2P0DA

Arhgap9 ph domain in complex with ins(1,4,5)p3
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
121
structure length
107
Chain Sequence
SHEVEKSGLLNMTKIAQGGRKLRKNWGPSWVVLTGNSLVFYREPRPESSVDLRGAALAHGRHLSSRRNVLHIRTIPGHEFLLQSDHETELRAWHRALRTVIERLVRW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Non-canonical Interaction of Phosphoinositides with Pleckstrin Homology Domains of Tiam1 and ArhGAP9.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligand binding protein
molecule keywords Rho GTPase-activating protein 9
total genus 26
structure length 107
sequence length 121
ec nomenclature
pdb deposition date 2007-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2p0dA00
2ZPYA 4MY6A 5LOPB 4DX8A 1MKEA 4YONA 1UNPA 2CAYA 4PNKA 4HB4B 2MKRA 2Z0OA 3G9WA 3KZ1A 2CY5A 3MDBC 1FGYA 3DXCA 2L2IA 4HAZB 1DBHA 4EJNA 4Y94A 4B6HA 1Y19B 4F7UP 3KY9A 1U5DA 1NTYA 2COAA 2DKQA 2D11A 1M7RA 1TXDA 3FSSA 3U7DA 3OANA 2ROVA 3WA0A 1MIXA 1WVHA 2Y8GA 2EMSA 2I1KA 1ZC3B 3A8QA 2RLOA 1WG7A 2N0YA 3QBVB 5FI1A 3PSCA 3KSYA 4NY0A 3PVWA 1EVHA 3CIKA 4KHBB 1X11A 3DXDA 2LOXA 2HE7A 2YT0A 2CRFA 2EMTA 4GN1A 4A6HA 1V89A 2YF0A 2LKOA 2ELBA 2DHJA 2YVCA 2DKPA 5C79A 2HTHB 4GXBA 1XKEA 3V5WA 4IAPA 1P5TA 2KUPA 1BTNA 3BINA 5D3XA 3PP2A 1TQZA 4KHOA 3GYPA 2RUKB 3CXBB 4CHMA 1FHWA 2PZ1A 4HAWB 4GMVA 1K5GB 1XCGA 1FHXA 2XQNM 3QIJA 3ZDTA 2D9ZA 1BTKA 1WJ1A 2RVBB 3A98B 2M38A 1P6SA 2IFSA 1GC6A 3GYOA 3PEGA 2W2XD 4HATB 4NSWA 4P7IA 2DX1A 5CLQB 2V76A 2Z0PA 4DXAB 2CY4A 2GS0A 3ODXA 3P7ZA 5D27A 2K00A 3PVLA 2JP2A 2UVMA 4D0NB 2Q13A 3MPXA 4K2PA 5J3QA 2D9YA 2DHIA 3FM8C 4A6KA 2DHKA 1ZSQA 3ULBA 2J0KA 1FGZA 4ZRIA 4TKNA 2Y7BA 1FB8A 4F7GA 1N3HA 2Y8FA 2D9VA 1X1FA 2J0JA 1XD4A 5HE3A 4Z2MB 1U27A 4BBKA 2Z0QA 1WGQA 1U5GA 1UNRA 1EF1A 3X23A 1DYNA 4EKUA 2J59M 1TJ6A 4CHJA 1NI2A 3TO1A 2YRYA 4TYZA 4DX90 5C6RA 2IYBA 3WYFB 2KGXB 5KQ4A 2NMBA 3KRXA 2YS3A 3VIAA 4GZUA 1W1GA 1Y5OA 1ZVRA 5C16A 2J0MA 1NTVA 2R09A 1FAOA 2D4QA 1QQGA 3FEHA 2E2XA 2EC1A 1U5FA 3SYXA 2COCA 4MT7A 4KHAA 5DHAB 2G35A 3LJUX 2GCJA 2VSZA 4GMXB 4HAYB 2YT1A 4KAXB 3QWMA 1W1DA 1P3RA 1X1GA 2KCJA 3TVVA 4WSFA 4L6EA 2K2UA 3SNHA 2I1JA 5JP4A 1AQCA 1LB1A 1WI1A 1V5PA 1KZGA 1M7EA 2LG1A 2ADZA 2H7DA 3PVUA 2R0DA 4MK0A 3TCAA 5DI9B 4HDOA 1U29A 2DYQA 4WVFB 5HE2A 2FJLA 2YSZA 1LW3A 1WGUA 2N23A 2RNRB 1BWNA 1U5EA 2D2QA 3KRWA 2X18A 1EGXA 2D9XA 3RCPA 1FOEA 2RGNB 1AWEA 1ZM0A 1U2BA 2P8VA 3IVFA 4EMOA 5JHGA 3BJIA 1X86A 5JLJB 4A5KA 1I2HA 1EAZA 4HAUB 4YL8A 4XWXA 5DHFB 5GOWB 3ML4A 1BAKA 2YS1A 2W2WA 2YS5A 2ROZB 3U8ZA 3SUZA 5KQ1A 4HAVB 1DDWA 5J3YA 1UNQA 2DYNA 1NU2A 3P6AA 1MK7B 1PFJA 2VKIA 1XX0A 1K5DB 1J19A 2CODA 5KCVA 4HB3B 3SV1A 3HQCA 4DBBA 3N7CA 1DDVA 1KZ7A 1WJMA 2L1CA 2P0FA 1UPRA 2GCLA 1OQNA 2DFKA 2RSGA 1W1HA 3PG7A 2W2XC 5HE0A 1SGHA 1GC7A 3F0WA 5FI0A 1V5UA 5D3YA 5LONB 1Z87A 3A8PA 4F7HA 1UEFA 1H10A 3PZDA 2ELAA 1RRPB 3ODOA 2VRWB 1MAIA 4ZRKA 1X05A 4HB0B 3D8EA 4HB2B 3D8FA 2D9WA 5D3WA 1DDMA 5EFXA 2OQBA 2DN6A 1V88A 