2VSZA

Crystal structure of the elmo1 ph domain
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
147
structure length
141
Chain Sequence
GPLGSPILELKEKIQPEILELIKQQRLNRLVEGTCFRKLNARRRQDKFWYCRLSPNHKVLHYGDLEESPQGEVPHDSLQDKLPVADIKAVVTGKDCPHMKENKEVLELAFSILYDSNCQLNFIAPDKHEYCIWTDGLNALL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title An Alpha-Helical Extension of the Elmo1 Pleckstrin Homology Domain Mediates Direct Interaction to Dock180 and is Critical in Rac Signaling.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Apoptosis
molecule keywords ENGULFMENT AND CELL MOTILITY PROTEIN 1
total genus 37
structure length 141
sequence length 147
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16457 PH_12 Pleckstrin homology domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2vszA02
2Q13A 2CODA 3A8PA 5C16A 1ZVRA 5EFXA 2EJ8A 4K2PA 5JHGA 3BJIA 1FGZA 2K2UA 5C6RA 5LOPB 2V76A 2KUPA 2DN6A 1DYNA 2H7EA 2L2IA 2UZSA 4Z2MB 4NY0A 4K81A 1U5GA 3IVFA 1ISNA 1PFJA 2LG1A 3MPXA 2N23A 2YRYA 3P6AA 4A6KA 1QQGA 4TYZA 2FJLA 4HAUB 1ZSQA 3ODXA 2G35A 3ODOA 1MKEA 1U5EA 1EF1A 3PP2A 1V61A 3PZDA 1KI1B 2GCLA 3QBVB 1GC6A 2Z0OA 4KVGB 3TO1A 4NSWA 4WSFA 3SV1A 1M7EA 4HB2B 4KHAA 1OQNA 1BWNA 2DKPA 5D3XA 5J3QA 2VRWB 1X1GA 2N0YA 4Z2NA 1W1GA 4HAYB 2D10A 2LYDA 1J0WA 1P6SA 2RUKB 3M1IB 2D9YA 2RGNB 3ZDTA 4HB4B 4F7UP 5JP4A 2LOXA 3SO6A 5KQ1A 4GN1A 2D4QA 1XCGA 2AEHA 4HDQA 4XWXA 1X1FA 2I5FA 3AU4A 2DFKA 3T06A 1BAKA 1LB1A 2DTCA 2Y8FA 4WVFB 2KGXB 1H10A 2HE7A 3GYOA 1NU2A 3X23A 1Y19B 3FM8C 4ZRIA 1FAOA 2I1KA 3KSYA 5C79A 1UPRA 2J0JA 1MK7B 2LKOA 3U8ZA 4MT7A 4GMVA 3NSUA 4CHJA 2K00A 4HAWB 1WI1A 1BTKA 2K2JA 2QKLA 1B55A 1U2BA 3TCAA 2QKMA 4C0AA 1SHCA 1WVHA 3O96A 5DHFB 2DYNA 2DX1A 1FB8A 5D3VA 5D3YA 3MDBC 2ELBA 1Z87A 1XR0B 2J0MA 1X11A 5C5BA 5HE0A 3CIKA 1X86A 1W1HA 1EAZA 1TQZA 2JP2A 4GMXB 4ZRKA 3ML4A 5HE2A 2IFSA 1I2HA 4MY6A 2Y8GA 1RJ2A 3A8QA 3D8EA 2E2XA 3FEHA 5KQ4A 2VSZA 1FHXA 2EC1A 4PNKA 4HAXB 5JLJB 1N3HA 4KHBB 1EVHA 1UEFA 2KCJA 5LONB 1TJ6A 3HK0A 4MK0A 2RVBB 1GG3A 3ULCA 2ELAA 3D8DA 3VOQA 1SGHA 2YVCA 1AWEA 4D0NB 1GC7A 2YS3A 2MFQA 4DX8A 1FHWA 2XQNM 5FI1A 1DBHA 2RSGA 2ZPYA 1WJMA 2BCJA 2J59M 5FI0A 5DH9B 1U5FA 2DLWA 1V88A 1DROA 1RRPB 2MWNB 1DDMA 2LULA 2DA0A 3N7CA 1NTVA 4A6FA 1TXDA 2W2WA 3KRWA 1ZM0A 5DI9B 1BTNA 3F5RA 2OQBA 2GJYA 3U7DA 4KAXB 3HQCA 3P7ZA 1MIZB 4BBKA 4F7GA 2P0HA 1DDVA 4HATB 4K2OA 2MDXA 2X18A 4GZUA 1KZGA 4H8SA 2NZ8B 1U29A 4HDOA 3WA0A 3PEGA 2YT1A 1V5PA 1U27A 2DKQA 2Y7BA 3ZVRA 5JHHA 4B6HA 5J3TA 2I5CA 1XKEA 3V5WA 2DHKA 3RCPA 1V5MA 3QIJA 3PSCA 2COFA 4GPTB 3DXDA 1M7RA 2PZ1A 4CHMA 2YS5A 1K5GB 1Q67A 1FOEA 3VIAA 4EKUA 3SNHA 4A6FB 5CLLB 4YONA 1UNRA 5HE1A 4F7HA 1XD4A 4EJNA 1QC6A 3TFMA 4P7IA 4HB3B 3FSSA 2GCJA 1K5DB 1WG7A 2M14A 1V5UA 3KRXA 4IOYX 1E5WA 2Z0QA 2D2QA 2H7DA 4HAVB 2YS1A 2CRFA 2EMTA 3A98B 4A6HA 1WGQA 5D27A 4A5KA 2NMBA 2DYQA 4EMOA 1OY2A 