2P0DA

Arhgap9 ph domain in complex with ins(1,4,5)p3
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
121
structure length
107
Chain Sequence
SHEVEKSGLLNMTKIAQGGRKLRKNWGPSWVVLTGNSLVFYREPRPESSVDLRGAALAHGRHLSSRRNVLHIRTIPGHEFLLQSDHETELRAWHRALRTVIERLVRW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Rho GTPase-activating protein 9
publication title Non-canonical Interaction of Phosphoinositides with Pleckstrin Homology Domains of Tiam1 and ArhGAP9.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligand binding protein
total genus 26
structure length 107
sequence length 121
ec nomenclature
pdb deposition date 2007-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2p0dA00
3VIAA 2YVCA 1FHOA 2QKLA 5D3XA 5EFXA 3WA0A 4KHAA 2ELAA 3D8EA 2RUKB 1XCGA 1KZGA 2J0KA 4HB0B 2D9WA 2DHIA 5C16A 1E5WA 1XKEA 2M14A 2CAYA 4DX8A 3WYFB 3U8ZA 3BJIA 3DXEA 3ODOA 1J0WA 3PVLA 3KSYA 3TO1A 2YS1A 1EVHA 1H10A 2J59M 3AU5A 3TVVA 2UZRA 1Y5OA 3IVFA 3GYOA 1XODA 1WG7A 2IFSA 1FHXA 4A6HA 2EMTA 1SGHA 2KCJA 1B55A 4HDQA 2OTXA 1GC7A 2EJ8A 2I1JA 3HQCA 4GMVA 1W1GA 2R09A 2LG1A 2LULA 1X1FA 3SV1A 5JP4A 2D11A 5DHFB 2XQNM 4HATB 4WJ7A 3RCPA 2DN6A 2UVMA 4PNKA 1UNRA 3HW2B 2RVBB 2YSZA 1RJ2A 2DYQA 1DDMA 3AJ4A 1DBHA 1PLSA 2ELBA 1U2BA 3PZDA 3O96A 1LW3A 2RSGA 2I5CA 2D9YA 3G9WA 1BWNA 1P6SA 2AEHA 5JHHA 5D27A 1U29A 2MFQA 5JHGA 2GS0A 2QKMA 1NTVA 2E2XA 4YONA 1WI1A 1NTYA 5D3YA 1IRSA 3TCAA 5CLLB 1I2HA 2CY4A 2H7DA 5D3VA 1M7RA 2HE7A 3F0WA 3ZVRA 3OANA 2YF0A 5J3YA 3U7DA 3A98B 3F5RA 2YT0A 3KZ1A 4D0NB 1ZC3B 5DHAB 1XR0B 1EF1A 2CY5A 4KVGB 1MAIA 4PQ0A 2ZPYA 3QWMA 1SHCA 2H7EA 3QIJA 1Y19B 5DH9B 3TFMA 2COFA 2DYNA 2CODA 2D4QA 1J19A 1P3RA 2L2IA 3A8PA 2VRWB 1I7AA 1OY2A 2RNRB 3V5WA 3LJUX 3PVUA 1Q67A 1U5FA 3MDBC 2W2WA 2MKRA 4KHBB 1DDWA 4WVFB 1TQZA 1W1DA 4L6EA 3N7CA 1U5GA 1MIXA 4HAXB 4HDOA 4C0AA 2L1CA 1X05A 1U27A 2DHKA 3KY9A 2Q13A 1KZ7A 2COAA 2VKIA 2ROZB 2J0MA 4ZRIA 4GZUA 2IYBA 4BBKA 3TW1A 1H4RA 2J0JA 1BTNA 2R0DA 2ROVA 1UNQA 1W1HA 4EJNA 2RLOA 4IFSA 4Z2MB 1WVHA 4DXAB 5HE0A 1V5MA 1MK7B 4MK0A 4GXBA 1P5TA 2N0YA 5HE3A 1FB8A 1V89A 1TJ6A 3D8DA 1WJMA 1ZC4B 4YL8A 3PP2A 4A6FA 1FAOA 1MPHA 3ULBA 3PVWA 1U5EA 4ZRJA 2PZ1A 3ODWA 1UNPA 2RGNB 2V76A 4HB2B 1UPRA 1NI2A 3HK0A 2P0FA 1MKEA 2DA0A 3PG7A 1BAKA 3P6AA 1XX0A 4CYEA 2YT1A 2CRFA 2GCLA 2W2XD 3PSCA 4H8SA 3QBVB 4XWXA 2Z0QA 1XD4A 3DXDA 4GPTB 4HHVA 5LOPB 2N23A 2EMSA 2K2JA 5KQ4A 4HAUB 5FI0A 1OQNA 2LOZA 2DFKA 2G35A 5J3QA 4MY6A 4NSWA 1QQGA 1U5DA 2OQBA 5J3TA 1V88A 4EMOA 3FM8C 3VOQA 4P7IA 4HB4B 1TXDA 2GJYA 2LOXA 4IAPA 2Y8GA 4HAVB 1UEFA 4F7UP 2MWNB 4K2PA 1QC6A 1N3HA 1MK9B 1K5DB 4TKNA 5HE2A 4DBBA 1OMWA 2Y8FA 2W2XC 3ODXA 1WJ1A 1PMSA 1DYNA 3SO6A 2BCJA 2D2QA 2NZ8B 1FOEA 1EAZA 3T06A 2K00A 5C79A 2D9ZA 2GCJA 1FHWA 3UZTA 1X86A 2JP2A 3AU4A 2DX1A 2UZSA 3ML4A 4K17A 3ULCA 4CHMA 4KAXB 2VSZA 1V5PA 1X1GA 3SYXA 4F7HA 1V61A 4CHJA 5GOWB 1RRPB 5DIFB 5L81A 1BTKA 3D8FA 1V5UA 2K2UA 3MPXA 4K81A 3P7ZA 4F7GA 1WGQA 2I1KA 2DKQA 