5L81A 2D10A 4KVGB 2COFA 3ULCA 2AEHA 3F5RA 2UZRA 4ZRJA 4K2OA 4A6FA 2AL6A 3ODWA 3UZTA 1ISNA 1OY2A 1MK9B 2LULA 3HW2B 4HDQA 1J0WA 4WJ7A 2UZSA 5DH9B 3NSUA 2EJ8A 2DTCA 4IOYX 3ZVRA 1KI1B 1RJ2A 3AU5A 3D8DA 1PLSA 3O96A 2H7EA 3HK0A 5JHHA 2NZ8B 1ZC4B 4Z2NA 3VOQA 1XODA 4HHVA 4GPTB 3T06A 4H8SA 5C5BB 3AJ4A 2MDXA 4HAXB 4C0AA 2QKMA 1SHCA 1V5MA 1XR0B 1E5WA 1MIZB 2MFQA 4K81A 3TW1A 2I5FA 2M14A 1OMWA 2QKLA 2I5CA 1B55A 1UPQA 5HE1A 5CLLB 2P0DA 2LOZA 3M1IB 2K2JA 5C5BA 2DLWA 2LYDA 1GG3A 2OTXA 4PQ0A 1V61A 1MPHA 2P0HA 5D3VA 4CYEA 5DIFB 1H4RA 1I7AA 3AU4A 4IFSA 4A6FB 3TFMA 2DA0A 1QC6A 3DXEA 1Q67A 2MWNB 1PMSA 1DROA 2BCJA 5J3TA 2DX5A 4K17A 2GJYA 1FHOA 1IRSA 3SO6A
chains in the Genus database with same CATH superfamily
2ZPYA 4MY6A 5LOPB 4DX8A 1MKEA 4YONA 1UNPA 2CAYA 4PNKA 4HB4B 2MKRA 2Z0OA 3G9WA 3KZ1A 2CY5A 3MDBC 1FGYA 3DXCA 2L2IA 4HAZB 1DBHA 4EJNA 4Y94A 4B6HA 1Y19B 4F7UP 3KY9A 1U5DA 4KHBA 1NTYA 2COAA 2DKQA 2D11A 1M7RA 1TXDA 3FSSA 3U7DA 3OANA 2ROVA 3WA0A 1MIXA 1WVHA 2Y8GA 2EMSA 2I1KA 1ZC3B 4QJ4B 3A8QA 2KUQA 2RLOA 1WG7A 5I2SA 2N0YA 3QBVB 5FI1A 3PSCA 3KSYA 4NY0A 3PVWA 1EVHA 3CIKA 4KHBB 1X11A 3DXDA 2LOXA 2HE7A 2YT0A 2CRFA 2EMTA 2Z59A 4GN1A 4A6HA 1V89A 3HIEA 2YF0A 2LKOA 2ELBA 2DHJA 2YVCA 2DKPA 4QXAB 5C79A 2Z13A 2HTHB 2ZKMX 4GXBA 1XKEA 3V5WA 4IAPA 5LG4B 1P5TA 2KUPA 1BTNA 3BINA 5D3XA 3PP2A 1TQZA 4KHOA 3GYPA 2RUKB 3CXBB 4CHMA 1FHWA 2PZ1A 4HAWB 5I2MA 4GMVA 2NBVA 1K5GB 1XCGA 1FHXA 2XQNM 3QIJA 3ZDTA 2D9ZA 1BTKA 1WJ1A 2RVBB 1MI1A 3A98B 2M38A 1P6SA 2IFSA 1GC6A 3GYOA 3PEGA 2W2XD 4HATB 4NSWA 4P7IA 2DX1A 5CLQB 2V76A 2Z0PA 4DXAB 2CY4A 2GS0A 3ODXA 3P7ZA 5D27A 2K00A 4QJ5B 3NWDA 3PVLA 2JP2A 2UVMA 4D0NB 2K49A 3NWAA 2Q13A 3MPXA 4K2PA 3FVCA 5J3QA 2D9YA 2DHIA 3FM8C 4A6KA 2DHKA 1ZSQA 3ULBA 2K8EA 3OHMB 2J0KA 1FGZA 4ZRIA 4TKNA 2Y7BA 1FB8A 4F7GA 1N3HA 2Y8FA 2D9VA 1X1FA 2J0JA 1XD4A 5HE3A 4Z2MB 1U27A 4BBKA 2Z0QA 1WGQA 1U5GA 1UNRA 2R2YA 1EF1A 3X23A 1DYNA 4HSIA 4EKUA 2RRFA 2J59M 1TJ6A 4CHJA 1NI2A 3TO1A 2YRYA 4TYZA 4DX90 5C6RA 2IYBA 3WYFB 2KGXB 5KQ4A 2NMBA 3KRXA 2YS3A 3VIAA 4GZUA 1W1GA 1Y5OA 1ZVRA 5C16A 2J0MA 1NTVA 2R09A 2Z14A 1FAOA 2D4QA 1QQGA 3FEHA 2E2XA 2EC1A 1U5FA 3SYXA 2COCA 4MT7A 4KHAA 5DHAB 2G35A 3LJUX 2GCJA 2VSZA 4GMXB 4HAYB 2YT1A 4KAXB 3QWMA 1W1DA 4OSNA 1P3RA 1X1GA 2KCJA 3TVVA 4WSFA 4L1RA 4OT1A 4L6EA 4QJ3B 2K2UA 3SNHA 2I1JA 5JP4A 1AQCA 1LB1A 1WI1A 1V5PA 1KZGA 1M7EA 2LG1A 2ADZA 2H7DA 3PVUA 2R0DA 4MK0A 3TCAA 5DI9B 4HDOA 1U29A 2DYQA 4WVFB 2KIGA 5HE2A 1ZYIA 2FJLA 2YSZA 1LW3A 1WGUA 2N23A 2RNRB 1BWNA 1U5EA 2D2QA 3KRWA 2X18A 1EGXA 2D9XA 3RCPA 1T77A 1FOEA 2RGNB 1AWEA 1ZM0A 1U2BA 2P8VA 3IVFA 4EMOA 5JHGA 3BJIA 1X86A 5JLJB 4A5KA 1I2HA 1EAZA 4HAUB 4D6WA 4YL8A 4GOUA 4XWXA 5DHFB 5GOWB 3ML4A 1BAKA 4CSQA 2YS1A 2W2WA 2YS5A 2ROZB 3U8ZA 3SUZA 5KQ1A 4HAVB 1DDWA 5J3YA 1UNQA 2DYNA 1NU2A 3P6AA 1MK7B 1PFJA 2VKIA 1XX0A 1K5DB 1J19A 2CODA 5KCVA 4HB3B 3SV1A 3NW8A 3HQCA 4DBBA 3N7CA 1DDVA 1KZ7A 1WJMA 2L1CA 2P0FA 1UPRA 2GCLA 1OQNA 2DFKA 