2IYBA 2Z0PA 1EGXA 2D9VA 4K17A 3QWMA 3AU5A 4HAZB 3F0WA 3TW1A 3AJ4A 3SUZA 1IRSA 5J3YA 4DX90 3LJUX 5HE3A 3HW2B 2J0KA 3TVVA 4WJ7A 1J19A 2LOZA 2COCA 2AL6A 3PG7A 2GS0A 1AQCA 4PQ0A 3BINA 1MIXA 2HTHB 3GYPA 1U5DA 1H4RA 2COAA 3PVWA 1XX0A 2P0DA 2ROVA 2CY5A 2R09A 5CLQB 1UPQA 5L81A 1X05A 1P3RA 3DXCA 3SYXA 2RLOA 1DDWA 4DXAB 4KHOA 5DIFB 2R0DA 3D8FA 1MAIA 2EMSA 2YF0A 1ZC4B 3CXBB 1MPHA 1ZC3B 2YT0A 3PVLA 3UZTA 3G9WA 3DXEA 1UNQA 2DHIA 3PVUA 4TKNA 5KCVA 5D3WA 4ZRJA 5GOWB 3WYFB 2RNRB 2W2XC 2ROZB 5C5BB 1WJ1A 1NTYA 4L6EA 2P8VA 4Y94A 1UNPA 4YL8A 1Y5OA 1FHOA 2D9XA 1LW3A 2DHJA 5DHAB 1W1DA 1XODA 2MKRA 2M38A 1P5TA 4GXBA 2VKIA 4IAPA 3KY9A 1V89A 1FGYA 1KZ7A 2OTXA 1NI2A 1PMSA 1WGUA 4HHVA 3ODWA 2UZRA 3KZ1A 2CY4A 4CYEA 2D11A 1OMWA 2UVMA 4HB0B 1I7AA 2P0FA 2W2XD 1PLSA 2YSZA 2D9ZA 2L1CA 3OANA 2I1JA 2DX5A 2D9WA 4IFSA 2ADZA 2CAYA 4DBBA 1MK9B 3ULBA
chains in the Genus database with same CATH superfamily
2Q13A 2CODA 3A8PA 5C16A 1ZVRA 5EFXA 2EJ8A 4K2PA 5JHGA 3BJIA 4L1RA 4QXAB 1FGZA 2K2UA 5C6RA 5LOPB 2V76A 2KUPA 2DN6A 1DYNA 2H7EA 2K49A 2L2IA 2UZSA 4Z2MB 4NY0A 4K81A 1U5GA 3IVFA 4QJ3B 1ISNA 1PFJA 2LG1A 3MPXA 2N23A 2YRYA 3P6AA 4A6KA 1QQGA 4TYZA 2FJLA 4HAUB 1ZSQA 3ODXA 2G35A 3ODOA 1MKEA 1U5EA 1EF1A 3PP2A 1V61A 3PZDA 1KI1B 2YT2A 2Z13A 2GCLA 3QBVB 1GC6A 2Z0OA 4KVGB 3TO1A 3OHMB 5I2SA 2R2YA 4NSWA 4WSFA 3SV1A 1M7EA 4HB2B 4KHAA 1OQNA 1BWNA 2GUMA 2DKPA 5D3XA 5J3QA 4GOUA 2VRWB 1X1GA 2N0YA 4Z2NA 1W1GA 4HAYB 2D10A 2LYDA 1J0WA 1P6SA 2RUKB 3M1IB 2D9YA 2RGNB 3ZDTA 4HB4B 4F7UP 5JP4A 2LOXA 3SO6A 5KQ1A 4GN1A 2D4QA 1XCGA 2AEHA 4HDQA 4XWXA 1X1FA 2I5FA 3AU4A 2DFKA 3T06A 1BAKA 1LB1A 2DTCA 2Y8FA 4WVFB 2KGXB 1H10A 2HE7A 3GYOA 1NU2A 3X23A 3U12A 1Y19B 3FM8C 4ZRIA 1FAOA 2I1KA 3KSYA 1MI1A 5C79A 1UPRA 2J0JA 1MK7B 2LKOA 3U8ZA 4MT7A 4GMVA 3NSUA 4CHJA 2K00A 4HAWB 1WI1A 1BTKA 2K2JA 4CSQA 2QKLA 1B55A 1U2BA 3TCAA 2QKMA 4C0AA 1SHCA 1WVHA 3O96A 5DHFB 2DYNA 2DX1A 1FB8A 5D3VA 5D3YA 3MDBC 2ELBA 1Z87A 1XR0B 2J0MA 1X11A 5C5BA 5HE0A 3CIKA 1X86A 1W1HA 1EAZA 1TQZA 2Z14A 2JP2A 4GMXB 4ZRKA 3ML4A 5HE2A 2IFSA 1I2HA 4MY6A 2Y8GA 1RJ2A 3A8QA 3D8EA 2E2XA 3FEHA 5KQ4A 2VSZA 1FHXA 2EC1A 4PNKA 4HAXB 5JLJB 1N3HA 4KHBB 5IRSA 1EVHA 1UEFA 2KCJA 5LONB 1TJ6A 3HK0A 4MK0A 2RVBB 4D6WA 1GG3A 3ULCA 2Z4DA 2ELAA 3D8DA 3VOQA 1SGHA 2YVCA 2KIGA 4DIXA 1AWEA 4D0NB 1GC7A 2YS3A 2MFQA 4DX8A 3B77A 3NWDA 1FHWA 2XQNM 3NW8A 5FI1A 1DBHA 2RSGA 2ZPYA 1WJMA 2BCJA 2J59M 5FI0A 5DH9B 1U5FA 2DLWA 1V88A 1DROA 1RRPB 2MWNB 1DDMA 2LULA 2DA0A 3N7CA 1NTVA 4A6FA 2KR0A 1TXDA 2W2WA 3KRWA 1ZM0A 4QJ4B 5DI9B 1BTNA 3F5RA 2OQBA 2GJYA 3U7DA 4KAXB 3HQCA 3P7ZA 1MIZB 4BBKA 3NWFA 1ZYIA 4F7GA 2P0HA 1DDVA 4HATB 4K2OA 2MDXA 3A58A 2X18A 4GZUA 1KZGA 4H8SA 2NZ8B 2FJUB 1U29A 4HDOA 3WA0A 3PEGA 2YT1A 1V5PA 1U27A 2DKQA 2Y7BA 3ZVRA 4KHBA 5JHHA 4B6HA 3HSAA 5J3TA 2I5CA 1XKEA 3V5WA 2DHKA 3RCPA 1V5MA 3QIJA 1T77A 3PSCA 2COFA 4GPTB 3DXDA 1M7RA 2PZ1A 2KUQA 4CHMA 2YS5A 1K5GB 1Q67A 1FOEA 3VIAA 4EKUA 3SNHA 4A6FB 5CLLB 4YONA 1UNRA 5HE1A 4OT1A 4F7HA 3NWAA 1XD4A 4EJNA 1QC6A 4HSIA 3TFMA 4P7IA 4HB3B 2NBVA 3FSSA 2GCJA 1K5DB 1WG7A 2M14A 1V5UA 3KRXA 4IOYX 1E5WA 3DCXA 2Z0QA 2D2QA 2H7DA 4HAVB 2YS1A 2CRFA 2EMTA 3A98B 4A6HA 1WGQA 5D27A 4OSNA 4A5KA 2NMBA 2DYQA 4EMOA 2KIEA 1OY2A 2IYBA 2RRFA 2Z0PA 5M4YB 1EGXA 2D9VA 4K17A 2K8EA 3QWMA 3AU5A 4HAZB 3F0WA 3TW1A 3AJ4A 3SUZA 1IRSA 5J3YA 4DX90 3LJUX 5HE3A 3HW2B 2J0KA 3TVVA 4WJ7A 1J19A 2LOZA 2COCA 2AL6A 3PG7A 2GS0A 3FVCA 1AQCA 4PQ0A 3BINA 1MIXA 2HTHB 3GYPA 1U5DA 1H4RA 2COAA 3PVWA 1XX0A 2P0DA 2ROVA 2CY5A 2R09A 5CLQB 1UPQA 5L81A 1X05A 1P3RA 3DXCA 3SYXA 2RLOA 1DDWA 4DXAB 4KHOA 5DIFB 2R0DA 3D8FA 1MAIA 2EMSA 2YF0A 1ZC4B 5I2MA 3CXBB 1MPHA 4QJ5B 1ZC3B 2YT0A 3PVLA 3UZTA 3G9WA 3DXEA 1UNQA 2DHIA 3PVUA 3HIEA 4TKNA 5KCVA 5D3WA 4ZRJA 5GOWB 3WYFB 2RNRB 2ZKMX 2W2XC 2ROZB 5C5BB 1WJ1A 1NTYA 4L6EA 2P8VA 4Y94A 1UNPA 4YL8A 1Y5OA 1FHOA 2D9XA 1LW3A 2DHJA 5DHAB 1W1DA 1XODA 2MKRA 2M38A 1P5TA 4GXBA 4GNKB 2VKIA 4IAPA 5LG4B 3KY9A 1V89A 1FGYA 1KZ7A 2OTXA 1NI2A 1PMSA 1WGUA 4HHVA 3ODWA 2UZRA 3KZ1A 2CY4A 4CYEA 2D11A 1OMWA 2UVMA 4HB0B 1I7AA 2P0FA 2W2XD 1PLSA 2YSZA 2D9ZA 2L1CA 3OANA 2I1JA 2DX5A 2D9WA 2Z59A 4IFSA 2ADZA 2CAYA 4DBBA 1MK9B 3ULBA
chains in the Genus database with same CATH topology
2Q13A 2CODA 3A8PA 5C16A 1ZVRA 5EFXA 2EJ8A 4K2PA 5JHGA 3BJIA 1FGZA 2K2UA 5C6RA 5LOPB 2V76A 2KUPA 2DN6A 1DYNA 2H7EA 2L2IA 2UZSA 4Z2MB 4NY0A 4K81A 1U5GA 3IVFA 1ISNA 1PFJA 2LG1A 3MPXA 2N23A 2YRYA 3P6AA 4A6KA 1QQGA 4TYZA 2FJLA 4HAUB 1ZSQA 3ODXA 2G35A 3ODOA 1MKEA 1U5EA 1EF1A 3PP2A 1V61A 3PZDA 1KI1B 2GCLA 3QBVB 1GC6A 2Z0OA 4KVGB 3TO1A 4NSWA 4WSFA 3SV1A 1M7EA 4HB2B 4KHAA 1OQNA 1BWNA 2DKPA 5D3XA 5J3QA 2VRWB 1X1GA 2N0YA 4Z2NA 1W1GA 4HAYB 2D10A 2LYDA 1J0WA 1P6SA 2RUKB 3M1IB 2D9YA 2RGNB 3ZDTA 4HB4B 4F7UP 5JP4A 2LOXA 3SO6A 5KQ1A 4GN1A 2D4QA 1XCGA 2AEHA 4HDQA 4XWXA 1X1FA 2I5FA 3AU4A 2DFKA 3T06A 1BAKA 1LB1A 2DTCA 2Y8FA 4WVFB 2KGXB 1H10A 2HE7A 3GYOA 1NU2A 3X23A 1Y19B 3FM8C 4ZRIA 1FAOA 2I1KA 3KSYA 5C79A 1UPRA 2J0JA 1MK7B 2LKOA 3U8ZA 4MT7A 4GMVA 3NSUA 4CHJA 2K00A 4HAWB 1WI1A 1BTKA 2K2JA 2QKLA 1B55A 1U2BA 3TCAA 2QKMA 4C0AA 1SHCA 1WVHA 3O96A 5DHFB 2DYNA 2DX1A 1FB8A 5D3VA 5D3YA 3MDBC 2ELBA 1Z87A 1XR0B 2J0MA 1X11A 5C5BA 5HE0A 3CIKA 1X86A 1W1HA 1EAZA 1TQZA 2JP2A 4GMXB 4ZRKA 3ML4A 5HE2A 2IFSA 1I2HA 4MY6A 2Y8GA 1RJ2A 3A8QA 3D8EA 2E2XA 3FEHA 5KQ4A 2VSZA 1FHXA 2EC1A 4PNKA 4HAXB 5JLJB 1N3HA 4KHBB 1EVHA 1UEFA 2KCJA 5LONB 1TJ6A 3HK0A 4MK0A 2RVBB 1GG3A 3ULCA 2ELAA 3D8DA 3VOQA 1SGHA 2YVCA 1AWEA 4D0NB 1GC7A 2YS3A 2MFQA 4DX8A 1FHWA 2XQNM 5FI1A 1DBHA 2RSGA 2ZPYA 1WJMA 2BCJA 2J59M 5FI0A 5DH9B 1U5FA 2DLWA 1V88A 1DROA 1RRPB 2MWNB 1DDMA 2LULA 2DA0A 3N7CA 1NTVA 4A6FA 1TXDA 2W2WA 3KRWA 1ZM0A 5DI9B 1BTNA 3F5RA 2OQBA 2GJYA 3U7DA 4KAXB 3HQCA 3P7ZA 1MIZB 4BBKA 4F7GA 2P0HA 1DDVA 4HATB 4K2OA 2MDXA 2X18A 