2P0DA

Arhgap9 ph domain in complex with ins(1,4,5)p3
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
121
structure length
107
Chain Sequence
b'SHEVEKSGLLNMTKIAQGGRKLRKNWGPSWVVLTGNSLVFYREPRPESSVDLRGAALAHGRHLSSRRNVLHIRTIPGHEFLLQSDHETELRAWHRALRTVIERLVRW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Rho GTPase-activating protein 9
publication title Non-canonical Interaction of Phosphoinositides with Pleckstrin Homology Domains of Tiam1 and ArhGAP9.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligand binding protein
total genus 26
structure length 107
sequence length 121
ec nomenclature
pdb deposition date 2007-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2p0dA00
2D10A 1MAIA 1XKEA 4KHBB 2GCLA 2P0DA 2Z0OA 3KY9A 3NSUA 1XR0B 4PNKA 2YS1A 1I7AA 2M38A 4MY6A 1KZGA 4D0NB 3PSCA 2J0KA 1WGQA 2J0MA 2NZ8B 3CXBB 3F0WA 2EMSA 1Q67A 1EGXA 1V5MA 1KI1B 2J59M 1ZVRA 2LOZA 5FI0A 4F7UP 4F7HA 1E5WA 4DX8A 2GS0A 2RVBB 4CYEA 2RNRB 3P6AA 1WG7A 3U7DA 2DYNA 3TCAA 5DHAB 3F5RA 1TQZA 4KHOA 2J0JA 1K5DB 2R0DA 3M1IB 1ZC4B 3A98B 1W1HA 3ZDTA 4XWXA 1EAZA 1NTVA 3FM8C 4CHMA 5C5BB 2H7DA 4IFSA 4HB2B 5KQ4A 2D11A 5D3VA 2DHJA 2DKQA 2YVCA 2MKRA 2K2JA 2N23A 4P7IA 3SUZA 5HE2A 3HW2B 1XX0A 1V5UA 2L2IA 1X86A 2D2QA 2OQBA 2DLWA 3GYOA 1U2BA 1WJ1A 2RSGA 1WGUA 3P7ZA 3X23A 4HAVB 1DDMA 3D8EA 1H4RA 2DA0A 2YS5A 3BJIA 2CY5A 4H8SA 4GZUA 3QWMA 2CY4A 4GMVA 5FI1A 4K17A 1RRPB 3ML4A 3KZ1A 4HAUB 4HDOA 4DBBA 3A8QA 3MDBC 1ZM0A 2MFQA 2OTXA 5GOWB 4C0AA 5CLQB 2DTCA 3ODOA 4WJ7A 5JLJB 1OQNA 2RLOA 4ZRKA 2ADZA 3AJ4A 4B6HA 1P3RA 2DHIA 4EMOA 2H7EA 3WYFB 3SO6A 1BTNA 4DX90 3TW1A 2JP2A 2YF0A 2LKOA 5D3XA 2MDXA 2UZRA 2COAA 1W1GA 3PVUA 5HE1A 1X1FA 5EFXA 2QKMA 1MK9B 4YONA 3BINA 2CODA 2LULA 1Z87A 2M14A 4K81A 2D9XA 1AQCA 4YL8A 1ZC3B 3ODWA 5D27A 1MPHA 5HE3A 3GYPA 2EMTA 4HHVA 2R09A 1QC6A 4TYZA 1TXDA 1EF1A 3SV1A 3CIKA 3QIJA 3LJUX 1Y5OA 1TJ6A 1QQGA 2COFA 2X18A 3SNHA 3ODXA 5D3WA 2KCJA 1U29A 1BAKA 4F7GA 2I1KA 2ROVA 1NTYA 1BTKA 1FGZA 2LYDA 2AEHA 1FAOA 4KHAA 2I5FA 5C6RA 2YSZA 2P0FA 4HAYB 1DDVA 2DHKA 3OANA 1MIXA 1FHOA 2DYQA 4TKNA 2I5CA 5LONB 5J3QA 2W2XC 2COCA 1UEFA 2IFSA 3PG7A 2ZPYA 1J19A 1PMSA 1NI2A 2D4QA 2DFKA 2PZ1A 2IYBA 2N0YA 5C79A 2EJ8A 4HDQA 1DDWA 2VRWB 2HTHB 4K2OA 1OMWA 5J3TA 3ZVRA 4A6FB 1P5TA 4GXBA 3UZTA 1UPQA 2CRFA 2Y7BA 5C5BA 3PZDA 4HB3B 3PEGA 2KGXB 5DHFB 2Q13A 3TO1A 1WI1A 2Y8FA 3RCPA 1I2HA 3KRWA 2FJLA 1ZSQA 3DXEA 2V76A 2I1JA 1MKEA 1FHWA 2LOXA 3AU4A 4KAXB 1AWEA 3T06A 2MWNB 1WVHA 2DX1A 1N3HA 3FEHA 4EJNA 1GG3A 4IAPA 1X11A 1FHXA 3D8DA 2QKLA 4GMXB 1V88A 2XQNM 1LW3A 1UNPA 4A5KA 2YS3A 1MIZB 5JP4A 2LG1A 3ULCA 4BBKA 4GPTB 2DN6A 3U8ZA 3HQCA 3IVFA 1U5EA 3PVLA 3MPXA 1U5FA 4PQ0A 1V61A 1V5PA 1GC7A 2ELAA 1PLSA 2DKPA 1XODA 4WVFB 2CAYA 4ZRJA 4HAZB 4HAXB 1B55A 1XCGA 3HK0A 2YRYA 2D9YA 1H10A 2Z0QA 2P8VA 3A8PA 1EVHA 1SHCA 3TVVA 1DROA 2Y8GA 3V5WA 3VIAA 3KRXA 1DYNA 5J3YA 5L81A 4HAWB 1J0WA 4NSWA 4K2PA 2UZSA 2YT0A 5D3YA 5C16A 2YT1A 5CLLB 3PVWA 