3FEHA 2NMBA 5KCVA 4HAYB 2DX5A 1ZM0A 2P0HA 1ZSQA 3KRWA 2Z0OA 4WSFA 4KHOA 4B6HA 3DXCA 5D3WA 4Y94A 2DTCA 2M38A 4A6KA 2X18A 4MT7A 1M7EA 4A6FB 1AQCA 2D9VA 1K5GB 3ZDTA 1DDVA 4A5KA 1NU2A 4Z2NA 2KGXB 4DX90 5JLJB 1FGZA 1X11A 1ISNA 2DKPA 2DHJA 3BINA 4GMXB 4IOYX 1MIZB 3KRXA 5HE1A 5C5BA 1DROA 2AL6A 5C5BB 3X23A 5KQ1A 2D10A 4HB3B 2MDXA 2COCA 4TYZA 3SNHA 4EKUA 4NY0A 1GG3A 2KUPA 2YRYA 5C6RA 2P8VA 1UPQA 1PFJA 3A8QA 3GYPA 2EC1A 4HAZB 3FSSA 2YS3A 1KI1B 1Z87A 4GN1A 1WGUA 2ADZA 4ZRKA 5CLQB 2P0DA 3SUZA 4HAWB 1LB1A 3PEGA 3NSUA 2DLWA 2I5FA 1EGXA 2Y7BA 2LKOA 3M1IB 1FGYA 2D9XA 5FI1A 5LONB 1GC6A 1AWEA 2YS5A 2HTHB 5DI9B 3CIKA 1ZVRA 2FJLA 3CXBB 4K2OA 2LYDA 2Z0PA
chains in the Genus database with same CATH superfamily
3VIAA 2YVCA 1FHOA 2QKLA 5D3XA 5EFXA 3WA0A 4KHAA 2ELAA 2Z59A 3D8EA 2RUKB 1XCGA 1KZGA 2J0KA 4HB0B 2D9WA 2DHIA 5C16A 1E5WA 1XKEA 2M14A 2CAYA 4DX8A 3DCXA 3WYFB 4GNKB 3U8ZA 3BJIA 3DXEA 3ODOA 1J0WA 3PVLA 3KSYA 3TO1A 2YS1A 1EVHA 1H10A 2J59M 3AU5A 3TVVA 2UZRA 4GOUA 1Y5OA 3IVFA 3GYOA 1XODA 1WG7A 2IFSA 1FHXA 4A6HA 2EMTA 1SGHA 2KCJA 1B55A 4HDQA 3NWAA 2OTXA 1GC7A 2EJ8A 2I1JA 3HQCA 4GMVA 1W1GA 2R09A 2LG1A 2LULA 1X1FA 3SV1A 5JP4A 3NWDA 2D11A 5DHFB 2XQNM 4HATB 4WJ7A 3RCPA 2DN6A 2UVMA 4PNKA 1UNRA 3HW2B 2RVBB 2YSZA 1RJ2A 2DYQA 1DDMA 3AJ4A 1DBHA 1PLSA 2ELBA 4D6WA 1U2BA 3PZDA 3O96A 2K8EA 1LW3A 2RSGA 2I5CA 2D9YA 3G9WA 1BWNA 1P6SA 2AEHA 5JHHA 5D27A 1U29A 2MFQA 4QJ5B 5JHGA 2GS0A 2QKMA 1NTVA 2E2XA 4YONA 1WI1A 1NTYA 5D3YA 1IRSA 3TCAA 5CLLB 1I2HA 2CY4A 2H7DA 2YT2A 5D3VA 1M7RA 2HE7A 3F0WA 3ZVRA 2FJUB 2RRFA 2YF0A 3OANA 5J3YA 3U7DA 3A98B 1ZYIA 3F5RA 2YT0A 3KZ1A 4D0NB 3NWFA 1ZC3B 5DHAB 1XR0B 1EF1A 2CY5A 4KVGB 1MAIA 4PQ0A 1T77A 2ZPYA 3QWMA 1SHCA 2H7EA 3QIJA 1Y19B 5DH9B 3TFMA 2COFA 2DYNA 2CODA 2D4QA 1J19A 1P3RA 2L2IA 3A8PA 2VRWB 1I7AA 1OY2A 2RNRB 3V5WA 3LJUX 3PVUA 1Q67A 1U5FA 3MDBC 4KHBA 2W2WA 2MKRA 4KHBB 1DDWA 4WVFB 1TQZA 1W1DA 2R2YA 4L6EA 2Z4DA 3N7CA 1U5GA 1MIXA 4HAXB 4HDOA 4C0AA 2L1CA 2KR0A 1X05A 1U27A 2DHKA 3KY9A 2Q13A 3OHMB 1KZ7A 2COAA 2VKIA 2ROZB 2J0MA 4ZRIA 4GZUA 2IYBA 4BBKA 3TW1A 1H4RA 2J0JA 1BTNA 2R0DA 2ROVA 1UNQA 3NW8A 1W1HA 5I2MA 4EJNA 2RLOA 4IFSA 4Z2MB 1WVHA 4QJ3B 4DXAB 5HE0A 1V5MA 1MK7B 4MK0A 4GXBA 4QXAB 1P5TA 2N0YA 5HE3A 1FB8A 1V89A 4CSQA 4DIXA 1TJ6A 3D8DA 1WJMA 4OSNA 1ZC4B 2KIGA 5IRSA 4YL8A 3PP2A 4A6FA 1FAOA 1MPHA 3ULBA 3PVWA 1U5EA 4ZRJA 2PZ1A 3ODWA 1UNPA 2RGNB 3HIEA 2NBVA 2V76A 4HB2B 2Z13A 1UPRA 1NI2A 3HK0A 2P0FA 1MKEA 2DA0A 3PG7A 1BAKA 3P6AA 1XX0A 4CYEA 2YT1A 2CRFA 2GCLA 2W2XD 3PSCA 4H8SA 3QBVB 5LG4B 4XWXA 2Z0QA 1XD4A 3DXDA 4GPTB 4HHVA 5LOPB 2N23A 2EMSA 2K2JA 5KQ4A 3A58A 4HAUB 5FI0A 1OQNA 2LOZA 4OT1A 2DFKA 2G35A 5M4YB 5J3QA 4MY6A 4NSWA 1QQGA 1U5DA 2OQBA 5J3TA 1V88A 3U12A 4EMOA 3FM8C 3VOQA 4P7IA 4HB4B 1TXDA 2GJYA 2LOXA 4IAPA 2Y8GA 4HAVB 1UEFA 4F7UP 2MWNB 4K2PA 1QC6A 1N3HA 1MK9B 1K5DB 4TKNA 5HE2A 4DBBA 1OMWA 2Y8FA 2W2XC 3ODXA 1WJ1A 1PMSA 1DYNA 3SO6A 5I2SA 1MI1A 2BCJA 2D2QA 3B77A 2NZ8B 