4GZUA 1KZGA 4H8SA 2NZ8B 1U29A 4HDOA 3WA0A 3PEGA 2YT1A 1V5PA 1U27A 2DKQA 2Y7BA 3ZVRA 5JHHA 4B6HA 5J3TA 2I5CA 1XKEA 3V5WA 2DHKA 3RCPA 1V5MA 3QIJA 3PSCA 2COFA 4GPTB 3DXDA 1M7RA 2PZ1A 4CHMA 2YS5A 1K5GB 1Q67A 1FOEA 3VIAA 4EKUA 3SNHA 4A6FB 5CLLB 4YONA 1UNRA 5HE1A 4F7HA 1XD4A 4EJNA 1QC6A 3TFMA 4P7IA 4HB3B 3FSSA 2GCJA 1K5DB 1WG7A 2M14A 1V5UA 3KRXA 4IOYX 1E5WA 2Z0QA 2D2QA 2H7DA 4HAVB 2YS1A 2CRFA 2EMTA 3A98B 4A6HA 1WGQA 5D27A 4A5KA 2NMBA 2DYQA 4EMOA 1OY2A 2IYBA 2Z0PA 1EGXA 2D9VA 4K17A 3QWMA 3AU5A 4HAZB 3F0WA 3TW1A 3AJ4A 3SUZA 1IRSA 5J3YA 4DX90 3LJUX 5HE3A 3HW2B 2J0KA 3TVVA 4WJ7A 1J19A 2LOZA 2COCA 2AL6A 3PG7A 2GS0A 1AQCA 4PQ0A 3BINA 1MIXA 2HTHB 3GYPA 1U5DA 1H4RA 2COAA 3PVWA 1XX0A 2P0DA 2ROVA 2CY5A 2R09A 5CLQB 1UPQA 5L81A 1X05A 1P3RA 3DXCA 3SYXA 2RLOA 1DDWA 4DXAB 4KHOA 5DIFB 2R0DA 3D8FA 1MAIA 2EMSA 2YF0A 1ZC4B 3CXBB 1MPHA 1ZC3B 2YT0A 3PVLA 3UZTA 3G9WA 3DXEA 1UNQA 2DHIA 3PVUA 4TKNA 5KCVA 5D3WA 4ZRJA 5GOWB 3WYFB 2RNRB 2W2XC 2ROZB 5C5BB 1WJ1A 1NTYA 4L6EA 2P8VA 4Y94A 1UNPA 4YL8A 1Y5OA 1FHOA 2D9XA 1LW3A 2DHJA 5DHAB 1W1DA 1XODA 2MKRA 2M38A 1P5TA 4GXBA 2VKIA 4IAPA 3KY9A 1V89A 1FGYA 1KZ7A 2OTXA 1NI2A 1PMSA 1WGUA 4HHVA 3ODWA 2UZRA 3KZ1A 2CY4A 4CYEA 2D11A 1OMWA 2UVMA 4HB0B 1I7AA 2P0FA 2W2XD 1PLSA 2YSZA 2D9ZA 2L1CA 3OANA 2I1JA 2DX5A 2D9WA 4IFSA 2ADZA 2CAYA 4DBBA 1MK9B 3ULBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q13 A;  2COD A;  3A8P A;  5C16 A;  1ZVR A;  5EFX A;  2EJ8 A;  4K2P A;  5JHG A;  3BJI A;  1FGZ A;  2K2U A;  5C6R A;  5LOP B;  2V76 A;  2KUP A;  2DN6 A;  1DYN A;  2H7E A;  2L2I A;  2UZS A;  4Z2M B;  4NY0 A;  4K81 A;  1U5G A;  3IVF A;  1ISN A;  1PFJ A;  2LG1 A;  3MPX A;  2N23 A;  2YRY A;  3P6A A;  4A6K A;  1QQG A;  4TYZ A;  2FJL A;  4HAU B;  1ZSQ A;  3ODX A;  2G35 A;  3ODO A;  1MKE A;  1U5E A;  1EF1 A;  3PP2 A;  1V61 A;  3PZD A;  1KI1 B;  2GCL A;  3QBV B;  1GC6 A;  2Z0O A;  4KVG B;  3TO1 A;  4NSW A;  4WSF A;  3SV1 A;  1M7E A;  4HB2 B;  4KHA A;  1OQN A;  1BWN A;  2DKP A;  5D3X A;  5J3Q A;  2VRW B;  1X1G A;  2N0Y A;  4Z2N A;  1W1G A;  4HAY B;  2D10 A;  2LYD A;  1J0W A;  1P6S A;  2RUK B;  3M1I B;  2D9Y A;  2RGN B;  3ZDT A;  4HB4 B;  4F7U P;  5JP4 A;  2LOX A;  3SO6 A;  5KQ1 A;  4GN1 A;  2D4Q A;  1XCG A;  2AEH A;  4HDQ A;  4XWX A;  1X1F A;  2I5F A;  3AU4 A;  2DFK A;  3T06 A;  1BAK A;  1LB1 A;  2DTC A;  2Y8F A;  4WVF B;  2KGX B;  1H10 A;  2HE7 A;  3GYO A;  1NU2 A;  3X23 A;  1Y19 B;  3FM8 C;  4ZRI A;  1FAO A;  2I1K A;  3KSY A;  5C79 A;  1UPR A;  2J0J A;  1MK7 B;  2LKO A;  3U8Z A;  4MT7 A;  4GMV A;  3NSU A;  4CHJ A;  2K00 A;  4HAW B;  1WI1 A;  1BTK A;  2K2J A;  2QKL A;  1B55 A;  1U2B A;  3TCA A;  2QKM A;  4C0A A;  1SHC A;  1WVH A;  3O96 A;  5DHF B;  2DYN A;  2DX1 A;  1FB8 A;  5D3V A;  5D3Y A;  3MDB C;  2ELB A;  1Z87 A;  1XR0 B;  2J0M A;  1X11 A;  5C5B A;  5HE0 A;  3CIK A;  1X86 A;  1W1H A;  1EAZ A;  