  1OQN A;  4K81 A;  3SUZ A;  2R0D A;  1ISN A;  2RNR B;  2DKQ A;  5HE2 A;  3TFM A;  2LYD A;  1PFJ A;  3SNH A;  2IFS A;  5DI9 B;  2DA0 A;  3BJI A;  4MY6 A;  2Y8G A;  1FHX A;  2VRW B;  2K2U A;  3D8E A;  5C5B B;  2COF A;  2YT0 A;  4F7G A;  1DDW A;  1WGQ A;  1I7A A;  2GCJ A;  5EFX A;  4XWX A;  1NI2 A;  1QQG A;  5LON B;  2CAY A;  1WGU A;  1KZ7 A;  1X05 A;  1EVH A;  1K5D B;  1K5G B;  2Q13 A;  1P3R A;  5FI1 A;  1U2B A;  1V89 A;  2D9Z A;  2L2I A;  2YRY A;  4KVG B;  2DN6 A;  2GCL A;  2PZ1 A;  3DXE A;  4GMX B;  4WSF A;  1RRP B;  3LJU X;  5D3Y A;  1TQZ A;  4HDO A;  1U5G A;  2I1K A;  2DX1 A;  1X1F A;  2MDX A;  5D27 A;  1UNQ A;  4IAP A;  4Z2N A;  5KCV A;  4ZRK A;  4EJN A;  1ZC4 B;  1IRS A;  1X11 A;  2EMS A;  2LG1 A;  1M7E A;  2E2X A;  1V5M A;  4K17 A;  5DHF B;  2MKR A;  2Z0O A;  1BTN A;  2ROV A;  3BIN A;  4GN1 A;  2Y7B A;  1DDV A;  1XKE A;  5J3Y A;  4H8S A;  1BWN A;  4IOY X;  1BAK A;  1FOE A;  4PQ0 A;  1M7R A;  1H10 A;  2YT1 A;  1N3H A;  1FHW A;  2P0H A;  2DHJ A;  2DHK A;  2GS0 A;  2ELA A;  2RSG A;  3HK0 A;  1U29 A;  2DKP A;  2MWN B;  3WYF B;  2XQN M;  1SGH A;  2MFQ A;  3CXB B;  1EAZ A;  5KQ4 A;  4HAT B;  3DXC A;  2W2X C;  2CRF A;  1UPR A;  1LB1 A;  1V88 A;  2J0K A;  2EMT A;  2NMB A;  3KSY A;  2CY4 A;  1NTV A;  2KUP A;  2JP2 A;  2YSZ A;  5DHA B;  1WG7 A;  2EC1 A;  5KQ1 A;  1DYN A;  1I2H A;  1Q67 A;  2G35 A;  1XCG A;  4ZRI A;  2LOX A;  3D8D A;  3U7D A;  4HB3 B;  2I1J A;  2DFK A;  4BBK A;  4HDQ A;  2H7E A;  2UZS A;  2YVC A;  3TW1 A;  2D4Q A;  3CIK A;  2K00 A;  1J0W A;  2YS3 A;  4D0N B;  3FSS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...