1FOEA 1EAZA 3T06A 2K00A 5C79A 2D9ZA 2GCJA 1FHWA 3HSAA 3UZTA 1X86A 2JP2A 3AU4A 2DX1A 2UZSA 3ML4A 4K17A 3ULCA 2KUQA 4CHMA 4KAXB 2VSZA 1V5PA 1X1GA 3SYXA 4F7HA 1V61A 4CHJA 5GOWB 1RRPB 5DIFB 5L81A 1BTKA 3D8FA 2ZKMX 1V5UA 2K2UA 3MPXA 4K81A 3P7ZA 4F7GA 1WGQA 2I1KA 2DKQA 3FEHA 2NMBA 5KCVA 4HAYB 2GUMA 2DX5A 1ZM0A 2P0HA 1ZSQA 3KRWA 2Z0OA 4WSFA 4KHOA 4B6HA 3DXCA 5D3WA 4Y94A 2DTCA 2M38A 4A6KA 2X18A 4MT7A 1M7EA 4L1RA 4A6FB 1AQCA 2KIEA 2D9VA 1K5GB 3ZDTA 1DDVA 4A5KA 1NU2A 4Z2NA 2KGXB 4DX90 5JLJB 1FGZA 1X11A 1ISNA 2DKPA 2DHJA 3BINA 4GMXB 4IOYX 1MIZB 3KRXA 5HE1A 4QJ4B 5C5BA 2AL6A 1DROA 5C5BB 3X23A 5KQ1A 2D10A 4HB3B 2MDXA 2COCA 4TYZA 3SNHA 4EKUA 4NY0A 1GG3A 2KUPA 2YRYA 5C6RA 2P8VA 1UPQA 1PFJA 3A8QA 3GYPA 2EC1A 4HAZB 3FVCA 3FSSA 2YS3A 1KI1B 1Z87A 4GN1A 1WGUA 2ADZA 4ZRKA 5CLQB 2P0DA 3SUZA 4HAWB 1LB1A 3PEGA 3NSUA 2DLWA 2I5FA 2K49A 1EGXA 2Y7BA 2LKOA 3M1IB 1FGYA 4HSIA 2D9XA 5FI1A 2Z14A 5LONB 1GC6A 1AWEA 2YS5A 2HTHB 5DI9B 3CIKA 1ZVRA 2FJLA 3CXBB 4K2OA 2LYDA 2Z0PA
chains in the Genus database with same CATH topology
3VIAA 2YVCA 1FHOA 2QKLA 5D3XA 5EFXA 3WA0A 4KHAA 2ELAA 3D8EA 2RUKB 1XCGA 1KZGA 2J0KA 4HB0B 2D9WA 2DHIA 5C16A 1E5WA 1XKEA 2M14A 2CAYA 4DX8A 3WYFB 3U8ZA 3BJIA 3DXEA 3ODOA 1J0WA 3PVLA 3KSYA 3TO1A 2YS1A 1EVHA 1H10A 2J59M 3AU5A 3TVVA 2UZRA 1Y5OA 3IVFA 3GYOA 1XODA 1WG7A 2IFSA 1FHXA 4A6HA 2EMTA 1SGHA 2KCJA 1B55A 4HDQA 2OTXA 1GC7A 2EJ8A 2I1JA 3HQCA 4GMVA 1W1GA 2R09A 2LG1A 2LULA 1X1FA 3SV1A 5JP4A 2D11A 5DHFB 2XQNM 4HATB 4WJ7A 3RCPA 2DN6A 2UVMA 4PNKA 1UNRA 3HW2B 2RVBB 2YSZA 1RJ2A 2DYQA 1DDMA 3AJ4A 1DBHA 1PLSA 2ELBA 1U2BA 3PZDA 3O96A 1LW3A 2RSGA 2I5CA 2D9YA 3G9WA 1BWNA 1P6SA 2AEHA 5JHHA 5D27A 1U29A 2MFQA 5JHGA 2GS0A 2QKMA 1NTVA 2E2XA 4YONA 1WI1A 1NTYA 5D3YA 1IRSA 3TCAA 5CLLB 1I2HA 2CY4A 2H7DA 5D3VA 1M7RA 2HE7A 3F0WA 3ZVRA 3OANA 2YF0A 5J3YA 3U7DA 3A98B 3F5RA 2YT0A 3KZ1A 4D0NB 1ZC3B 5DHAB 1XR0B 1EF1A 2CY5A 4KVGB 1MAIA 4PQ0A 2ZPYA 3QWMA 1SHCA 2H7EA 3QIJA 1Y19B 5DH9B 3TFMA 2COFA 2DYNA 2CODA 2D4QA 1J19A 1P3RA 2L2IA 3A8PA 2VRWB 1I7AA 1OY2A 2RNRB 3V5WA 3LJUX 3PVUA 1Q67A 1U5FA 3MDBC 2W2WA 2MKRA 4KHBB 1DDWA 4WVFB 1TQZA 1W1DA 4L6EA 3N7CA 1U5GA 1MIXA 4HAXB 4HDOA 4C0AA 2L1CA 1X05A 1U27A 2DHKA 3KY9A 2Q13A 1KZ7A 2COAA 2VKIA 2ROZB 2J0MA 4ZRIA 4GZUA 2IYBA 4BBKA 3TW1A 1H4RA 2J0JA 1BTNA 2R0DA 2ROVA 1UNQA 1W1HA 4EJNA 2RLOA 4IFSA 4Z2MB 1WVHA 4DXAB 5HE0A 1V5MA 1MK7B 4MK0A 4GXBA 1P5TA 2N0YA 5HE3A 1FB8A 1V89A 1TJ6A 3D8DA 1WJMA 1ZC4B 4YL8A 3PP2A 4A6FA 1FAOA 1MPHA 3ULBA 3PVWA 1U5EA 4ZRJA 2PZ1A 3ODWA 1UNPA 2RGNB 2V76A 4HB2B 1UPRA 1NI2A 3HK0A 2P0FA 1MKEA 2DA0A 3PG7A 1BAKA 3P6AA 1XX0A 4CYEA 2YT1A 2CRFA 2GCLA 2W2XD 3PSCA 4H8SA 3QBVB 4XWXA 2Z0QA 1XD4A 3DXDA 4GPTB 4HHVA 5LOPB 2N23A 2EMSA 2K2JA 5KQ4A 4HAUB 5FI0A 1OQNA 2LOZA 2DFKA 2G35A 5J3QA 4MY6A 4NSWA 1QQGA 1U5DA 2OQBA 5J3TA 1V88A 4EMOA 3FM8C 3VOQA 4P7IA 4HB4B 1TXDA 2GJYA 2LOXA 4IAPA 2Y8GA 4HAVB 1UEFA 4F7UP 2MWNB 4K2PA 1QC6A 1N3HA 1MK9B 1K5DB 4TKNA 5HE2A 