1TQZ A;  2JP2 A;  4GMX B;  4ZRK A;  3ML4 A;  5HE2 A;  2IFS A;  1I2H A;  4MY6 A;  2Y8G A;  1RJ2 A;  3A8Q A;  3D8E A;  2E2X A;  3FEH A;  5KQ4 A;  2VSZ A;  1FHX A;  2EC1 A;  4PNK A;  4HAX B;  5JLJ B;  1N3H A;  4KHB B;  1EVH A;  1UEF A;  2KCJ A;  5LON B;  1TJ6 A;  3HK0 A;  4MK0 A;  2RVB B;  1GG3 A;  3ULC A;  2ELA A;  3D8D A;  3VOQ A;  1SGH A;  2YVC A;  1AWE A;  4D0N B;  1GC7 A;  2YS3 A;  2MFQ A;  4DX8 A;  1FHW A;  2XQN M;  5FI1 A;  1DBH A;  2RSG A;  2ZPY A;  1WJM A;  2BCJ A;  2J59 M;  5FI0 A;  5DH9 B;  1U5F A;  2DLW A;  1V88 A;  1DRO A;  1RRP B;  2MWN B;  1DDM A;  2LUL A;  2DA0 A;  3N7C A;  1NTV A;  4A6F A;  1TXD A;  2W2W A;  3KRW A;  1ZM0 A;  5DI9 B;  1BTN A;  3F5R A;  2OQB A;  2GJY A;  3U7D A;  4KAX B;  3HQC A;  3P7Z A;  1MIZ B;  4BBK A;  4F7G A;  2P0H A;  1DDV A;  4HAT B;  4K2O A;  2MDX A;  2X18 A;  4GZU A;  1KZG A;  4H8S A;  2NZ8 B;  1U29 A;  4HDO A;  3WA0 A;  3PEG A;  2YT1 A;  1V5P A;  1U27 A;  2DKQ A;  2Y7B A;  3ZVR A;  5JHH A;  4B6H A;  5J3T A;  2I5C A;  1XKE A;  3V5W A;  2DHK A;  3RCP A;  1V5M A;  3QIJ A;  3PSC A;  2COF A;  4GPT B;  3DXD A;  1M7R A;  2PZ1 A;  4CHM A;  2YS5 A;  1K5G B;  1Q67 A;  1FOE A;  3VIA A;  4EKU A;  3SNH A;  4A6F B;  5CLL B;  4YON A;  1UNR A;  5HE1 A;  4F7H A;  1XD4 A;  4EJN A;  1QC6 A;  3TFM A;  4P7I A;  4HB3 B;  3FSS A;  2GCJ A;  1K5D B;  1WG7 A;  2M14 A;  1V5U A;  3KRX A;  4IOY X;  1E5W A;  2Z0Q A;  2D2Q A;  2H7D A;  4HAV B;  2YS1 A;  2CRF A;  2EMT A;  3A98 B;  4A6H A;  1WGQ A;  5D27 A;  4A5K A;  2NMB A;  2DYQ A;  4EMO A;  1OY2 A;  2IYB A;  2Z0P A;  1EGX A;  2D9V A;  4K17 A;  3QWM A;  3AU5 A;  4HAZ B;  3F0W A;  3TW1 A;  3AJ4 A;  3SUZ A;  1IRS A;  5J3Y A;  4DX9 0;  3LJU X;  5HE3 A;  3HW2 B;  2J0K A;  3TVV A;  4WJ7 A;  1J19 A;  2LOZ A;  2COC A;  2AL6 A;  3PG7 A;  2GS0 A;  1AQC A;  4PQ0 A;  3BIN A;  1MIX A;  2HTH B;  3GYP A;  1U5D A;  1H4R A;  2COA A;  3PVW A;  1XX0 A;  2P0D A;  2ROV A;  2CY5 A;  2R09 A;  5CLQ B;  1UPQ A;  5L81 A;  1X05 A;  1P3R A;  3DXC A;  3SYX A;  2RLO A;  1DDW A;  4DXA B;  4KHO A;  5DIF B;  2R0D A;  3D8F A;  1MAI A;  2EMS A;  2YF0 A;  1ZC4 B;  3CXB B;  1MPH A;  1ZC3 B;  2YT0 A;  3PVL A;  3UZT A;  3G9W A;  3DXE A;  1UNQ A;  2DHI A;  3PVU A;  4TKN A;  5KCV A;  5D3W A;  4ZRJ A;  5GOW B;  3WYF B;  2RNR B;  2W2X C;  2ROZ B;  5C5B B;  1WJ1 A;  1NTY A;  4L6E A;  2P8V A;  4Y94 A;  1UNP A;  4YL8 A;  1Y5O A;  1FHO A;  2D9X A;  1LW3 A;  2DHJ A;  5DHA B;  1W1D A;  1XOD A;  2MKR A;  2M38 A;  1P5T A;  4GXB A;  2VKI A;  4IAP A;  3KY9 A;  1V89 A;  1FGY A;  1KZ7 A;  2OTX A;  1NI2 A;  1PMS A;  1WGU A;  4HHV A;  3ODW A;  2UZR A;  3KZ1 A;  2CY4 A;  4CYE A;  2D11 A;  1OMW A;  2UVM A;  4HB0 B;  1I7A A;  2P0F A;  2W2X D;  1PLS A;  2YSZ A;  2D9Z A;  2L1C A;  3OAN A;  2I1J A;  2DX5 A;  2D9W A;  4IFS A;  2ADZ A;  2CAY A;  4DBB A;  1MK9 B;  3ULB A; 