2RSGA 1W1HA 3PG7A 2W2XC 4GNKB 5HE0A 1SGHA 1GC7A 3F0WA 3HSAA 5FI0A 1V5UA 5D3YA 5LONB 1Z87A 3A8PA 4F7HA 1UEFA 1H10A 3PZDA 2ELAA 3U12A 1RRPB 2KIEA 3ODOA 2VRWB 1MAIA 4ZRKA 1X05A 4HB0B 5IRSA 3D8EA 4HB2B 3D8FA 2D9WA 5D3WA 3B77A 1DDMA 2KR0A 5EFXA 2OQBA 2DN6A 1V88A 5L81A 2D10A 4KVGB 2COFA 2Z4DA 3ULCA 3DCXA 2AEHA 3F5RA 3A58A 2GUMA 2UZRA 4ZRJA 4K2OA 4A6FA 2AL6A 3ODWA 3UZTA 1ISNA 1OY2A 1MK9B 2LULA 3HW2B 4HDQA 1J0WA 4WJ7A 2UZSA 5DH9B 3NSUA 2FJUB 2EJ8A 2DTCA 4IOYX 3ZVRA 1KI1B 1RJ2A 3AU5A 3D8DA 1PLSA 3O96A 2H7EA 3HK0A 5JHHA 5M4YB 2NZ8B 1ZC4B 4Z2NA 3VOQA 1XODA 4HHVA 4GPTB 3T06A 4H8SA 5C5BB 3AJ4A 2MDXA 4HAXB 4C0AA 2QKMA 1SHCA 1V5MA 1XR0B 1E5WA 1MIZB 2MFQA 4K81A 3TW1A 2I5FA 2M14A 1OMWA 2QKLA 2I5CA 1B55A 1UPQA 5HE1A 5CLLB 2P0DA 2LOZA 2YT2A 3M1IB 2K2JA 5C5BA 2DLWA 2LYDA 1GG3A 2OTXA 4PQ0A 1V61A 1MPHA 2P0HA 5D3VA 4CYEA 5DIFB 1H4RA 1I7AA 3AU4A 4IFSA 4A6FB 3TFMA 2DA0A 1QC6A 3DXEA 1Q67A 2MWNB 1PMSA 1DROA 2BCJA 5J3TA 2DX5A 4K17A 2GJYA 1FHOA 1IRSA 3SO6A 4DIXA 3NWFA
chains in the Genus database with same CATH topology
2ZPYA 4MY6A 5LOPB 4DX8A 1MKEA 4YONA 1UNPA 2CAYA 4PNKA 4HB4B 2MKRA 2Z0OA 3G9WA 3KZ1A 2CY5A 3MDBC 1FGYA 3DXCA 2L2IA 4HAZB 1DBHA 4EJNA 4Y94A 4B6HA 1Y19B 4F7UP 3KY9A 1U5DA 1NTYA 2COAA 2DKQA 2D11A 1M7RA 1TXDA 3FSSA 3U7DA 3OANA 2ROVA 3WA0A 1MIXA 1WVHA 2Y8GA 2EMSA 2I1KA 1ZC3B 3A8QA 2RLOA 1WG7A 2N0YA 3QBVB 5FI1A 3PSCA 3KSYA 4NY0A 3PVWA 1EVHA 3CIKA 4KHBB 1X11A 3DXDA 2LOXA 2HE7A 2YT0A 2CRFA 2EMTA 4GN1A 4A6HA 1V89A 2YF0A 2LKOA 2ELBA 2DHJA 2YVCA 2DKPA 5C79A 2HTHB 4GXBA 1XKEA 3V5WA 4IAPA 1P5TA 2KUPA 1BTNA 3BINA 5D3XA 3PP2A 1TQZA 4KHOA 3GYPA 2RUKB 3CXBB 4CHMA 1FHWA 2PZ1A 4HAWB 4GMVA 1K5GB 1XCGA 1FHXA 2XQNM 3QIJA 3ZDTA 2D9ZA 1BTKA 1WJ1A 2RVBB 3A98B 2M38A 1P6SA 2IFSA 1GC6A 3GYOA 3PEGA 2W2XD 4HATB 4NSWA 4P7IA 2DX1A 5CLQB 2V76A 2Z0PA 4DXAB 2CY4A 2GS0A 3ODXA 3P7ZA 5D27A 2K00A 3PVLA 2JP2A 2UVMA 4D0NB 2Q13A 3MPXA 4K2PA 5J3QA 2D9YA 2DHIA 3FM8C 4A6KA 2DHKA 1ZSQA 3ULBA 2J0KA 1FGZA 4ZRIA 4TKNA 2Y7BA 1FB8A 4F7GA 1N3HA 2Y8FA 2D9VA 1X1FA 2J0JA 1XD4A 5HE3A 4Z2MB 1U27A 4BBKA 2Z0QA 1WGQA 1U5GA 1UNRA 1EF1A 3X23A 1DYNA 4EKUA 2J59M 1TJ6A 4CHJA 1NI2A 3TO1A 2YRYA 4TYZA 4DX90 5C6RA 2IYBA 3WYFB 2KGXB 5KQ4A 2NMBA 3KRXA 2YS3A 3VIAA 4GZUA 1W1GA 1Y5OA 1ZVRA 5C16A 2J0MA 1NTVA 2R09A 1FAOA 2D4QA 1QQGA 3FEHA 2E2XA 2EC1A 1U5FA 3SYXA 2COCA 4MT7A 4KHAA 5DHAB 2G35A 3LJUX 2GCJA 2VSZA 4GMXB 4HAYB 2YT1A 4KAXB 3QWMA 1W1DA 1P3RA 1X1GA 2KCJA 3TVVA 4WSFA 4L6EA 2K2UA 3SNHA 2I1JA 5JP4A 1AQCA 1LB1A 1WI1A 1V5PA 1KZGA 1M7EA 2LG1A 2ADZA 2H7DA 3PVUA 2R0DA 4MK0A 3TCAA 5DI9B 4HDOA 1U29A 2DYQA 4WVFB 5HE2A 2FJLA 2YSZA 1LW3A 1WGUA 2N23A 2RNRB 1BWNA 1U5EA 2D2QA 3KRWA 2X18A 1EGXA 2D9XA 3RCPA 1FOEA 2RGNB 1AWEA 1ZM0A 1U2BA 2P8VA 3IVFA 4EMOA 5JHGA 3BJIA 1X86A 5JLJB 4A5KA 1I2HA 1EAZA 4HAUB 4YL8A 4XWXA 5DHFB 5GOWB 3ML4A 1BAKA 2YS1A 2W2WA 2YS5A 2ROZB 3U8ZA 3SUZA 5KQ1A 4HAVB 1DDWA 5J3YA 1UNQA 2DYNA 1NU2A 3P6AA 1MK7B 1PFJA 2VKIA 1XX0A 1K5DB 