4DBBA 1OMWA 2Y8FA 2W2XC 3ODXA 1WJ1A 1PMSA 1DYNA 3SO6A 2BCJA 2D2QA 2NZ8B 1FOEA 1EAZA 3T06A 2K00A 5C79A 2D9ZA 2GCJA 1FHWA 3UZTA 1X86A 2JP2A 3AU4A 2DX1A 2UZSA 3ML4A 4K17A 3ULCA 4CHMA 4KAXB 2VSZA 1V5PA 1X1GA 3SYXA 4F7HA 1V61A 4CHJA 5GOWB 1RRPB 5DIFB 5L81A 1BTKA 3D8FA 1V5UA 2K2UA 3MPXA 4K81A 3P7ZA 4F7GA 1WGQA 2I1KA 2DKQA 3FEHA 2NMBA 5KCVA 4HAYB 2DX5A 1ZM0A 2P0HA 1ZSQA 3KRWA 2Z0OA 4WSFA 4KHOA 4B6HA 3DXCA 5D3WA 4Y94A 2DTCA 2M38A 4A6KA 2X18A 4MT7A 1M7EA 4A6FB 1AQCA 2D9VA 1K5GB 3ZDTA 1DDVA 4A5KA 1NU2A 4Z2NA 2KGXB 4DX90 5JLJB 1FGZA 1X11A 1ISNA 2DKPA 2DHJA 3BINA 4GMXB 4IOYX 1MIZB 3KRXA 5HE1A 5C5BA 1DROA 2AL6A 5C5BB 3X23A 5KQ1A 2D10A 4HB3B 2MDXA 2COCA 4TYZA 3SNHA 4EKUA 4NY0A 1GG3A 2KUPA 2YRYA 5C6RA 2P8VA 1UPQA 1PFJA 3A8QA 3GYPA 2EC1A 4HAZB 3FSSA 2YS3A 1KI1B 1Z87A 4GN1A 1WGUA 2ADZA 4ZRKA 5CLQB 2P0DA 3SUZA 4HAWB 1LB1A 3PEGA 3NSUA 2DLWA 2I5FA 1EGXA 2Y7BA 2LKOA 3M1IB 1FGYA 2D9XA 5FI1A 5LONB 1GC6A 1AWEA 2YS5A 2HTHB 5DI9B 3CIKA 1ZVRA 2FJLA 3CXBB 4K2OA 2LYDA 2Z0PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VIA A;  2YVC A;  1FHO A;  2QKL A;  5D3X A;  5EFX A;  3WA0 A;  4KHA A;  2ELA A;  3D8E A;  2RUK B;  1XCG A;  1KZG A;  2J0K A;  4HB0 B;  2D9W A;  2DHI A;  5C16 A;  1E5W A;  1XKE A;  2M14 A;  2CAY A;  4DX8 A;  3WYF B;  3U8Z A;  3BJI A;  3DXE A;  3ODO A;  1J0W A;  3PVL A;  3KSY A;  3TO1 A;  2YS1 A;  1EVH A;  1H10 A;  2J59 M;  3AU5 A;  3TVV A;  2UZR A;  1Y5O A;  3IVF A;  3GYO A;  1XOD A;  1WG7 A;  2IFS A;  1FHX A;  4A6H A;  2EMT A;  1SGH A;  2KCJ A;  1B55 A;  4HDQ A;  2OTX A;  1GC7 A;  2EJ8 A;  2I1J A;  3HQC A;  4GMV A;  1W1G A;  2R09 A;  2LG1 A;  2LUL A;  1X1F A;  3SV1 A;  5JP4 A;  2D11 A;  5DHF B;  2XQN M;  4HAT B;  4WJ7 A;  3RCP A;  2DN6 A;  2UVM A;  4PNK A;  1UNR A;  3HW2 B;  2RVB B;  2YSZ A;  1RJ2 A;  2DYQ A;  1DDM A;  3AJ4 A;  1DBH A;  1PLS A;  2ELB A;  1U2B A;  3PZD A;  3O96 A;  1LW3 A;  2RSG A;  2I5C A;  2D9Y A;  3G9W A;  1BWN A;  1P6S A;  2AEH A;  5JHH A;  5D27 A;  1U29 A;  2MFQ A;  5JHG A;  2GS0 A;  2QKM A;  1NTV A;  2E2X A;  4YON A;  1WI1 A;  1NTY A;  5D3Y A;  1IRS A;  3TCA A;  5CLL B;  1I2H A;  2CY4 A;  2H7D A;  5D3V A;  1M7R A;  2HE7 A;  3F0W A;  3ZVR A;  3OAN A;  2YF0 A;  5J3Y A;  3U7D A;  3A98 B;  3F5R A;  2YT0 A;  3KZ1 A;  4D0N B;  1ZC3 B;  5DHA B;  1XR0 B;  1EF1 A;  2CY5 A;  4KVG B;  1MAI A;  4PQ0 A;  2ZPY A;  3QWM A;  1SHC A;  2H7E A;  3QIJ A;  1Y19 B;  5DH9 B;  3TFM A;  2COF A;  2DYN A;  2COD A;  2D4Q A;  1J19 A;  1P3R A;  2L2I A;  3A8P A;  2VRW B;  1I7A A;  1OY2 A;  2RNR B;  3V5W A;  3LJU X;  3PVU A;  1Q67 A;  1U5F A;  3MDB C;  2W2W A;  2MKR A;  4KHB B;  1DDW A;  4WVF B;  1TQZ A;  1W1D A;  4L6E A;  3N7C A;  1U5G A;  1MIX A;  4HAX B;  4HDO A;  4C0A A;  2L1C A;  1X05 A;  1U27 A;  2DHK A;  3KY9 A;  2Q13 A;  1KZ7 A;  2COA A;  2VKI A;  2ROZ B;  2J0M A;  4ZRI A;  4GZU A;  2IYB A;  4BBK A;  3TW1 A;  1H4R A;  2J0J A;  1BTN A;  2R0D A;  2ROV A;  1UNQ A;  1W1H