2VSZA 5DH9B 4Z2MB 2HE7A 3AU5A 2D9VA 2ELBA 2VKIA 2E2XA 2ROZB 4A6HA 4HB0B 2G35A 2AL6A 4Y94A 4CHJA 1WJMA 1LB1A 4KVGB 1UNQA 1GC6A 2L1CA 2GCJA 1W1DA 1RJ2A 5HE0A 5LOPB 1U5DA 3FSSA 2NMBA 2P0HA 1U27A 3DXCA 1IRSA 5DIFB 1PFJA 2K2UA 3G9WA 1UPRA 4MK0A 4NY0A 4EKUA 4HB4B 1X05A 5DI9B 4ZRIA 2W2XD 1BWNA 1FB8A 5JHHA 1M7EA 2UVMA 1K5GB 2W2WA 2EC1A 3N7CA 4DXAB 3QBVB 1ISNA 1XD4A 2DX5A 2KUPA 1V89A 3D8FA 1KZ7A 3VOQA 3ULBA 2Z0PA 4WSFA 2K00A 2RUKB 3KSYA 1FGYA 1NU2A 4L6EA 1FOEA 4A6FA 1P6SA 2D9WA 1OY2A 2BCJA 4GN1A 1SGHA 5KCVA 4MT7A 3TFMA 1X1GA 2RGNB 4HATB 3O96A 1M7RA 1Y19B 1UNRA 4A6KA 3SYXA 1U5GA 2GJYA 5KQ1A 4Z2NA 1DBHA 4IOYX 2D9ZA 3DXDA 3WA0A 5JHGA 3PP2A 1MK7B
chains in the Genus database with same CATH superfamily
2D10A 1MAIA 1XKEA 2Z59A 4KHBB 2GCLA 2P0DA 2Z0OA 3KY9A 3NSUA 1XR0B 4PNKA 2YS1A 1I7AA 2M38A 4MY6A 1KZGA 4D0NB 3PSCA 2J0KA 1WGQA 2J0MA 3NWFA 2NZ8B 3CXBB 3F0WA 2Z14A 2EMSA 1Q67A 1EGXA 1V5MA 1KI1B 2J59M 1ZVRA 2LOZA 5FI0A 4F7UP 4F7HA 1E5WA 4DX8A 2GS0A 2RVBB 4CYEA 2RNRB 3P6AA 1WG7A 3U7DA 2DYNA 3TCAA 5DHAB 3F5RA 2KIEA 1TQZA 4KHOA 2J0JA 1K5DB 2R0DA 3M1IB 1ZC4B 3A98B 1W1HA 3ZDTA 4XWXA 1EAZA 1NTVA 3FM8C 4CHMA 5C5BB 2H7DA 4IFSA 4HB2B 5I2SA 5KQ4A 2D11A 5D3VA 2DHJA 2DKQA 2YVCA 2MKRA 2K2JA 2N23A 2RRFA 4P7IA 3SUZA 5HE2A 3HW2B 4QJ4B 1XX0A 1V5UA 2L2IA 1X86A 2D2QA 2OQBA 2DLWA 3GYOA 1U2BA 1WJ1A 2RSGA 1WGUA 3P7ZA 3X23A 4HAVB 1DDMA 3D8EA 1H4RA 2DA0A 2YS5A 3BJIA 2CY5A 4H8SA 4GZUA 3QWMA 2CY4A 4GMVA 5FI1A 4K17A 1RRPB 3ML4A 3KZ1A 4HAUB 4HDOA 4DBBA 3A8QA 3MDBC 1ZM0A 2MFQA 2OTXA 5GOWB 4C0AA 5CLQB 2DTCA 3ODOA 3OHMB 3NWDA 4WJ7A 5JLJB 1OQNA 2RLOA 4ZRKA 2ADZA 3AJ4A 2Z4DA 4B6HA 1P3RA 2DHIA 5I2MA 2KUQA 2H7EA 3WYFB 3SO6A 4EMOA 1BTNA 4DX90 3TW1A 2JP2A 2YF0A 2LKOA 5D3XA 2MDXA 2UZRA 2COAA 1W1GA 3PVUA 5HE1A 1X1FA 5EFXA 2QKMA 1MK9B 4YONA 3BINA 1MI1A 2CODA 2LULA 1Z87A 2M14A 4K81A 2D9XA 1AQCA 4YL8A 1ZC3B 3ODWA 5D27A 1MPHA 5HE3A 3GYPA 2EMTA 4HHVA 2R09A 1QC6A 4TYZA 1TXDA 2K49A 1EF1A 3SV1A 2NBVA 3CIKA 2KIGA 3QIJA 3LJUX 1Y5OA 1TJ6A 1QQGA 2COFA 2X18A 3SNHA 3ODXA 5D3WA 2KCJA 1U29A 1BAKA 4QXAB 4F7GA 2I1KA 2ROVA 1NTYA 1BTKA 4KHBA 1FGZA 2LYDA 2AEHA 1FAOA 4KHAA 2I5FA 5C6RA 2YSZA 2P0FA 4HAYB 4L1RA 1DDVA 2DHKA 3OANA 1MIXA 1FHOA 2DYQA 4TKNA 2I5CA 5LONB 2KR0A 5J3QA 2W2XC 2COCA 1UEFA 2IFSA 3PG7A 2ZPYA 1J19A 5M4YB 1PMSA 1NI2A 3DCXA 2D4QA 2DFKA 2PZ1A 2IYBA 2Z13A 2N0YA 5C79A 2EJ8A 4HDQA 1DDWA 2VRWB 2HTHB 4K2OA 1OMWA 5LG4B 5J3TA 3ZVRA 4A6FB 2R2YA 1P5TA 4GXBA 4D6WA 3UZTA 1UPQA 2CRFA 2Y7BA 5C5BA 3PZDA 4HB3B 3PEGA 2KGXB 5DHFB 2Q13A 2YT2A 3TO1A 1WI1A 2Y8FA 3RCPA 1I2HA 3KRWA 2FJLA 1ZSQA 3DXEA 2V76A 2I1JA 1MKEA 1FHWA 2LOXA 3AU4A 4KAXB 1AWEA 1ZYIA 3T06A 2MWNB 1WVHA 2DX1A 4CSQA 2K8EA 1N3HA 3FEHA 4EJNA 1GG3A 4IAPA 1X11A 1FHXA 3D8DA 2QKLA 4GMXB 1V88A 2XQNM 1LW3A 1UNPA 4A5KA 2YS3A 3NWAA 1MIZB 5JP4A 2LG1A 3ULCA 4BBKA 4GPTB 2DN6A 3U8ZA 3HQCA 3IVFA 1U5EA 3PVLA 3MPXA 1U5FA 4PQ0A 1V61A 1V5PA 1GC7A 2ELAA 1PLSA 2DKPA 1XODA 4WVFB 2CAYA 4ZRJA 2GUMA 