1J19A 2CODA 5KCVA 4HB3B 3SV1A 3HQCA 4DBBA 3N7CA 1DDVA 1KZ7A 1WJMA 2L1CA 2P0FA 1UPRA 2GCLA 1OQNA 2DFKA 2RSGA 1W1HA 3PG7A 2W2XC 5HE0A 1SGHA 1GC7A 3F0WA 5FI0A 1V5UA 5D3YA 5LONB 1Z87A 3A8PA 4F7HA 1UEFA 1H10A 3PZDA 2ELAA 1RRPB 3ODOA 2VRWB 1MAIA 4ZRKA 1X05A 4HB0B 3D8EA 4HB2B 3D8FA 2D9WA 5D3WA 1DDMA 5EFXA 2OQBA 2DN6A 1V88A 5L81A 2D10A 4KVGB 2COFA 3ULCA 2AEHA 3F5RA 2UZRA 4ZRJA 4K2OA 4A6FA 2AL6A 3ODWA 3UZTA 1ISNA 1OY2A 1MK9B 2LULA 3HW2B 4HDQA 1J0WA 4WJ7A 2UZSA 5DH9B 3NSUA 2EJ8A 2DTCA 4IOYX 3ZVRA 1KI1B 1RJ2A 3AU5A 3D8DA 1PLSA 3O96A 2H7EA 3HK0A 5JHHA 2NZ8B 1ZC4B 4Z2NA 3VOQA 1XODA 4HHVA 4GPTB 3T06A 4H8SA 5C5BB 3AJ4A 2MDXA 4HAXB 4C0AA 2QKMA 1SHCA 1V5MA 1XR0B 1E5WA 1MIZB 2MFQA 4K81A 3TW1A 2I5FA 2M14A 1OMWA 2QKLA 2I5CA 1B55A 1UPQA 5HE1A 5CLLB 2P0DA 2LOZA 3M1IB 2K2JA 5C5BA 2DLWA 2LYDA 1GG3A 2OTXA 4PQ0A 1V61A 1MPHA 2P0HA 5D3VA 4CYEA 5DIFB 1H4RA 1I7AA 3AU4A 4IFSA 4A6FB 3TFMA 2DA0A 1QC6A 3DXEA 1Q67A 2MWNB 1PMSA 1DROA 2BCJA 5J3TA 2DX5A 4K17A 2GJYA 1FHOA 1IRSA 3SO6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZPY A;  4MY6 A;  5LOP B;  4DX8 A;  1MKE A;  4YON A;  1UNP A;  2CAY A;  4PNK A;  4HB4 B;  2MKR A;  2Z0O A;  3G9W A;  3KZ1 A;  2CY5 A;  3MDB C;  1FGY A;  3DXC A;  2L2I A;  4HAZ B;  1DBH A;  4EJN A;  4Y94 A;  4B6H A;  1Y19 B;  4F7U P;  3KY9 A;  1U5D A;  1NTY A;  2COA A;  2DKQ A;  2D11 A;  1M7R A;  1TXD A;  3FSS A;  3U7D A;  3OAN A;  2ROV A;  3WA0 A;  1MIX A;  1WVH A;  2Y8G A;  2EMS A;  2I1K A;  1ZC3 B;  3A8Q A;  2RLO A;  1WG7 A;  2N0Y A;  3QBV B;  5FI1 A;  3PSC A;  3KSY A;  4NY0 A;  3PVW A;  1EVH A;  3CIK A;  4KHB B;  1X11 A;  3DXD A;  2LOX A;  2HE7 A;  2YT0 A;  2CRF A;  2EMT A;  4GN1 A;  4A6H A;  1V89 A;  2YF0 A;  2LKO A;  2ELB A;  2DHJ A;  2YVC A;  2DKP A;  5C79 A;  2HTH B;  4GXB A;  1XKE A;  3V5W A;  4IAP A;  1P5T A;  2KUP A;  1BTN A;  3BIN A;  5D3X A;  3PP2 A;  1TQZ A;  4KHO A;  3GYP A;  2RUK B;  3CXB B;  4CHM A;  1FHW A;  2PZ1 A;  4HAW B;  4GMV A;  1K5G B;  1XCG A;  1FHX A;  2XQN M;  3QIJ A;  3ZDT A;  2D9Z A;  1BTK A;  1WJ1 A;  2RVB B;  3A98 B;  2M38 A;  1P6S A;  2IFS A;  1GC6 A;  3GYO A;  3PEG A;  2W2X D;  4HAT B;  4NSW A;  4P7I A;  2DX1 A;  5CLQ B;  2V76 A;  2Z0P A;  4DXA B;  2CY4 A;  2GS0 A;  3ODX A;  3P7Z A;  5D27 A;  2K00 A;  3PVL A;  2JP2 A;  2UVM A;  4D0N B;  2Q13 A;  3MPX A;  4K2P A;  5J3Q A;  2D9Y A;  2DHI A;  3FM8 C;  4A6K A;  2DHK A;  1ZSQ A;  3ULB A;  2J0K A;  1FGZ A;  4ZRI A;  4TKN A;  2Y7B A;  1FB8 A;  4F7G A;  1N3H A;  2Y8F A;  2D9V A;  1X1F A;  2J0J A;  1XD4 A;  5HE3 A;  4Z2M B;  1U27 A;  4BBK A;  2Z0Q A;  1WGQ A;  1U5G A;  1UNR A;  1EF1 A;  3X23 A;  1DYN A;  4EKU A;  2J59 M;  1TJ6 A;  4CHJ A;  1NI2 A;  3TO1 A;  2YRY A;  4TYZ A;  4DX9 0;  5C6R A;  2IYB A;  3WYF B;  2KGX B;  5KQ4 A;  2NMB A;  3KRX A;  2YS3 A;  3VIA A;  4GZU A;  1W1G A;  1Y5O A;  1ZVR A;  5C16 A;  2J0M A;  1NTV A;  2R09 A;  1FAO A;  2D4Q A;  1QQG A;  3FEH A;  2E2X A;  2EC1 A;  1U5F