A;  4EJN A;  2RLO A;  4IFS A;  4Z2M B;  1WVH A;  4DXA B;  5HE0 A;  1V5M A;  1MK7 B;  4MK0 A;  4GXB A;  1P5T A;  2N0Y A;  5HE3 A;  1FB8 A;  1V89 A;  1TJ6 A;  3D8D A;  1WJM A;  1ZC4 B;  4YL8 A;  3PP2 A;  4A6F A;  1FAO A;  1MPH A;  3ULB A;  3PVW A;  1U5E A;  4ZRJ A;  2PZ1 A;  3ODW A;  1UNP A;  2RGN B;  2V76 A;  4HB2 B;  1UPR A;  1NI2 A;  3HK0 A;  2P0F A;  1MKE A;  2DA0 A;  3PG7 A;  1BAK A;  3P6A A;  1XX0 A;  4CYE A;  2YT1 A;  2CRF A;  2GCL A;  2W2X D;  3PSC A;  4H8S A;  3QBV B;  4XWX A;  2Z0Q A;  1XD4 A;  3DXD A;  4GPT B;  4HHV A;  5LOP B;  2N23 A;  2EMS A;  2K2J A;  5KQ4 A;  4HAU B;  5FI0 A;  1OQN A;  2LOZ A;  2DFK A;  2G35 A;  5J3Q A;  4MY6 A;  4NSW A;  1QQG A;  1U5D A;  2OQB A;  5J3T A;  1V88 A;  4EMO A;  3FM8 C;  3VOQ A;  4P7I A;  4HB4 B;  1TXD A;  2GJY A;  2LOX A;  4IAP A;  2Y8G A;  4HAV B;  1UEF A;  4F7U P;  2MWN B;  4K2P A;  1QC6 A;  1N3H A;  1MK9 B;  1K5D B;  4TKN A;  5HE2 A;  4DBB A;  1OMW A;  2Y8F A;  2W2X C;  3ODX A;  1WJ1 A;  1PMS A;  1DYN A;  3SO6 A;  2BCJ A;  2D2Q A;  2NZ8 B;  1FOE A;  1EAZ A;  3T06 A;  2K00 A;  5C79 A;  2D9Z A;  2GCJ A;  1FHW A;  3UZT A;  1X86 A;  2JP2 A;  3AU4 A;  2DX1 A;  2UZS A;  3ML4 A;  4K17 A;  3ULC A;  4CHM A;  4KAX B;  2VSZ A;  1V5P A;  1X1G A;  3SYX A;  4F7H A;  1V61 A;  4CHJ A;  5GOW B;  1RRP B;  5DIF B;  5L81 A;  1BTK A;  3D8F A;  1V5U A;  2K2U A;  3MPX A;  4K81 A;  3P7Z A;  4F7G A;  1WGQ A;  2I1K A;  2DKQ A;  3FEH A;  2NMB A;  5KCV A;  4HAY B;  2DX5 A;  1ZM0 A;  2P0H A;  1ZSQ A;  3KRW A;  2Z0O A;  4WSF A;  4KHO A;  4B6H A;  3DXC A;  5D3W A;  4Y94 A;  2DTC A;  2M38 A;  4A6K A;  2X18 A;  4MT7 A;  1M7E A;  4A6F B;  1AQC A;  2D9V A;  1K5G B;  3ZDT A;  1DDV A;  4A5K A;  1NU2 A;  4Z2N A;  2KGX B;  4DX9 0;  5JLJ B;  1FGZ A;  1X11 A;  1ISN A;  2DKP A;  2DHJ A;  3BIN A;  4GMX B;  4IOY X;  1MIZ B;  3KRX A;  5HE1 A;  5C5B A;  1DRO A;  2AL6 A;  5C5B B;  3X23 A;  5KQ1 A;  2D10 A;  4HB3 B;  2MDX A;  2COC A;  4TYZ A;  3SNH A;  4EKU A;  4NY0 A;  1GG3 A;  2KUP A;  2YRY A;  5C6R A;  2P8V A;  1UPQ A;  1PFJ A;  3A8Q A;  3GYP A;  2EC1 A;  4HAZ B;  3FSS A;  2YS3 A;  1KI1 B;  1Z87 A;  4GN1 A;  1WGU A;  2ADZ A;  4ZRK A;  5CLQ B;  2P0D A;  3SUZ A;  4HAW B;  1LB1 A;  3PEG A;  3NSU A;  2DLW A;  2I5F A;  1EGX A;  2Y7B A;  2LKO A;  3M1I B;  1FGY A;  2D9X A;  5FI1 A;  5LON B;  1GC6 A;  1AWE A;  2YS5 A;  2HTH B;  5DI9 B;  3CIK A;  1ZVR A;  2FJL A;  3CXB B;  4K2O A;  2LYD A;  2Z0P A; 
#chains in the Genus database with same CATH topology