4HAZB 4HAXB 1B55A 1XCGA 2ZKMX 3HK0A 2YRYA 2D9YA 1H10A 2Z0QA 2P8VA 3A8PA 1EVHA 1SHCA 2FJUB 3TVVA 1DROA 2Y8GA 3V5WA 1T77A 3VIAA 3KRXA 1DYNA 5J3YA 5L81A 4HAWB 1J0WA 4NSWA 4K2PA 4OT1A 2UZSA 2YT0A 5D3YA 5C16A 2YT1A 5CLLB 3PVWA 2VSZA 5DH9B 4Z2MB 2HE7A 4HSIA 3AU5A 2D9VA 2ELBA 2VKIA 2E2XA 2ROZB 4A6HA 4HB0B 2G35A 2AL6A 4Y94A 4CHJA 1WJMA 1LB1A 4KVGB 1UNQA 3HSAA 1GC6A 2L1CA 2GCJA 1W1DA 1RJ2A 4QJ3B 5HE0A 5LOPB 3B77A 1U5DA 3FSSA 2NMBA 2P0HA 1U27A 3DXCA 1IRSA 3NW8A 5DIFB 1PFJA 2K2UA 3FVCA 3G9WA 1UPRA 4MK0A 4NY0A 4EKUA 4HB4B 1X05A 5DI9B 4ZRIA 2W2XD 1BWNA 1FB8A 5JHHA 1M7EA 2UVMA 1K5GB 2W2WA 2EC1A 3N7CA 4GOUA 4DXAB 3QBVB 4OSNA 1ISNA 4QJ5B 1XD4A 2DX5A 2KUPA 1V89A 3D8FA 1KZ7A 3VOQA 3ULBA 2Z0PA 4WSFA 2K00A 2RUKB 3KSYA 1FGYA 1NU2A 4L6EA 4GNKB 4DIXA 1FOEA 3HIEA 4A6FA 1P6SA 2D9WA 1OY2A 2BCJA 4GN1A 1SGHA 5KCVA 4MT7A 3TFMA 1X1GA 2RGNB 4HATB 5IRSA 3O96A 1M7RA 1Y19B 1UNRA 4A6KA 3SYXA 1U5GA 3U12A 2GJYA 5KQ1A 3A58A 4Z2NA 1DBHA 4IOYX 2D9ZA 3DXDA 3WA0A 5JHGA 3PP2A 1MK7B
chains in the Genus database with same CATH topology
2D10A 1MAIA 1XKEA 4KHBB 2GCLA 2P0DA 2Z0OA 3KY9A 3NSUA 1XR0B 4PNKA 2YS1A 1I7AA 2M38A 4MY6A 1KZGA 4D0NB 3PSCA 2J0KA 1WGQA 2J0MA 2NZ8B 3CXBB 3F0WA 2EMSA 1Q67A 1EGXA 1V5MA 1KI1B 2J59M 1ZVRA 2LOZA 5FI0A 4F7UP 4F7HA 1E5WA 4DX8A 2GS0A 2RVBB 4CYEA 2RNRB 3P6AA 1WG7A 3U7DA 2DYNA 3TCAA 5DHAB 3F5RA 1TQZA 4KHOA 2J0JA 1K5DB 2R0DA 3M1IB 1ZC4B 3A98B 1W1HA 3ZDTA 4XWXA 1EAZA 1NTVA 3FM8C 4CHMA 5C5BB 2H7DA 4IFSA 4HB2B 5KQ4A 2D11A 5D3VA 2DHJA 2DKQA 2YVCA 2MKRA 2K2JA 2N23A 4P7IA 3SUZA 5HE2A 3HW2B 1XX0A 1V5UA 2L2IA 1X86A 2D2QA 2OQBA 2DLWA 3GYOA 1U2BA 1WJ1A 2RSGA 1WGUA 3P7ZA 3X23A 4HAVB 1DDMA 3D8EA 1H4RA 2DA0A 2YS5A 3BJIA 2CY5A 4H8SA 4GZUA 3QWMA 2CY4A 4GMVA 5FI1A 4K17A 1RRPB 3ML4A 3KZ1A 4HAUB 4HDOA 4DBBA 3A8QA 3MDBC 1ZM0A 2MFQA 2OTXA 5GOWB 4C0AA 5CLQB 2DTCA 3ODOA 4WJ7A 5JLJB 1OQNA 2RLOA 4ZRKA 2ADZA 3AJ4A 4B6HA 1P3RA 2DHIA 4EMOA 2H7EA 3WYFB 3SO6A 1BTNA 4DX90 3TW1A 2JP2A 2YF0A 2LKOA 5D3XA 2MDXA 2UZRA 2COAA 1W1GA 3PVUA 5HE1A 1X1FA 5EFXA 2QKMA 1MK9B 4YONA 3BINA 2CODA 2LULA 1Z87A 2M14A 4K81A 2D9XA 1AQCA 4YL8A 1ZC3B 3ODWA 5D27A 1MPHA 5HE3A 3GYPA 2EMTA 4HHVA 2R09A 1QC6A 4TYZA 1TXDA 1EF1A 3SV1A 3CIKA 3QIJA 3LJUX 1Y5OA 1TJ6A 1QQGA 2COFA 2X18A 3SNHA 3ODXA 5D3WA 2KCJA 1U29A 1BAKA 4F7GA 2I1KA 2ROVA 1NTYA 1BTKA 1FGZA 2LYDA 2AEHA 1FAOA 4KHAA 2I5FA 5C6RA 2YSZA 2P0FA 4HAYB 1DDVA 2DHKA 3OANA 1MIXA 1FHOA 2DYQA 4TKNA 2I5CA 5LONB 5J3QA 2W2XC 2COCA 1UEFA 2IFSA 3PG7A 2ZPYA 1J19A 1PMSA 1NI2A 2D4QA 2DFKA 2PZ1A 2IYBA 2N0YA 5C79A 2EJ8A 4HDQA 1DDWA 2VRWB 2HTHB 4K2OA 1OMWA 5J3TA 3ZVRA 4A6FB 1P5TA 4GXBA 3UZTA 1UPQA 2CRFA 2Y7BA 5C5BA 3PZDA 4HB3B 3PEGA 2KGXB 5DHFB 2Q13A 3TO1A 1WI1A 2Y8FA 3RCPA 1I2HA 3KRWA 2FJLA 1ZSQA 3DXEA 2V76A 2I1JA 1MKEA 1FHWA 2LOXA 3AU4A 4KAXB 1AWEA 3T06A 2MWNB 1WVHA 2DX1A 1N3HA 3FEHA 4EJNA 1GG3A 4IAPA 1X11A 1FHXA 3D8DA 2QKLA 4GMXB 1V88A 2XQNM 1LW3A 1UNPA 4A5KA 2YS3A 1MIZB 5JP4A 2LG1A 3ULCA 4BBKA 