A;  3SYX A;  2COC A;  4MT7 A;  4KHA A;  5DHA B;  2G35 A;  3LJU X;  2GCJ A;  2VSZ A;  4GMX B;  4HAY B;  2YT1 A;  4KAX B;  3QWM A;  1W1D A;  1P3R A;  1X1G A;  2KCJ A;  3TVV A;  4WSF A;  4L6E A;  2K2U A;  3SNH A;  2I1J A;  5JP4 A;  1AQC A;  1LB1 A;  1WI1 A;  1V5P A;  1KZG A;  1M7E A;  2LG1 A;  2ADZ A;  2H7D A;  3PVU A;  2R0D A;  4MK0 A;  3TCA A;  5DI9 B;  4HDO A;  1U29 A;  2DYQ A;  4WVF B;  5HE2 A;  2FJL A;  2YSZ A;  1LW3 A;  1WGU A;  2N23 A;  2RNR B;  1BWN A;  1U5E A;  2D2Q A;  3KRW A;  2X18 A;  1EGX A;  2D9X A;  3RCP A;  1FOE A;  2RGN B;  1AWE A;  1ZM0 A;  1U2B A;  2P8V A;  3IVF A;  4EMO A;  5JHG A;  3BJI A;  1X86 A;  5JLJ B;  4A5K A;  1I2H A;  1EAZ A;  4HAU B;  4YL8 A;  4XWX A;  5DHF B;  5GOW B;  3ML4 A;  1BAK A;  2YS1 A;  2W2W A;  2YS5 A;  2ROZ B;  3U8Z A;  3SUZ A;  5KQ1 A;  4HAV B;  1DDW A;  5J3Y A;  1UNQ A;  2DYN A;  1NU2 A;  3P6A A;  1MK7 B;  1PFJ A;  2VKI A;  1XX0 A;  1K5D B;  1J19 A;  2COD A;  5KCV A;  4HB3 B;  3SV1 A;  3HQC A;  4DBB A;  3N7C A;  1DDV A;  1KZ7 A;  1WJM A;  2L1C A;  2P0F A;  1UPR A;  2GCL A;  1OQN A;  2DFK A;  2RSG A;  1W1H A;  3PG7 A;  2W2X C;  5HE0 A;  1SGH A;  1GC7 A;  3F0W A;  5FI0 A;  1V5U A;  5D3Y A;  5LON B;  1Z87 A;  3A8P A;  4F7H A;  1UEF A;  1H10 A;  3PZD A;  2ELA A;  1RRP B;  3ODO A;  2VRW B;  1MAI A;  4ZRK A;  1X05 A;  4HB0 B;  3D8E A;  4HB2 B;  3D8F A;  2D9W A;  5D3W A;  1DDM A;  5EFX A;  2OQB A;  2DN6 A;  1V88 A;  5L81 A;  2D10 A;  4KVG B;  2COF A;  3ULC A;  2AEH A;  3F5R A;  2UZR A;  4ZRJ A;  4K2O A;  4A6F A;  2AL6 A;  3ODW A;  3UZT A;  1ISN A;  1OY2 A;  1MK9 B;  2LUL A;  3HW2 B;  4HDQ A;  1J0W A;  4WJ7 A;  2UZS A;  5DH9 B;  3NSU A;  2EJ8 A;  2DTC A;  4IOY X;  3ZVR A;  1KI1 B;  1RJ2 A;  3AU5 A;  3D8D A;  1PLS A;  3O96 A;  2H7E A;  3HK0 A;  5JHH A;  2NZ8 B;  1ZC4 B;  4Z2N A;  3VOQ A;  1XOD A;  4HHV A;  4GPT B;  3T06 A;  4H8S A;  5C5B B;  3AJ4 A;  2MDX A;  4HAX B;  4C0A A;  2QKM A;  1SHC A;  1V5M A;  1XR0 B;  1E5W A;  1MIZ B;  2MFQ A;  4K81 A;  3TW1 A;  2I5F A;  2M14 A;  1OMW A;  2QKL A;  2I5C A;  1B55 A;  1UPQ A;  5HE1 A;  5CLL B;  2P0D A;  2LOZ A;  3M1I B;  2K2J A;  5C5B A;  2DLW A;  2LYD A;  1GG3 A;  2OTX A;  4PQ0 A;  1V61 A;  1MPH A;  2P0H A;  5D3V A;  4CYE A;  5DIF B;  1H4R A;  1I7A A;  3AU4 A;  4IFS A;  4A6F B;  3TFM A;  2DA0 A;  1QC6 A;  3DXE A;  1Q67 A;  2MWN B;  1PMS A;  1DRO A;  2BCJ A;  5J3T A;  2DX5 A;  4K17 A;  2GJY A;  1FHO A;  1IRS A;  3SO6 A; 
#chains in the Genus database with same CATH topology