 3VIA A;  2YVC A;  1FHO A;  2QKL A;  5D3X A;  5EFX A;  3WA0 A;  4KHA A;  2ELA A;  2Z59 A;  3D8E A;  2RUK B;  1XCG A;  1KZG A;  2J0K A;  4HB0 B;  2D9W A;  2DHI A;  5C16 A;  1E5W A;  1XKE A;  2M14 A;  2CAY A;  4DX8 A;  3DCX A;  3WYF B;  4GNK B;  3U8Z A;  3BJI A;  3DXE A;  3ODO A;  1J0W A;  3PVL A;  3KSY A;  3TO1 A;  2YS1 A;  1EVH A;  1H10 A;  2J59 M;  3AU5 A;  3TVV A;  2UZR A;  4GOU A;  1Y5O A;  3IVF A;  3GYO A;  1XOD A;  1WG7 A;  2IFS A;  1FHX A;  4A6H A;  2EMT A;  1SGH A;  2KCJ A;  1B55 A;  4HDQ A;  3NWA A;  2OTX A;  1GC7 A;  2EJ8 A;  2I1J A;  3HQC A;  4GMV A;  1W1G A;  2R09 A;  2LG1 A;  2LUL A;  1X1F A;  3SV1 A;  5JP4 A;  3NWD A;  2D11 A;  5DHF B;  2XQN M;  4HAT B;  4WJ7 A;  3RCP A;  2DN6 A;  2UVM A;  4PNK A;  1UNR A;  3HW2 B;  2RVB B;  2YSZ A;  1RJ2 A;  2DYQ A;  1DDM A;  3AJ4 A;  1DBH A;  1PLS A;  2ELB A;  4D6W A;  1U2B A;  3PZD A;  3O96 A;  2K8E A;  1LW3 A;  2RSG A;  2I5C A;  2D9Y A;  3G9W A;  1BWN A;  1P6S A;  2AEH A;  5JHH A;  5D27 A;  1U29 A;  2MFQ A;  4QJ5 B;  5JHG A;  2GS0 A;  2QKM A;  1NTV A;  2E2X A;  4YON A;  1WI1 A;  1NTY A;  5D3Y A;  1IRS A;  3TCA A;  5CLL B;  1I2H A;  2CY4 A;  2H7D A;  2YT2 A;  5D3V A;  1M7R A;  2HE7 A;  3F0W A;  3ZVR A;  2FJU B;  2RRF A;  2YF0 A;  3OAN A;  5J3Y A;  3U7D A;  3A98 B;  1ZYI A;  3F5R A;  2YT0 A;  3KZ1 A;  4D0N B;  3NWF A;  1ZC3 B;  5DHA B;  1XR0 B;  1EF1 A;  2CY5 A;  4KVG B;  1MAI A;  4PQ0 A;  1T77 A;  2ZPY A;  3QWM A;  1SHC A;  2H7E A;  3QIJ A;  1Y19 B;  5DH9 B;  3TFM A;  2COF A;  2DYN A;  2COD A;  2D4Q A;  1J19 A;  1P3R A;  2L2I A;  3A8P A;  2VRW B;  1I7A A;  1OY2 A;  2RNR B;  3V5W A;  3LJU X;  3PVU A;  1Q67 A;  1U5F A;  3MDB C;  4KHB A;  2W2W A;  2MKR A;  4KHB B;  1DDW A;  4WVF B;  1TQZ A;  1W1D A;  2R2Y A;  4L6E A;  2Z4D A;  3N7C A;  1U5G A;  1MIX A;  4HAX B;  4HDO A;  4C0A A;  2L1C A;  2KR0 A;  1X05 A;  1U27 A;  2DHK A;  3KY9 A;  2Q13 A;  3OHM B;  1KZ7 A;  2COA A;  2VKI A;  2ROZ B;  2J0M A;  4ZRI A;  4GZU A;  2IYB A;  4BBK A;  3TW1 A;  1H4R A;  2J0J A;  1BTN A;  2R0D A;  2ROV A;  1UNQ A;  3NW8 A;  1W1H A;  5I2M A;  4EJN A;  2RLO A;  4IFS A;  4Z2M B;  1WVH A;  4QJ3 B;  4DXA B;  5HE0 A;  1V5M A;  1MK7 B;  4MK0 A;  4GXB A;  4QXA B;  1P5T A;  2N0Y A;  5HE3 A;  1FB8 A;  1V89 A;  4CSQ A;  4DIX A;  1TJ6 A;  3D8D A;  1WJM A;  4OSN A;  1ZC4 B;  2KIG A;  5IRS A;  4YL8 A;  3PP2 A;  4A6F A;  1FAO A;  1MPH A;  3ULB A;  3PVW A;  1U5E A;  4ZRJ A;  2PZ1 A;  3ODW A;  1UNP A;  2RGN B;  3HIE A;  2NBV A;  2V76 A;  4HB2 B;  2Z13 A;  1UPR A;  1NI2 A;  3HK0 A;  2P0F A;  1MKE A;  2DA0 A;  3PG7 A;  1BAK A;  3P6A A;  1XX0 A;  4CYE A;  2YT1 A;  2CRF A;  2GCL A;  2W2X D;  3PSC A;  4H8S A;  3QBV B;  5LG4 B;  4XWX A;  2Z0Q A;  1XD4 A;  3DXD A;  4GPT B;  4HHV A;  5LOP B;  2N23 A;  2EMS A;  2K2J A;  5KQ4 A;  3A58 A;  4HAU B;  5FI0 A;  1OQN A;  2LOZ A;  4OT1 A;  2DFK A;  2G35 A;  5M4Y B;  5J3Q A;  4MY6 A;  4NSW A;  1QQG A;  1U5D A;  2OQB A;  5J3T A;  1V88 A;  3U12 A;  4EMO A;  3FM8 C;  3VOQ A;  4P7I A;  4HB4 B;  1TXD A;  2GJY A;  2LOX A;  4IAP A;  2Y8G A;  4HAV B;  1UEF A;  4F7U P;  2MWN B;  4K2P A;  1QC6 A;  1N3H A;  1MK9 B;  1K5D B;  4TKN A;  5HE2 A;  4DBB A;  1OMW A;  2Y8F A;  2W2X C;  3ODX A;  1WJ1 A;  1PMS A;  1DYN A;  3SO6 A;  5I2S A;  1MI1 A;  2BCJ A;  2D2Q A;  3B77 A;  2NZ8 B;  1FOE A;  1EAZ A;  3T06 A;  2K00 A;  5C79 A;  2D9Z A;  2GCJ A;  1FHW A;  3HSA A;  3UZT A;  1X86 A;  2JP2 A;  3AU4 A;  2DX1 A;  2UZS A;  3ML4 A;  4K17 A;  3ULC A;  2KUQ A;  4CHM A;  4KAX B;  2VSZ A;  1V5P A;  1X1G A;  3SYX A;  4F7H A;  1V61 A;  4CHJ A;  5GOW B;  1RRP B;  5DIF B;  5L81 A;  1BTK A;  3D8F A;  2ZKM X;  1V5U A;  2K2U A;  3MPX A;  4K81 A;  3P7Z A;  4F7G A;  1WGQ A;  2I1K A;  2DKQ A;  3FEH A;  2NMB A;  5KCV A;  4HAY B;  2GUM A;  2DX5 A;  1ZM0 A;  2P0H A;  1ZSQ A;  3KRW A;  2Z0O A;  4WSF A;  4KHO A;  4B6H A;  3DXC A;  5D3W A;  4Y94 A;  2DTC A;  2M38 A;  4A6K A;  2X18 A;  4MT7 A;  1M7E A;  4L1R A;  4A6F B;  1AQC A;  2KIE A;  2D9V A;  1K5G B;  3ZDT A;  1DDV A;  4A5K A;  1NU2 A;  4Z2N A;  2KGX B;  4DX9 0;  5JLJ B;  1FGZ A;  1X11 A;  1ISN A;  2DKP A;  2DHJ A;  3BIN A;  4GMX B;  4IOY X;  1MIZ B;  3KRX A;  5HE1 A;  4QJ4 B;  5C5B A;  2AL6 A;  1DRO A;  5C5B B;  3X23 A;  5KQ1 A;  2D10 A;  4HB3 B;  2MDX A;  2COC A;  4TYZ A;  3SNH A;  4EKU A;  4NY0 A;  1GG3 A;  2KUP A;  2YRY A;  5C6R A;  2P8V A;  1UPQ A;  1PFJ A;  3A8Q A;  3GYP A;  2EC1 A;  4HAZ B;  3FVC A;  3FSS A;  2YS3 A;  1KI1 B;  1Z87 A;  4GN1 A;  1WGU A;  2ADZ A;  4ZRK A;  5CLQ B;  2P0D A;  3SUZ A;  4HAW B;  1LB1 A;  3PEG A;  3NSU A;  2DLW A;  2I5F A;  2K49 A;  1EGX A;  2Y7B A;  2LKO A;  3M1I B;  1FGY A;  4HSI A;  2D9X A;  5FI1 A;  2Z14 A;  5LON B;  1GC6 A;  1AWE A;  2YS5 A;  2HTH B;  5DI9 B;  3CIK A;  1ZVR A;  2FJL A;  3CXB B;  4K2O A;  2LYD A;  2Z0P A; 
#chains in the Genus database with same CATH homology
 3VIA A;  2YVC A;  1FHO A;  2QKL A;  5D3X A;  5EFX A;  3WA0 A;  4KHA A;  2ELA A;  3D8E A;  2RUK B;  1XCG A;  1KZG A;  2J0K A;  4HB0 B;  2D9W A;  2DHI A;  5C16 A;  1E5W A;  1XKE A;  2M14 A;  2CAY A;  4DX8 A;  3WYF B;  3U8Z A;  3BJI A;  3DXE A;  3ODO A;  1J0W A;  3PVL A;  3KSY A;  3TO1 A;  2YS1 A;  1EVH A;  1H10 A;  2J59 M;  3AU5 A;  3TVV A;  2UZR A;  1Y5O A;  3IVF A;  3GYO A;  1XOD A;  1WG7 A;  2IFS A;  1FHX A;  4A6H A;  2EMT A;  1SGH A;  2KCJ A;  1B55 A;  4HDQ A;  2OTX A;  1GC7 A;  2EJ8 A;  2I1J A;  3HQC A;  4GMV A;  1W1G A;  2R09 A;  2LG1 A;  2LUL A;  1X1F A;  3SV1 A;  5JP4 A;  2D11 A;  5DHF B;  2XQN M;  4HAT B;  4WJ7 A;  3RCP A;  2DN6 A;  2UVM A;  4PNK A;  1UNR A;  3HW2 B;  2RVB B;  2YSZ A;  1RJ2 A;  2DYQ A;  1DDM A;  3AJ4 A;  1DBH A;  1PLS A;  2ELB A;  1U2B A;  3PZD A;  3O96 A;  1LW3 A;  2RSG A;  2I5C A;  2D9Y A;  3G9W A;  1BWN A;  1P6S A;  2AEH A;  5JHH A;  5D27 A;  1U29 A;  2MFQ A;  5JHG A;  2GS0 A;  2QKM A;  1NTV A;  2E2X A;  4YON A;  1WI1 A;  1NTY A;  5D3Y A;  1IRS A;  3TCA A;  5CLL B;  1I2H A;  2CY4 A;  2H7D A;  5D3V A;  1M7R A;  2HE7 A;  3F0W A;  3ZVR A;  3OAN A;  2YF0 A;  5J3Y A;  3U7D A;  3A98 B;  3F5R A;  2YT0 A;  3KZ1 A;  4D0N B;  1ZC3 B;  5DHA B;  1XR0 B;  1EF1 A;  2CY5 A;  4KVG B;  1MAI A;  4PQ0 A;  2ZPY A;  3QWM A;  1SHC A;  2H7E A;  3QIJ A;  1Y19 B;  5DH9 B;  3TFM A;  2COF A;  2DYN A;  2COD A;  2D4Q A;  1J19 A;  1P3R A;  2L2I A;  3A8P A;  