4GPTB 2DN6A 3U8ZA 3HQCA 3IVFA 1U5EA 3PVLA 3MPXA 1U5FA 4PQ0A 1V61A 1V5PA 1GC7A 2ELAA 1PLSA 2DKPA 1XODA 4WVFB 2CAYA 4ZRJA 4HAZB 4HAXB 1B55A 1XCGA 3HK0A 2YRYA 2D9YA 1H10A 2Z0QA 2P8VA 3A8PA 1EVHA 1SHCA 3TVVA 1DROA 2Y8GA 3V5WA 3VIAA 3KRXA 1DYNA 5J3YA 5L81A 4HAWB 1J0WA 4NSWA 4K2PA 2UZSA 2YT0A 5D3YA 5C16A 2YT1A 5CLLB 3PVWA 2VSZA 5DH9B 4Z2MB 2HE7A 3AU5A 2D9VA 2ELBA 2VKIA 2E2XA 2ROZB 4A6HA 4HB0B 2G35A 2AL6A 4Y94A 4CHJA 1WJMA 1LB1A 4KVGB 1UNQA 1GC6A 2L1CA 2GCJA 1W1DA 1RJ2A 5HE0A 5LOPB 1U5DA 3FSSA 2NMBA 2P0HA 1U27A 3DXCA 1IRSA 5DIFB 1PFJA 2K2UA 3G9WA 1UPRA 4MK0A 4NY0A 4EKUA 4HB4B 1X05A 5DI9B 4ZRIA 2W2XD 1BWNA 1FB8A 5JHHA 1M7EA 2UVMA 1K5GB 2W2WA 2EC1A 3N7CA 4DXAB 3QBVB 1ISNA 1XD4A 2DX5A 2KUPA 1V89A 3D8FA 1KZ7A 3VOQA 3ULBA 2Z0PA 4WSFA 2K00A 2RUKB 3KSYA 1FGYA 1NU2A 4L6EA 1FOEA 4A6FA 1P6SA 2D9WA 1OY2A 2BCJA 4GN1A 1SGHA 5KCVA 4MT7A 3TFMA 1X1GA 2RGNB 4HATB 3O96A 1M7RA 1Y19B 1UNRA 4A6KA 3SYXA 1U5GA 2GJYA 5KQ1A 4Z2NA 1DBHA 4IOYX 2D9ZA 3DXDA 3WA0A 5JHGA 3PP2A 1MK7B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D10 A;  1MAI A;  1XKE A;  4KHB B;  2GCL A;  2P0D A;  2Z0O A;  3KY9 A;  3NSU A;  1XR0 B;  4PNK A;  2YS1 A;  1I7A A;  2M38 A;  4MY6 A;  1KZG A;  4D0N B;  3PSC A;  2J0K A;  1WGQ A;  2J0M A;  2NZ8 B;  3CXB B;  3F0W A;  2EMS A;  1Q67 A;  1EGX A;  1V5M A;  1KI1 B;  2J59 M;  1ZVR A;  2LOZ A;  5FI0 A;  4F7U P;  4F7H A;  1E5W A;  4DX8 A;  2GS0 A;  2RVB B;  4CYE A;  2RNR B;  3P6A A;  1WG7 A;  3U7D A;  2DYN A;  3TCA A;  5DHA B;  3F5R A;  1TQZ A;  4KHO A;  2J0J A;  1K5D B;  2R0D A;  3M1I B;  1ZC4 B;  3A98 B;  1W1H A;  3ZDT A;  4XWX A;  1EAZ A;  1NTV A;  3FM8 C;  4CHM A;  5C5B B;  2H7D A;  4IFS A;  4HB2 B;  5KQ4 A;  2D11 A;  5D3V A;  2DHJ A;  2DKQ A;  2YVC A;  2MKR A;  2K2J A;  2N23 A;  4P7I A;  3SUZ A;  5HE2 A;  3HW2 B;  1XX0 A;  1V5U A;  2L2I A;  1X86 A;  2D2Q A;  2OQB A;  2DLW A;  3GYO A;  1U2B A;  1WJ1 A;  2RSG A;  1WGU A;  3P7Z A;  3X23 A;  4HAV B;  1DDM A;  3D8E A;  1H4R A;  2DA0 A;  2YS5 A;  3BJI A;  2CY5 A;  4H8S A;  4GZU A;  3QWM A;  2CY4 A;  4GMV A;  5FI1 A;  4K17 A;  1RRP B;  3ML4 A;  3KZ1 A;  4HAU B;  4HDO A;  4DBB A;  3A8Q A;  3MDB C;  1ZM0 A;  2MFQ A;  2OTX A;  5GOW B;  4C0A A;  5CLQ B;  2DTC A;  3ODO A;  4WJ7 A;  5JLJ B;  1OQN A;  2RLO A;  4ZRK A;  2ADZ A;  3AJ4 A;  4B6H A;  1P3R A;  2DHI A;  4EMO A;  2H7E A;  3WYF B;  3SO6 A;  1BTN A;  4DX9 0;  3TW1 A;  2JP2 A;  2YF0 A;  2LKO A;  5D3X A;  2MDX A;  2UZR A;  2COA A;  1W1G A;  3PVU A;  5HE1 A;  1X1F A;  5EFX A;  2QKM A;  1MK9 B;  4YON A;  3BIN A;  2COD A;  2LUL A;  1Z87 A;  2M14 A;  4K81 A;  2D9X A;  1AQC A;  4YL8 A;  1ZC3 B;  3ODW A;  5D27 A;  1MPH A;  5HE3 A;  3GYP A;  2EMT A;  4HHV A;  2R09 A;  1QC6 A;  4TYZ A;  1TXD A;  1EF1 A;  3SV1 A;  3CIK A;  3QIJ A;  3LJU X;  1Y5O A;  1TJ6 A;  1QQG A;  2COF A;  2X18 A;  3SNH A;  3ODX A;  5D3W A;  2KCJ A;  1U29 A;  1BAK A;  4F7G A;  2I1K A;  2ROV A;  1NTY A;  1BTK A;  1FGZ A;  2LYD A;  2AEH A;  1FAO A;  4KHA A;  2I5F A;  5C6R A;  2YSZ A;  2P0F A;  4HAY B;  1DDV A;  2DHK A;  3OAN A;  1MIX A;  1FHO A;  2DYQ A;  4TKN A;  2I5C A;  5LON B;  5J3Q A;  2W2X C;  2COC A;  1UEF A;  2IFS A;  3PG7 A;  2ZPY A;  1J19 A;  1PMS A;  1NI2 A;  2D4Q A;  2DFK A;  2PZ1 A;  2IYB A;  2N0Y A;  5C79 A;  2EJ8 A;  4HDQ A;  1DDW A;  2VRW B;  2HTH B;  4K2O A;  1OMW A;  5J3T A;  3ZVR A;  4A6F B;  1P5T A;  4GXB A;  3UZT A;  1UPQ A;  2CRF A;  2Y7B A;  5C5B A;  3PZD A;  4HB3 B;  3PEG A;  2KGX B;  5DHF B;  2Q13 A;  3TO1 A;  1WI1 A;  2Y8F A;  3RCP A;  1I2H A;  3KRW A;  2FJL A;  1ZSQ A;  3DXE A;  2V76 A;  2I1J A;  1MKE A;  1FHW A;  2LOX A;  3AU4 A;  4KAX B;  1AWE A;  3T06 A;  2MWN B;  1WVH A;  2DX1 A;  1N3H A;  3FEH A;  4EJN A;  1GG3 A;  4IAP A;  1X11 A;  1FHX A;  3D8D A;  2QKL A;  4GMX B;  1V88 A;  2XQN M;  1LW3 A;  1UNP A;  4A5K A;  2YS3 A;  1MIZ B;  5JP4 A;  2LG1 A;  3ULC A;  4BBK A;  4GPT B;  2DN6 A;  3U8Z A;  3HQC A;  3IVF A;  1U5E A;  3PVL A;  3MPX A;  1U5F A;  4PQ0 A;  1V61 A;  1V5P A;  1GC7 A;  2ELA A;  1PLS A;  2DKP A;  1XOD A;  4WVF B;  2CAY A;  4ZRJ A;  4HAZ B;  4HAX B;  1B55 A;  1XCG A;  3HK0 A;  2YRY A;  2D9Y A;  1H10 A;  2Z0Q A;  2P8V A;  3A8P A;  1EVH A;  1SHC A;  3TVV A;  1DRO A;  2Y8G A;  3V5W A;  3VIA A;  3KRX A;  1DYN A;  5J3Y A;  5L81 A;  4HAW B;  1J0W A;  4NSW A;  4K2P A;  2UZS A;  2YT0 A;  5D3Y A;  5C16 A;  2YT1 A;  5CLL B;  3PVW A;  2VSZ A;  5DH9 B;  4Z2M B;  2HE7 A;  3AU5 A;  2D9V A;  2ELB A;  2VKI A;  2E2X A;  2ROZ B;  4A6H A;  4HB0 B;  2G35 A;  2AL6 A;  4Y94 A;  4CHJ A;  1WJM A;  1LB1 A;  4KVG B;  1UNQ A;  1GC6 A;  2L1C A;  2GCJ A;  1W1D A;  1RJ2 A;  5HE0 A;  5LOP B;  1U5D A;  3FSS A;  2NMB A;  2P0H A;  1U27 A;  3DXC A;  1IRS A;  5DIF B;  1PFJ A;  2K2U A;  3G9W A;  1UPR A;  4MK0 A;  4NY0 A;  4EKU A;  4HB4 B;  1X05 A;  5DI9 B;  4ZRI A;  2W2X D;  1BWN A;  1FB8 A;  5JHH A;  1M7E A;  2UVM A;  1K5G B;  2W2W A;  2EC1 A;  3N7C A;  4DXA B;  3QBV B;  1ISN A;  1XD4 A;  2DX5 A;  2KUP A;  1V89 A;  3D8F A;  1KZ7 A;  3VOQ A;  3ULB A;  2Z0P A;  4WSF A;  2K00 A;  2RUK B;  3KSY A;  1FGY A;  1NU2 A;  4L6E A;  1FOE A;  4A6F A;  1P6S A;  2D9W A;  1OY2 A;  2BCJ A;  4GN1 A;  1SGH A;  5KCV A;  4MT7 A;  3TFM A;  1X1G A;  2RGN B;  4HAT B;  3O96 A;  1M7R A;  1Y19 B;  1UNR A;  4A6K A;  3SYX A;  1U5G A;  2GJY A;  5KQ1 A;  4Z2N A;  1DBH A;  4IOY X;  2D9Z A;  3DXD A;  3WA0 A;  5JHG A;  3PP2 A;  1MK7 B; 
#chains in the Genus database with same CATH topology