 2ZPY A;  4MY6 A;  5LOP B;  4DX8 A;  1MKE A;  4YON A;  1UNP A;  2CAY A;  4PNK A;  4HB4 B;  2MKR A;  2Z0O A;  3G9W A;  3KZ1 A;  2CY5 A;  3MDB C;  1FGY A;  3DXC A;  2L2I A;  4HAZ B;  1DBH A;  4EJN A;  4Y94 A;  4B6H A;  1Y19 B;  4F7U P;  3KY9 A;  1U5D A;  4KHB A;  1NTY A;  2COA A;  2DKQ A;  2D11 A;  1M7R A;  1TXD A;  3FSS A;  3U7D A;  3OAN A;  2ROV A;  3WA0 A;  1MIX A;  1WVH A;  2Y8G A;  2EMS A;  2I1K A;  1ZC3 B;  4QJ4 B;  3A8Q A;  2KUQ A;  2RLO A;  1WG7 A;  5I2S A;  2N0Y A;  3QBV B;  5FI1 A;  3PSC A;  3KSY A;  4NY0 A;  3PVW A;  1EVH A;  3CIK A;  4KHB B;  1X11 A;  3DXD A;  2LOX A;  2HE7 A;  2YT0 A;  2CRF A;  2EMT A;  2Z59 A;  4GN1 A;  4A6H A;  1V89 A;  3HIE A;  2YF0 A;  2LKO A;  2ELB A;  2DHJ A;  2YVC A;  2DKP A;  4QXA B;  5C79 A;  2Z13 A;  2HTH B;  2ZKM X;  4GXB A;  1XKE A;  3V5W A;  4IAP A;  5LG4 B;  1P5T A;  2KUP A;  1BTN A;  3BIN A;  5D3X A;  3PP2 A;  1TQZ A;  4KHO A;  3GYP A;  2RUK B;  3CXB B;  4CHM A;  1FHW A;  2PZ1 A;  4HAW B;  5I2M A;  4GMV A;  2NBV A;  1K5G B;  1XCG A;  1FHX A;  2XQN M;  3QIJ A;  3ZDT A;  2D9Z A;  1BTK A;  1WJ1 A;  2RVB B;  1MI1 A;  3A98 B;  2M38 A;  1P6S A;  2IFS A;  1GC6 A;  3GYO A;  3PEG A;  2W2X D;  4HAT B;  4NSW A;  4P7I A;  2DX1 A;  5CLQ B;  2V76 A;  2Z0P A;  4DXA B;  2CY4 A;  2GS0 A;  3ODX A;  3P7Z A;  5D27 A;  2K00 A;  4QJ5 B;  3NWD A;  3PVL A;  2JP2 A;  2UVM A;  4D0N B;  2K49 A;  3NWA A;  2Q13 A;  3MPX A;  4K2P A;  3FVC A;  5J3Q A;  2D9Y A;  2DHI A;  3FM8 C;  4A6K A;  2DHK A;  1ZSQ A;  3ULB A;  2K8E A;  3OHM B;  2J0K A;  1FGZ A;  4ZRI A;  4TKN A;  2Y7B A;  1FB8 A;  4F7G A;  1N3H A;  2Y8F A;  2D9V A;  1X1F A;  2J0J A;  1XD4 A;  5HE3 A;  4Z2M B;  1U27 A;  4BBK A;  2Z0Q A;  1WGQ A;  1U5G A;  1UNR A;  2R2Y A;  1EF1 A;  3X23 A;  1DYN A;  4HSI A;  4EKU A;  2RRF A;  2J59 M;  1TJ6 A;  4CHJ A;  1NI2 A;  3TO1 A;  2YRY A;  4TYZ A;  4DX9 0;  5C6R A;  2IYB A;  3WYF B;  2KGX B;  5KQ4 A;  2NMB A;  3KRX A;  2YS3 A;  3VIA A;  4GZU A;  1W1G A;  1Y5O A;  1ZVR A;  5C16 A;  2J0M A;  1NTV A;  2R09 A;  2Z14 A;  1FAO A;  2D4Q A;  1QQG A;  3FEH A;  2E2X A;  2EC1 A;  1U5F A;  3SYX A;  2COC A;  4MT7 A;  4KHA A;  5DHA B;  2G35 A;  3LJU X;  2GCJ A;  2VSZ A;  4GMX B;  4HAY B;  2YT1 A;  4KAX B;  3QWM A;  1W1D A;  4OSN A;  1P3R A;  1X1G A;  2KCJ A;  3TVV A;  4WSF A;  4L1R A;  4OT1 A;  4L6E A;  4QJ3 B;  2K2U A;  3SNH A;  2I1J A;  5JP4 A;  1AQC A;  1LB1 A;  1WI1 A;  1V5P A;  1KZG A;  1M7E A;  2LG1 A;  2ADZ A;  2H7D A;  3PVU A;  2R0D A;  4MK0 A;  3TCA A;  5DI9 B;  4HDO A;  1U29 A;  2DYQ A;  4WVF B;  2KIG A;  5HE2 A;  1ZYI A;  2FJL A;  2YSZ A;  1LW3 A;  1WGU A;  2N23 A;  2RNR B;  1BWN A;  1U5E A;  2D2Q A;  3KRW A;  2X18 A;  1EGX A;  2D9X A;  3RCP A;  1T77 A;  1FOE A;  2RGN B;  1AWE A;  1ZM0 A;  1U2B A;  2P8V A;  3IVF A;  4EMO A;  5JHG A;  3BJI A;  1X86 A;  5JLJ B;  4A5K A;  1I2H A;  1EAZ A;  4HAU B;  4D6W A;  4YL8 A;  4GOU A;  4XWX A;  5DHF B;  5GOW B;  3ML4 A;  1BAK A;  4CSQ A;  2YS1 A;  2W2W A;  2YS5 A;  2ROZ B;  3U8Z A;  3SUZ A;  5KQ1 A;  4HAV B;  1DDW A;  5J3Y A;  1UNQ A;  2DYN A;  1NU2 A;  3P6A A;  1MK7 B;  1PFJ A;  2VKI A;  1XX0 A;  1K5D B;  1J19 A;  2COD A;  5KCV A;  4HB3 B;  3SV1 A;  3NW8 A;  3HQC A;  4DBB A;  3N7C A;  1DDV A;  1KZ7 A;  1WJM A;  2L1C A;  2P0F A;  1UPR A;  2GCL A;  1OQN A;  2DFK A;  2RSG A;  1W1H A;  3PG7 A;  2W2X C;  4GNK B;  5HE0 A;  1SGH