2VRW B;  1I7A A;  1OY2 A;  2RNR B;  3V5W A;  3LJU X;  3PVU A;  1Q67 A;  1U5F A;  3MDB C;  2W2W A;  2MKR A;  4KHB B;  1DDW A;  4WVF B;  1TQZ A;  1W1D A;  4L6E A;  3N7C A;  1U5G A;  1MIX A;  4HAX B;  4HDO A;  4C0A A;  2L1C A;  1X05 A;  1U27 A;  2DHK A;  3KY9 A;  2Q13 A;  1KZ7 A;  2COA A;  2VKI A;  2ROZ B;  2J0M A;  4ZRI A;  4GZU A;  2IYB A;  4BBK A;  3TW1 A;  1H4R A;  2J0J A;  1BTN A;  2R0D A;  2ROV A;  1UNQ A;  1W1H A;  4EJN A;  2RLO A;  4IFS A;  4Z2M B;  1WVH A;  4DXA B;  5HE0 A;  1V5M A;  1MK7 B;  4MK0 A;  4GXB A;  1P5T A;  2N0Y A;  5HE3 A;  1FB8 A;  1V89 A;  1TJ6 A;  3D8D A;  1WJM A;  1ZC4 B;  4YL8 A;  3PP2 A;  4A6F A;  1FAO A;  1MPH A;  3ULB A;  3PVW A;  1U5E A;  4ZRJ A;  2PZ1 A;  3ODW A;  1UNP A;  2RGN B;  2V76 A;  4HB2 B;  1UPR A;  1NI2 A;  3HK0 A;  2P0F A;  1MKE A;  2DA0 A;  3PG7 A;  1BAK A;  3P6A A;  1XX0 A;  4CYE A;  2YT1 A;  2CRF A;  2GCL A;  2W2X D;  3PSC A;  4H8S A;  3QBV B;  4XWX A;  2Z0Q A;  1XD4 A;  3DXD A;  4GPT B;  4HHV A;  5LOP B;  2N23 A;  2EMS A;  2K2J A;  5KQ4 A;  4HAU B;  5FI0 A;  1OQN A;  2LOZ A;  2DFK A;  2G35 A;  5J3Q A;  4MY6 A;  4NSW A;  1QQG A;  1U5D A;  2OQB A;  5J3T A;  1V88 A;  4EMO A;  3FM8 C;  3VOQ A;  4P7I A;  4HB4 B;  1TXD A;  2GJY A;  2LOX A;  4IAP A;  2Y8G A;  4HAV B;  1UEF A;  4F7U P;  2MWN B;  4K2P A;  1QC6 A;  1N3H A;  1MK9 B;  1K5D B;  4TKN A;  5HE2 A;  4DBB A;  1OMW A;  2Y8F A;  2W2X C;  3ODX A;  1WJ1 A;  1PMS A;  1DYN A;  3SO6 A;  2BCJ A;  2D2Q A;  2NZ8 B;  1FOE A;  1EAZ A;  3T06 A;  2K00 A;  5C79 A;  2D9Z A;  2GCJ A;  1FHW A;  3UZT A;  1X86 A;  2JP2 A;  3AU4 A;  2DX1 A;  2UZS A;  3ML4 A;  4K17 A;  3ULC A;  4CHM A;  4KAX B;  2VSZ A;  1V5P A;  1X1G A;  3SYX A;  4F7H A;  1V61 A;  4CHJ A;  5GOW B;  1RRP B;  5DIF B;  5L81 A;  1BTK A;  3D8F A;  1V5U A;  2K2U A;  3MPX A;  4K81 A;  3P7Z A;  4F7G A;  1WGQ A;  2I1K A;  2DKQ A;  3FEH A;  2NMB A;  5KCV A;  4HAY B;  2DX5 A;  1ZM0 A;  2P0H A;  1ZSQ A;  3KRW A;  2Z0O A;  4WSF A;  4KHO A;  4B6H A;  3DXC A;  5D3W A;  4Y94 A;  2DTC A;  2M38 A;  4A6K A;  2X18 A;  4MT7 A;  1M7E A;  4A6F B;  1AQC A;  2D9V A;  1K5G B;  3ZDT A;  1DDV A;  4A5K A;  1NU2 A;  4Z2N A;  2KGX B;  4DX9 0;  5JLJ B;  1FGZ A;  1X11 A;  1ISN A;  2DKP A;  2DHJ A;  3BIN A;  4GMX B;  4IOY X;  1MIZ B;  3KRX A;  5HE1 A;  5C5B A;  1DRO A;  2AL6 A;  5C5B B;  3X23 A;  5KQ1 A;  2D10 A;  4HB3 B;  2MDX A;  2COC A;  4TYZ A;  3SNH A;  4EKU A;  4NY0 A;  1GG3 A;  2KUP A;  2YRY A;  5C6R A;  2P8V A;  1UPQ A;  1PFJ A;  3A8Q A;  3GYP A;  2EC1 A;  4HAZ B;  3FSS A;  2YS3 A;  1KI1 B;  1Z87 A;  4GN1 A;  1WGU A;  2ADZ A;  4ZRK A;  5CLQ B;  2P0D A;  3SUZ A;  4HAW B;  1LB1 A;  3PEG A;  3NSU A;  2DLW A;  2I5F A;  1EGX A;  2Y7B A;  2LKO A;  3M1I B;  1FGY A;  2D9X A;  5FI1 A;  5LON B;  1GC6 A;  1AWE A;  2YS5 A;  2HTH B;  5DI9 B;  3CIK A;  1ZVR A;  2FJL A;  3CXB B;  4K2O A;  2LYD A;  2Z0P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...