 2D10 A;  1MAI A;  1XKE A;  2Z59 A;  4KHB B;  2GCL A;  2P0D A;  2Z0O A;  3KY9 A;  3NSU A;  1XR0 B;  4PNK A;  2YS1 A;  1I7A A;  2M38 A;  4MY6 A;  1KZG A;  4D0N B;  3PSC A;  2J0K A;  1WGQ A;  2J0M A;  3NWF A;  2NZ8 B;  3CXB B;  3F0W A;  2Z14 A;  2EMS A;  1Q67 A;  1EGX A;  1V5M A;  1KI1 B;  2J59 M;  1ZVR A;  2LOZ A;  5FI0 A;  4F7U P;  4F7H A;  1E5W A;  4DX8 A;  2GS0 A;  2RVB B;  4CYE A;  2RNR B;  3P6A A;  1WG7 A;  3U7D A;  2DYN A;  3TCA A;  5DHA B;  3F5R A;  2KIE A;  1TQZ A;  4KHO A;  2J0J A;  1K5D B;  2R0D A;  3M1I B;  1ZC4 B;  3A98 B;  1W1H A;  3ZDT A;  4XWX A;  1EAZ A;  1NTV A;  3FM8 C;  4CHM A;  5C5B B;  2H7D A;  4IFS A;  4HB2 B;  5I2S A;  5KQ4 A;  2D11 A;  5D3V A;  2DHJ A;  2DKQ A;  2YVC A;  2MKR A;  2K2J A;  2N23 A;  2RRF A;  4P7I A;  3SUZ A;  5HE2 A;  3HW2 B;  4QJ4 B;  1XX0 A;  1V5U A;  2L2I A;  1X86 A;  2D2Q A;  2OQB A;  2DLW A;  3GYO A;  1U2B A;  1WJ1 A;  2RSG A;  1WGU A;  3P7Z A;  3X23 A;  4HAV B;  1DDM A;  3D8E A;  1H4R A;  2DA0 A;  2YS5 A;  3BJI A;  2CY5 A;  4H8S A;  4GZU A;  3QWM A;  2CY4 A;  4GMV A;  5FI1 A;  4K17 A;  1RRP B;  3ML4 A;  3KZ1 A;  4HAU B;  4HDO A;  4DBB A;  3A8Q A;  3MDB C;  1ZM0 A;  2MFQ A;  2OTX A;  5GOW B;  4C0A A;  5CLQ B;  2DTC A;  3ODO A;  3OHM B;  3NWD A;  4WJ7 A;  5JLJ B;  1OQN A;  2RLO A;  4ZRK A;  2ADZ A;  3AJ4 A;  2Z4D A;  4B6H A;  1P3R A;  2DHI A;  5I2M A;  2KUQ A;  2H7E A;  3WYF B;  3SO6 A;  4EMO A;  1BTN A;  4DX9 0;  3TW1 A;  2JP2 A;  2YF0 A;  2LKO A;  5D3X A;  2MDX A;  2UZR A;  2COA A;  1W1G A;  3PVU A;  5HE1 A;  1X1F A;  5EFX A;  2QKM A;  1MK9 B;  4YON A;  3BIN A;  1MI1 A;  2COD A;  2LUL A;  1Z87 A;  2M14 A;  4K81 A;  2D9X A;  1AQC A;  4YL8 A;  1ZC3 B;  3ODW A;  5D27 A;  1MPH A;  5HE3 A;  3GYP A;  2EMT A;  4HHV A;  2R09 A;  1QC6 A;  4TYZ A;  1TXD A;  2K49 A;  1EF1 A;  3SV1 A;  2NBV A;  3CIK A;  2KIG A;  3QIJ A;  3LJU X;  1Y5O A;  1TJ6 A;  1QQG A;  2COF A;  2X18 A;  3SNH A;  3ODX A;  5D3W A;  2KCJ A;  1U29 A;  1BAK A;  4QXA B;  4F7G A;  2I1K A;  2ROV A;  1NTY A;  1BTK A;  4KHB A;  1FGZ A;  2LYD A;  2AEH A;  1FAO A;  4KHA A;  2I5F A;  5C6R A;  2YSZ A;  2P0F A;  4HAY B;  4L1R A;  1DDV A;  2DHK A;  3OAN A;  1MIX A;  1FHO A;  2DYQ A;  4TKN A;  2I5C A;  5LON B;  2KR0 A;  5J3Q A;  2W2X C;  2COC A;  1UEF A;  2IFS A;  3PG7 A;  2ZPY A;  1J19 A;  5M4Y B;  1PMS A;  1NI2 A;  3DCX A;  2D4Q A;  2DFK A;  2PZ1 A;  2IYB A;  2Z13 A;  2N0Y A;  5C79 A;  2EJ8 A;  4HDQ A;  1DDW A;  2VRW B;  2HTH B;  4K2O A;  1OMW A;  5LG4 B;  5J3T A;  3ZVR A;  4A6F B;  2R2Y A;  1P5T A;  4GXB A;  4D6W A;  3UZT A;  1UPQ A;  2CRF A;  2Y7B A;  5C5B A;  3PZD A;  4HB3 B;  3PEG A;  2KGX B;  5DHF B;  2Q13 A;  2YT2 A;  3TO1 A;  1WI1 A;  2Y8F A;  3RCP A;  1I2H A;  3KRW A;  2FJL A;  1ZSQ A;  3DXE A;  2V76 A;  2I1J A;  1MKE A;  1FHW A;  2LOX A;  3AU4 A;  4KAX B;  1AWE A;  1ZYI A;  3T06 A;  2MWN B;  1WVH A;  2DX1 A;  4CSQ A;  2K8E A;  1N3H A;  3FEH A;  4EJN A;  1GG3 A;  4IAP A;  1X11 A;  1FHX A;  3D8D A;  2QKL A;  4GMX B;  1V88 A;  2XQN M;  1LW3 A;  1UNP A;  4A5K A;  2YS3 A;  3NWA A;  1MIZ B;  5JP4 A;  2LG1 A;  3ULC A;  4BBK A;  4GPT B;  2DN6 A;  3U8Z A;  3HQC A;  3IVF A;  1U5E A;  3PVL A;  3MPX A;  1U5F A;  4PQ0 A;  1V61 A;  1V5P A;  1GC7 A;  2ELA A;  1PLS A;  2DKP A;  1XOD A;  4WVF B;  2CAY A;  4ZRJ A;  2GUM A;  4HAZ B;  4HAX B;  1B55 A;  1XCG A;  2ZKM X;  3HK0 A;  2YRY A;  2D9Y A;  1H10 A;  2Z0Q A;  2P8V A;  3A8P A;  1EVH A;  1SHC A;  2FJU B;  3TVV A;  1DRO A;  2Y8G A;  3V5W A;  1T77 A;  3VIA A;  3KRX A;  1DYN A;  5J3Y A;  5L81 A;  4HAW B;  1J0W A;  4NSW A;  4K2P A;  4OT1 A;  2UZS A;  2YT0 A;  5D3Y A;  5C16 A;  2YT1 A;  5CLL B;  3PVW A;  2VSZ A;  5DH9 B;  4Z2M B;  2HE7 A;  4HSI A;  3AU5 A;  2D9V A;  2ELB A;  2VKI A;  2E2X A;  2ROZ B;  4A6H A;  4HB0 B;  2G35 A;  2AL6 A;  4Y94 A;  4CHJ A;  1WJM A;  1LB1 A;  4KVG B;  1UNQ A;  3HSA A;  1GC6 A;  2L1C A;  2GCJ A;  1W1D A;  1RJ2 A;  4QJ3 B;  5HE0 A;  5LOP B;  3B77 A;  1U5D A;  3FSS A;  2NMB A;  2P0H A;  1U27 A;  3DXC A;  1IRS A;  3NW8 A;  5DIF B;  1PFJ A;  2K2U A;  3FVC A;  3G9W A;  1UPR A;  4MK0 A;  4NY0 A;  4EKU A;  4HB4 B;  1X05 A;  5DI9 B;  4ZRI A;  2W2X D;  1BWN A;  1FB8 A;  5JHH A;  1M7E A;  2UVM A;  1K5G B;  2W2W A;  2EC1 A;  3N7C A;  4GOU A;  4DXA B;  3QBV B;  4OSN A;  1ISN A;  4QJ5 B;  1XD4 A;  2DX5 A;  2KUP A;  1V89 A;  3D8F A;  1KZ7 A;  3VOQ A;  3ULB A;  2Z0P A;  4WSF A;  2K00 A;  2RUK B;  3KSY A;  1FGY A;  1NU2 A;  4L6E A;  4GNK B;  4DIX A;  1FOE A;  3HIE A;  4A6F A;  1P6S A;  2D9W A;  1OY2 A;  2BCJ A;  4GN1 A;  1SGH A;  5KCV A;  4MT7 A;  3TFM A;  1X1G A;  2RGN B;  4HAT B;  5IRS A;  3O96 A;  1M7R A;  1Y19 B;  1UNR A;  4A6K A;  3SYX A;  1U5G A;  3U12 A;  2GJY A;  5KQ1 A;  3A58 A;  4Z2N A;  1DBH A;  4IOY X;  2D9Z A;  3DXD A;  3WA0 A;  5JHG A;  3PP2 A;  1MK7 B; 
#chains in the Genus database with same CATH homology
 2D10 A;  1MAI A;  1XKE A;  4KHB B;  2GCL A;  2P0D A;  2Z0O A;  3KY9 A;  3NSU A;  1XR0 B;  4PNK A;  2YS1 A;  1I7A A;  2M38 A;  4MY6 A;  1KZG A;  4D0N B;  3PSC A;  2J0K A;  1WGQ A;  2J0M A;  2NZ8 B;  3CXB B;  3F0W A;  2EMS A;  1Q67 A;  1EGX A;  1V5M A;  1KI1 B;  2J59 M;  1ZVR A;  2LOZ A;  5FI0 A;  4F7U P;  4F7H A;  1E5W A;  4DX8 A;  2GS0 A;  2RVB B;  4CYE A;  2RNR B;  3P6A A;  1WG7 A;  3U7D A;  2DYN A;  3TCA A;  5DHA B;  3F5R A;  1TQZ A;  4KHO A;  2J0J A;  1K5D B;  2R0D A;  3M1I B;  1ZC4 B;  3A98 B;  1W1H A;  3ZDT A;  4XWX A;  1EAZ A;  1NTV A;  3FM8 C;  4CHM A;  5C5B B;  2H7D A;  4IFS A;  4HB2 B;  5KQ4 A;  2D11 A;  5D3V A;  2DHJ A;  2DKQ A;  2YVC A;  2MKR A;  2K2J A;  2N23 A;  4P7I A;  3SUZ A;  5HE2 A;  3HW2 B;  1XX0 A;  1V5U A;  2L2I A;  1X86 A;  2D2Q A;  2OQB A;  2DLW A;  3GYO A;  1U2B A;  1WJ1 A;  2RSG A;  1WGU A;  3P7Z A;  3X23 A;  4HAV B;  1DDM A;  3D8E A;  1H4R A;  2DA0 A;  2YS5 A;  3BJI A;  2CY5 A;  4H8S A;  4GZU A;  3QWM A;  2CY4 A;  4GMV A;  5FI1 A;  4K17 A;  1RRP B;  3ML4 A;  3KZ1 A;  4HAU B;  4HDO A;  4DBB A;  3A8Q A;  3MDB C;  1ZM0 A;  2MFQ A;  2OTX A;  5GOW B;  4C0A A;  5CLQ B;  2DTC A;  3ODO A;  4WJ7 A;  5JLJ B;  1OQN A;  2RLO A;  4ZRK A;  2ADZ A;  3AJ4 A;  4B6H A;  1P3R A;  2DHI A;  4EMO A;  2H7E A;  3WYF B;  3SO6 A;  1BTN A;  4DX9 0;  3TW1 A;  2JP2 A;  2YF0 A;  2LKO A;  5D3X A;  2MDX A;  2UZR A;  2COA A;  1W1G A;  3PVU A;  5HE1 A;  1X1F A;  