A;  1GC7 A;  3F0W A;  3HSA A;  5FI0 A;  1V5U A;  5D3Y A;  5LON B;  1Z87 A;  3A8P A;  4F7H A;  1UEF A;  1H10 A;  3PZD A;  2ELA A;  3U12 A;  1RRP B;  2KIE A;  3ODO A;  2VRW B;  1MAI A;  4ZRK A;  1X05 A;  4HB0 B;  5IRS A;  3D8E A;  4HB2 B;  3D8F A;  2D9W A;  5D3W A;  3B77 A;  1DDM A;  2KR0 A;  5EFX A;  2OQB A;  2DN6 A;  1V88 A;  5L81 A;  2D10 A;  4KVG B;  2COF A;  2Z4D A;  3ULC A;  3DCX A;  2AEH A;  3F5R A;  3A58 A;  2GUM A;  2UZR A;  4ZRJ A;  4K2O A;  4A6F A;  2AL6 A;  3ODW A;  3UZT A;  1ISN A;  1OY2 A;  1MK9 B;  2LUL A;  3HW2 B;  4HDQ A;  1J0W A;  4WJ7 A;  2UZS A;  5DH9 B;  3NSU A;  2FJU B;  2EJ8 A;  2DTC A;  4IOY X;  3ZVR A;  1KI1 B;  1RJ2 A;  3AU5 A;  3D8D A;  1PLS A;  3O96 A;  2H7E A;  3HK0 A;  5JHH A;  5M4Y B;  2NZ8 B;  1ZC4 B;  4Z2N A;  3VOQ A;  1XOD A;  4HHV A;  4GPT B;  3T06 A;  4H8S A;  5C5B B;  3AJ4 A;  2MDX A;  4HAX B;  4C0A A;  2QKM A;  1SHC A;  1V5M A;  1XR0 B;  1E5W A;  1MIZ B;  2MFQ A;  4K81 A;  3TW1 A;  2I5F A;  2M14 A;  1OMW A;  2QKL A;  2I5C A;  1B55 A;  1UPQ A;  5HE1 A;  5CLL B;  2P0D A;  2LOZ A;  2YT2 A;  3M1I B;  2K2J A;  5C5B A;  2DLW A;  2LYD A;  1GG3 A;  2OTX A;  4PQ0 A;  1V61 A;  1MPH A;  2P0H A;  5D3V A;  4CYE A;  5DIF B;  1H4R A;  1I7A A;  3AU4 A;  4IFS A;  4A6F B;  3TFM A;  2DA0 A;  1QC6 A;  3DXE A;  1Q67 A;  2MWN B;  1PMS A;  1DRO A;  2BCJ A;  5J3T A;  2DX5 A;  4K17 A;  2GJY A;  1FHO A;  1IRS A;  3SO6 A;  4DIX A;  3NWF A; 
#chains in the Genus database with same CATH homology
 2ZPY A;  4MY6 A;  5LOP B;  4DX8 A;  1MKE A;  4YON A;  1UNP A;  2CAY A;  4PNK A;  4HB4 B;  2MKR A;  2Z0O A;  3G9W A;  3KZ1 A;  2CY5 A;  3MDB C;  1FGY A;  3DXC A;  2L2I A;  4HAZ B;  1DBH A;  4EJN A;  4Y94 A;  4B6H A;  1Y19 B;  4F7U P;  3KY9 A;  1U5D A;  1NTY A;  2COA A;  2DKQ A;  2D11 A;  1M7R A;  1TXD A;  3FSS A;  3U7D A;  3OAN A;  2ROV A;  3WA0 A;  1MIX A;  1WVH A;  2Y8G A;  2EMS A;  2I1K A;  1ZC3 B;  3A8Q A;  2RLO A;  1WG7 A;  2N0Y A;  3QBV B;  5FI1 A;  3PSC A;  3KSY A;  4NY0 A;  3PVW A;  1EVH A;  3CIK A;  4KHB B;  1X11 A;  3DXD A;  2LOX A;  2HE7 A;  2YT0 A;  2CRF A;  2EMT A;  4GN1 A;  4A6H A;  1V89 A;  2YF0 A;  2LKO A;  2ELB A;  2DHJ A;  2YVC A;  2DKP A;  5C79 A;  2HTH B;  4GXB A;  1XKE A;  3V5W A;  4IAP A;  1P5T A;  2KUP A;  1BTN A;  3BIN A;  5D3X A;  3PP2 A;  1TQZ A;  4KHO A;  3GYP A;  2RUK B;  3CXB B;  4CHM A;  1FHW A;  2PZ1 A;  4HAW B;  4GMV A;  1K5G B;  1XCG A;  1FHX A;  2XQN M;  3QIJ A;  3ZDT A;  2D9Z A;  1BTK A;  1WJ1 A;  2RVB B;  3A98 B;  2M38 A;  1P6S A;  2IFS A;  1GC6 A;  3GYO A;  3PEG A;  2W2X D;  4HAT B;  4NSW A;  4P7I A;  2DX1 A;  5CLQ B;  2V76 A;  2Z0P A;  4DXA B;  2CY4 A;  2GS0 A;  3ODX A;  3P7Z A;  5D27 A;  2K00 A;  3PVL A;  2JP2 A;  2UVM A;  4D0N B;  2Q13 A;  3MPX A;  4K2P A;  5J3Q A;  2D9Y A;  2DHI A;  3FM8 C;  4A6K A;  2DHK A;  1ZSQ A;  3ULB A;  2J0K A;  1FGZ A;  4ZRI A;  4TKN A;  2Y7B A;  1FB8 A;  4F7G A;  1N3H A;  2Y8F A;  2D9V A;  