#chains in the Genus database with same CATH topology
 2Q13 A;  2COD A;  3A8P A;  5C16 A;  1ZVR A;  5EFX A;  2EJ8 A;  4K2P A;  5JHG A;  3BJI A;  4L1R A;  4QXA B;  1FGZ A;  2K2U A;  5C6R A;  5LOP B;  2V76 A;  2KUP A;  2DN6 A;  1DYN A;  2H7E A;  2K49 A;  2L2I A;  2UZS A;  4Z2M B;  4NY0 A;  4K81 A;  1U5G A;  3IVF A;  4QJ3 B;  1ISN A;  1PFJ A;  2LG1 A;  3MPX A;  2N23 A;  2YRY A;  3P6A A;  4A6K A;  1QQG A;  4TYZ A;  2FJL A;  4HAU B;  1ZSQ A;  3ODX A;  2G35 A;  3ODO A;  1MKE A;  1U5E A;  1EF1 A;  3PP2 A;  1V61 A;  3PZD A;  1KI1 B;  2YT2 A;  2Z13 A;  2GCL A;  3QBV B;  1GC6 A;  2Z0O A;  4KVG B;  3TO1 A;  3OHM B;  5I2S A;  2R2Y A;  4NSW A;  4WSF A;  3SV1 A;  1M7E A;  4HB2 B;  4KHA A;  1OQN A;  1BWN A;  2GUM A;  2DKP A;  5D3X A;  5J3Q A;  4GOU A;  2VRW B;  1X1G A;  2N0Y A;  4Z2N A;  1W1G A;  4HAY B;  2D10 A;  2LYD A;  1J0W A;  1P6S A;  2RUK B;  3M1I B;  2D9Y A;  2RGN B;  3ZDT A;  4HB4 B;  4F7U P;  5JP4 A;  2LOX A;  3SO6 A;  5KQ1 A;  4GN1 A;  2D4Q A;  1XCG A;  2AEH A;  4HDQ A;  4XWX A;  1X1F A;  2I5F A;  3AU4 A;  2DFK A;  3T06 A;  1BAK A;  1LB1 A;  2DTC A;  2Y8F A;  4WVF B;  2KGX B;  1H10 A;  2HE7 A;  3GYO A;  1NU2 A;  3X23 A;  3U12 A;  1Y19 B;  3FM8 C;  4ZRI A;  1FAO A;  2I1K A;  3KSY A;  1MI1 A;  5C79 A;  1UPR A;  2J0J A;  1MK7 B;  2LKO A;  3U8Z A;  4MT7 A;  4GMV A;  3NSU A;  4CHJ A;  2K00 A;  4HAW B;  1WI1 A;  1BTK A;  2K2J A;  4CSQ A;  2QKL A;  1B55 A;  1U2B A;  3TCA A;  2QKM A;  4C0A A;  1SHC A;  1WVH A;  3O96 A;  5DHF B;  2DYN A;  2DX1 A;  1FB8 A;  5D3V A;  5D3Y A;  3MDB C;  2ELB A;  1Z87 A;  1XR0 B;  2J0M A;  1X11 A;  5C5B A;  5HE0 A;  3CIK A;  1X86 A;  1W1H A;  1EAZ A;  1TQZ A;  2Z14 A;  2JP2 A;  4GMX B;  4ZRK A;  3ML4 A;  5HE2 A;  2IFS A;  1I2H A;  4MY6 A;  2Y8G A;  1RJ2 A;  3A8Q A;  3D8E A;  2E2X A;  3FEH A;  5KQ4 A;  2VSZ A;  1FHX A;  2EC1 A;  4PNK A;  4HAX B;  5JLJ B;  1N3H A;  4KHB B;  5IRS A;  1EVH A;  1UEF A;  2KCJ A;  5LON B;  1TJ6 A;  3HK0 A;  4MK0 A;  2RVB B;  4D6W A;  1GG3 A;  3ULC A;  2Z4D A;  2ELA A;  3D8D A;  3VOQ A;  1SGH A;  2YVC A;  2KIG A;  4DIX A;  1AWE A;  4D0N B;  1GC7 A;  2YS3 A;  2MFQ A;  4DX8 A;  3B77 A;  3NWD A;  1FHW A;  2XQN M;  3NW8 A;  5FI1 A;  1DBH A;  2RSG A;  2ZPY A;  1WJM A;  2BCJ A;  2J59 M;  5FI0 A;  5DH9 B;  1U5F A;  2DLW A;  1V88 A;  1DRO A;  1RRP B;  2MWN B;  1DDM A;  2LUL A;  2DA0 A;  3N7C A;  1NTV A;  4A6F A;  2KR0 A;  1TXD A;  2W2W A;  3KRW A;  1ZM0 A;  4QJ4 B;  5DI9 B;  1BTN A;  3F5R A;  2OQB A;  2GJY A;  3U7D A;  4KAX B;  3HQC A;  3P7Z A;  1MIZ B;  4BBK A;  3NWF A;  1ZYI A;  4F7G A;  2P0H A;  1DDV A;  4HAT B;  4K2O A;  2MDX A;  3A58 A;  2X18 A;  4GZU A;  1KZG A;  4H8S A;  2NZ8 B;  2FJU B;  1U29 A;  4HDO A;  3WA0 A;  3PEG A;  2YT1 A;  1V5P A;  1U27 A;  2DKQ A;  2Y7B A;  3ZVR A;  4KHB A;  5JHH A;  4B6H A;  3HSA A;  5J3T A;  2I5C A;  1XKE A;  3V5W A;  2DHK A;  3RCP A;  