5EFX A;  2QKM A;  1MK9 B;  4YON A;  3BIN A;  2COD A;  2LUL A;  1Z87 A;  2M14 A;  4K81 A;  2D9X A;  1AQC A;  4YL8 A;  1ZC3 B;  3ODW A;  5D27 A;  1MPH A;  5HE3 A;  3GYP A;  2EMT A;  4HHV A;  2R09 A;  1QC6 A;  4TYZ A;  1TXD A;  1EF1 A;  3SV1 A;  3CIK A;  3QIJ A;  3LJU X;  1Y5O A;  1TJ6 A;  1QQG A;  2COF A;  2X18 A;  3SNH A;  3ODX A;  5D3W A;  2KCJ A;  1U29 A;  1BAK A;  4F7G A;  2I1K A;  2ROV A;  1NTY A;  1BTK A;  1FGZ A;  2LYD A;  2AEH A;  1FAO A;  4KHA A;  2I5F A;  5C6R A;  2YSZ A;  2P0F A;  4HAY B;  1DDV A;  2DHK A;  3OAN A;  1MIX A;  1FHO A;  2DYQ A;  4TKN A;  2I5C A;  5LON B;  5J3Q A;  2W2X C;  2COC A;  1UEF A;  2IFS A;  3PG7 A;  2ZPY A;  1J19 A;  1PMS A;  1NI2 A;  2D4Q A;  2DFK A;  2PZ1 A;  2IYB A;  2N0Y A;  5C79 A;  2EJ8 A;  4HDQ A;  1DDW A;  2VRW B;  2HTH B;  4K2O A;  1OMW A;  5J3T A;  3ZVR A;  4A6F B;  1P5T A;  4GXB A;  3UZT A;  1UPQ A;  2CRF A;  2Y7B A;  5C5B A;  3PZD A;  4HB3 B;  3PEG A;  2KGX B;  5DHF B;  2Q13 A;  3TO1 A;  1WI1 A;  2Y8F A;  3RCP A;  1I2H A;  3KRW A;  2FJL A;  1ZSQ A;  3DXE A;  2V76 A;  2I1J A;  1MKE A;  1FHW A;  2LOX A;  3AU4 A;  4KAX B;  1AWE A;  3T06 A;  2MWN B;  1WVH A;  2DX1 A;  1N3H A;  3FEH A;  4EJN A;  1GG3 A;  4IAP A;  1X11 A;  1FHX A;  3D8D A;  2QKL A;  4GMX B;  1V88 A;  2XQN M;  1LW3 A;  1UNP A;  4A5K A;  2YS3 A;  1MIZ B;  5JP4 A;  2LG1 A;  3ULC A;  4BBK A;  4GPT B;  2DN6 A;  3U8Z A;  3HQC A;  3IVF A;  1U5E A;  3PVL A;  3MPX A;  1U5F A;  4PQ0 A;  1V61 A;  1V5P A;  1GC7 A;  2ELA A;  1PLS A;  2DKP A;  1XOD A;  4WVF B;  2CAY A;  4ZRJ A;  4HAZ B;  4HAX B;  1B55 A;  1XCG A;  3HK0 A;  2YRY A;  2D9Y A;  1H10 A;  2Z0Q A;  2P8V A;  3A8P A;  1EVH A;  1SHC A;  3TVV A;  1DRO A;  2Y8G A;  3V5W A;  3VIA A;  3KRX A;  1DYN A;  5J3Y A;  5L81 A;  4HAW B;  1J0W A;  4NSW A;  4K2P A;  2UZS A;  2YT0 A;  5D3Y A;  5C16 A;  2YT1 A;  5CLL B;  3PVW A;  2VSZ A;  5DH9 B;  4Z2M B;  2HE7 A;  3AU5 A;  2D9V A;  2ELB A;  2VKI A;  2E2X A;  2ROZ B;  4A6H A;  4HB0 B;  2G35 A;  2AL6 A;  4Y94 A;  4CHJ A;  1WJM A;  1LB1 A;  4KVG B;  1UNQ A;  1GC6 A;  2L1C A;  2GCJ A;  1W1D A;  1RJ2 A;  5HE0 A;  5LOP B;  1U5D A;  3FSS A;  2NMB A;  2P0H A;  1U27 A;  3DXC A;  1IRS A;  5DIF B;  1PFJ A;  2K2U A;  3G9W A;  1UPR A;  4MK0 A;  4NY0 A;  4EKU A;  4HB4 B;  1X05 A;  5DI9 B;  4ZRI A;  2W2X D;  1BWN A;  1FB8 A;  5JHH A;  1M7E A;  2UVM A;  1K5G B;  2W2W A;  2EC1 A;  3N7C A;  4DXA B;  3QBV B;  1ISN A;  1XD4 A;  2DX5 A;  2KUP A;  1V89 A;  3D8F A;  1KZ7 A;  3VOQ A;  3ULB A;  2Z0P A;  4WSF A;  2K00 A;  2RUK B;  3KSY A;  1FGY A;  1NU2 A;  4L6E A;  1FOE A;  4A6F A;  1P6S A;  2D9W A;  1OY2 A;  2BCJ A;  4GN1 A;  1SGH A;  5KCV A;  4MT7 A;  3TFM A;  1X1G A;  2RGN B;  4HAT B;  3O96 A;  1M7R A;  1Y19 B;  1UNR A;  4A6K A;  3SYX A;  1U5G A;  2GJY A;  5KQ1 A;  4Z2N A;  1DBH A;  4IOY X;  2D9Z A;  3DXD A;  3WA0 A;  5JHG A;  3PP2 A;  1MK7 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...