1X1F A;  2J0J A;  1XD4 A;  5HE3 A;  4Z2M B;  1U27 A;  4BBK A;  2Z0Q A;  1WGQ A;  1U5G A;  1UNR A;  1EF1 A;  3X23 A;  1DYN A;  4EKU A;  2J59 M;  1TJ6 A;  4CHJ A;  1NI2 A;  3TO1 A;  2YRY A;  4TYZ A;  4DX9 0;  5C6R A;  2IYB A;  3WYF B;  2KGX B;  5KQ4 A;  2NMB A;  3KRX A;  2YS3 A;  3VIA A;  4GZU A;  1W1G A;  1Y5O A;  1ZVR A;  5C16 A;  2J0M A;  1NTV A;  2R09 A;  1FAO A;  2D4Q A;  1QQG A;  3FEH A;  2E2X A;  2EC1 A;  1U5F A;  3SYX A;  2COC A;  4MT7 A;  4KHA A;  5DHA B;  2G35 A;  3LJU X;  2GCJ A;  2VSZ A;  4GMX B;  4HAY B;  2YT1 A;  4KAX B;  3QWM A;  1W1D A;  1P3R A;  1X1G A;  2KCJ A;  3TVV A;  4WSF A;  4L6E A;  2K2U A;  3SNH A;  2I1J A;  5JP4 A;  1AQC A;  1LB1 A;  1WI1 A;  1V5P A;  1KZG A;  1M7E A;  2LG1 A;  2ADZ A;  2H7D A;  3PVU A;  2R0D A;  4MK0 A;  3TCA A;  5DI9 B;  4HDO A;  1U29 A;  2DYQ A;  4WVF B;  5HE2 A;  2FJL A;  2YSZ A;  1LW3 A;  1WGU A;  2N23 A;  2RNR B;  1BWN A;  1U5E A;  2D2Q A;  3KRW A;  2X18 A;  1EGX A;  2D9X A;  3RCP A;  1FOE A;  2RGN B;  1AWE A;  1ZM0 A;  1U2B A;  2P8V A;  3IVF A;  4EMO A;  5JHG A;  3BJI A;  1X86 A;  5JLJ B;  4A5K A;  1I2H A;  1EAZ A;  4HAU B;  4YL8 A;  4XWX A;  5DHF B;  5GOW B;  3ML4 A;  1BAK A;  2YS1 A;  2W2W A;  2YS5 A;  2ROZ B;  3U8Z A;  3SUZ A;  5KQ1 A;  4HAV B;  1DDW A;  5J3Y A;  1UNQ A;  2DYN A;  1NU2 A;  3P6A A;  1MK7 B;  1PFJ A;  2VKI A;  1XX0 A;  1K5D B;  1J19 A;  2COD A;  5KCV A;  4HB3 B;  3SV1 A;  3HQC A;  4DBB A;  3N7C A;  1DDV A;  1KZ7 A;  1WJM A;  2L1C A;  2P0F A;  1UPR A;  2GCL A;  1OQN A;  2DFK A;  2RSG A;  1W1H A;  3PG7 A;  2W2X C;  5HE0 A;  1SGH A;  1GC7 A;  3F0W A;  5FI0 A;  1V5U A;  5D3Y A;  5LON B;  1Z87 A;  3A8P A;  4F7H A;  1UEF A;  1H10 A;  3PZD A;  2ELA A;  1RRP B;  3ODO A;  2VRW B;  1MAI A;  4ZRK A;  1X05 A;  4HB0 B;  3D8E A;  4HB2 B;  3D8F A;  2D9W A;  5D3W A;  1DDM A;  5EFX A;  2OQB A;  2DN6 A;  1V88 A;  5L81 A;  2D10 A;  4KVG B;  2COF A;  3ULC A;  2AEH A;  3F5R A;  2UZR A;  4ZRJ A;  4K2O A;  4A6F A;  2AL6 A;  3ODW A;  3UZT A;  1ISN A;  1OY2 A;  1MK9 B;  2LUL A;  3HW2 B;  4HDQ A;  1J0W A;  4WJ7 A;  2UZS A;  5DH9 B;  3NSU A;  2EJ8 A;  2DTC A;  4IOY X;  3ZVR A;  1KI1 B;  1RJ2 A;  3AU5 A;  3D8D A;  1PLS A;  3O96 A;  2H7E A;  3HK0 A;  5JHH A;  2NZ8 B;  1ZC4 B;  4Z2N A;  3VOQ A;  1XOD A;  4HHV A;  4GPT B;  3T06 A;  4H8S A;  5C5B B;  3AJ4 A;  2MDX A;  4HAX B;  4C0A A;  2QKM A;  1SHC A;  1V5M A;  1XR0 B;  1E5W A;  1MIZ B;  2MFQ A;  4K81 A;  3TW1 A;  2I5F A;  2M14 A;  1OMW A;  2QKL A;  2I5C A;  1B55 A;  1UPQ A;  5HE1 A;  5CLL B;  2P0D A;  2LOZ A;  3M1I B;  2K2J A;  5C5B A;  2DLW A;  2LYD A;  1GG3 A;  2OTX A;  4PQ0 A;  1V61 A;  1MPH A;  2P0H A;  5D3V A;  4CYE A;  5DIF B;  1H4R A;  1I7A A;  3AU4 A;  4IFS A;  4A6F B;  3TFM A;  2DA0 A;  1QC6 A;  3DXE A;  1Q67 A;  2MWN B;  1PMS A;  1DRO A;  2BCJ A;  5J3T A;  2DX5 A;  4K17 A;  2GJY A;  1FHO A;  1IRS A;  3SO6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...