1V5M A;  3QIJ A;  1T77 A;  3PSC A;  2COF A;  4GPT B;  3DXD A;  1M7R A;  2PZ1 A;  2KUQ A;  4CHM A;  2YS5 A;  1K5G B;  1Q67 A;  1FOE A;  3VIA A;  4EKU A;  3SNH A;  4A6F B;  5CLL B;  4YON A;  1UNR A;  5HE1 A;  4OT1 A;  4F7H A;  3NWA A;  1XD4 A;  4EJN A;  1QC6 A;  4HSI A;  3TFM A;  4P7I A;  4HB3 B;  2NBV A;  3FSS A;  2GCJ A;  1K5D B;  1WG7 A;  2M14 A;  1V5U A;  3KRX A;  4IOY X;  1E5W A;  3DCX A;  2Z0Q A;  2D2Q A;  2H7D A;  4HAV B;  2YS1 A;  2CRF A;  2EMT A;  3A98 B;  4A6H A;  1WGQ A;  5D27 A;  4OSN A;  4A5K A;  2NMB A;  2DYQ A;  4EMO A;  2KIE A;  1OY2 A;  2IYB A;  2RRF A;  2Z0P A;  5M4Y B;  1EGX A;  2D9V A;  4K17 A;  2K8E A;  3QWM A;  3AU5 A;  4HAZ B;  3F0W A;  3TW1 A;  3AJ4 A;  3SUZ A;  1IRS A;  5J3Y A;  4DX9 0;  3LJU X;  5HE3 A;  3HW2 B;  2J0K A;  3TVV A;  4WJ7 A;  1J19 A;  2LOZ A;  2COC A;  2AL6 A;  3PG7 A;  2GS0 A;  3FVC A;  1AQC A;  4PQ0 A;  3BIN A;  1MIX A;  2HTH B;  3GYP A;  1U5D A;  1H4R A;  2COA A;  3PVW A;  1XX0 A;  2P0D A;  2ROV A;  2CY5 A;  2R09 A;  5CLQ B;  1UPQ A;  5L81 A;  1X05 A;  1P3R A;  3DXC A;  3SYX A;  2RLO A;  1DDW A;  4DXA B;  4KHO A;  5DIF B;  2R0D A;  3D8F A;  1MAI A;  2EMS A;  2YF0 A;  1ZC4 B;  5I2M A;  3CXB B;  1MPH A;  4QJ5 B;  1ZC3 B;  2YT0 A;  3PVL A;  3UZT A;  3G9W A;  3DXE A;  1UNQ A;  2DHI A;  3PVU A;  3HIE A;  4TKN A;  5KCV A;  5D3W A;  4ZRJ A;  5GOW B;  3WYF B;  2RNR B;  2ZKM X;  2W2X C;  2ROZ B;  5C5B B;  1WJ1 A;  1NTY A;  4L6E A;  2P8V A;  4Y94 A;  1UNP A;  4YL8 A;  1Y5O A;  1FHO A;  2D9X A;  1LW3 A;  2DHJ A;  5DHA B;  1W1D A;  1XOD A;  2MKR A;  2M38 A;  1P5T A;  4GXB A;  4GNK B;  2VKI A;  4IAP A;  5LG4 B;  3KY9 A;  1V89 A;  1FGY A;  1KZ7 A;  2OTX A;  1NI2 A;  1PMS A;  1WGU A;  4HHV A;  3ODW A;  2UZR A;  3KZ1 A;  2CY4 A;  4CYE A;  2D11 A;  1OMW A;  2UVM A;  4HB0 B;  1I7A A;  2P0F A;  2W2X D;  1PLS A;  2YSZ A;  2D9Z A;  2L1C A;  3OAN A;  2I1J A;  2DX5 A;  2D9W A;  2Z59 A;  4IFS A;  2ADZ A;  2CAY A;  4DBB A;  1MK9 B;  3ULB A; 
#chains in the Genus database with same CATH homology
 2Q13 A;  2COD A;  3A8P A;  5C16 A;  1ZVR A;  5EFX A;  2EJ8 A;  4K2P A;  5JHG A;  3BJI A;  1FGZ A;  2K2U A;  5C6R A;  5LOP B;  2V76 A;  2KUP A;  2DN6 A;  1DYN A;  2H7E A;  2L2I A;  2UZS A;  4Z2M B;  4NY0 A;  4K81 A;  1U5G A;  3IVF A;  1ISN A;  1PFJ A;  2LG1 A;  3MPX A;  2N23 A;  2YRY A;  3P6A A;  4A6K A;  1QQG A;  4TYZ A;  2FJL A;  4HAU B;  1ZSQ A;  3ODX A;  2G35 A;  3ODO A;  1MKE A;  1U5E A;  1EF1 A;  3PP2 A;  1V61 A;  3PZD A;  1KI1 B;  2GCL A;  3QBV B;  1GC6 A;  2Z0O A;  4KVG B;  3TO1 A;  4NSW A;  4WSF A;  3SV1 A;  1M7E A;  4HB2 B;  4KHA A;  1OQN A;  1BWN A;  2DKP A;  5D3X A;  5J3Q A;  2VRW B;  1X1G A;  2N0Y A;  4Z2N A;  1W1G A;  4HAY B;  2D10 A;  2LYD A;  1J0W A;  1P6S A;  2RUK B;  3M1I B;  2D9Y A;  2RGN B;  3ZDT A;  4HB4 B;  4F7U P;  5JP4 A;  2LOX A;  3SO6 A;  5KQ1 A;  4GN1 A;  2D4Q A;  1XCG A;  2AEH A;  4HDQ A;  4XWX A;  1X1F A;  2I5F A;  3AU4 A;  2DFK A;  3T06 A;  1BAK A;  1LB1 A;  2DTC A;  2Y8F A;  4WVF B;  2KGX B;  1H10 A;  2HE7 A;  3GYO A;  1NU2 A;  3X23 A;  1Y19 B;  3FM8 C;  4ZRI A;  1FAO A;  2I1K A;  3KSY A;  5C79 A;  1UPR A;  2J0J A;  1MK7 B;  2LKO A;  3U8Z A;  4MT7 A;  4GMV A;  3NSU A;  4CHJ A;  2K00 A;  4HAW B;  1WI1 A;  1BTK A;  2K2J A;  2QKL A;  1B55 A;  1U2B A;  3TCA A;  2QKM A;  4C0A A;  1SHC A;  1WVH A;  3O96 A;  5DHF B;  2DYN A;  2DX1 A;  1FB8 A;  5D3V A;  5D3Y A;  3MDB C;  2ELB A;  1Z87 A;  1XR0 B;  2J0M A;  1X11 A;  5C5B A;  5HE0 A;  3CIK A;  1X86 A;  1W1H A;  1EAZ A;  1TQZ A;  2JP2 A;  4GMX B;  4ZRK A;  3ML4 A;  5HE2 A;  2IFS A;  1I2H A;  4MY6 A;  2Y8G A;  1RJ2 A;  3A8Q A;  3D8E A;  2E2X A;  3FEH A;  5KQ4 A;  2VSZ A;  1FHX A;  2EC1 A;  4PNK A;  4HAX B;  5JLJ B;  1N3H A;  4KHB B;  1EVH A;  1UEF A;  2KCJ A;  5LON B;  1TJ6 A;  3HK0 A;  4MK0 A;  2RVB B;  1GG3 A;  3ULC A;  2ELA A;  3D8D A;  3VOQ A;  1SGH A;  2YVC A;  1AWE A;  4D0N B;  1GC7 A;  2YS3 A;  2MFQ A;  4DX8 A;  1FHW A;  2XQN M;  5FI1 A;  1DBH A;  2RSG A;  2ZPY A;  1WJM A;  2BCJ A;  2J59 M;  5FI0 A;  5DH9 B;  1U5F A;  2DLW A;  1V88 A;  1DRO A;  1RRP B;  2MWN B;  1DDM A;  2LUL A;  2DA0 A;  3N7C A;  1NTV A;  4A6F A;  1TXD A;  2W2W A;  3KRW A;  1ZM0 A;  5DI9 B;  1BTN A;  3F5R A;  2OQB A;  2GJY A;  3U7D A;  4KAX B;  3HQC A;  3P7Z A;  1MIZ B;  4BBK A;  4F7G A;  2P0H A;  1DDV A;  4HAT B;  4K2O A;  2MDX A;  2X18 A;  4GZU A;  1KZG A;  4H8S A;  2NZ8 B;  1U29 A;  4HDO A;  3WA0 A;  3PEG A;  2YT1 A;  1V5P A;  1U27 A;  2DKQ A;  2Y7B A;  3ZVR A;  5JHH A;  4B6H A;  5J3T A;  2I5C A;  1XKE A;  3V5W A;  2DHK A;  3RCP A;  1V5M A;  3QIJ A;  3PSC A;  2COF A;  4GPT B;  3DXD A;  1M7R A;  2PZ1 A;  4CHM A;  2YS5 A;  1K5G B;  1Q67 A;  1FOE A;  3VIA A;  4EKU A;  3SNH A;  4A6F B;  5CLL B;  4YON A;  1UNR A;  5HE1 A;  4F7H A;  1XD4 A;  4EJN A;  1QC6 A;  3TFM A;  4P7I A;  4HB3 B;  3FSS A;  2GCJ A;  1K5D B;  1WG7 A;  2M14 A;  1V5U A;  3KRX A;  4IOY X;  1E5W A;  2Z0Q A;  2D2Q A;  2H7D A;  4HAV B;  2YS1 A;  2CRF A;  2EMT A;  3A98 B;  4A6H A;  1WGQ A;  5D27 A;  4A5K A;  2NMB A;  2DYQ A;  4EMO A;  1OY2 A;  2IYB A;  2Z0P A;  1EGX A;  2D9V A;  4K17 A;  3QWM A;  3AU5 A;  4HAZ B;  3F0W A;  3TW1 A;  3AJ4 A;  3SUZ A;  1IRS A;  5J3Y A;  4DX9 0;  3LJU X;  5HE3 A;  3HW2 B;  2J0K A;  3TVV A;  4WJ7 A;  1J19 A;  2LOZ A;  2COC A;  2AL6 A;  3PG7 A;  2GS0 A;  1AQC A;  4PQ0 A;  3BIN A;  1MIX A;  2HTH B;  3GYP A;  1U5D A;  1H4R A;  2COA A;  3PVW A;  1XX0 A;  2P0D A;  2ROV A;  2CY5 A;  2R09 A;  5CLQ B;  1UPQ A;  5L81 A;  1X05 A;  1P3R A;  3DXC A;  3SYX A;  2RLO A;  1DDW A;  4DXA B;  4KHO A;  5DIF B;  2R0D A;  3D8F A;  1MAI A;  2EMS A;  2YF0 A;  1ZC4 B;  3CXB B;  1MPH A;  1ZC3 B;  2YT0 A;  3PVL A;  3UZT A;  3G9W A;  3DXE A;  1UNQ A;  2DHI A;  3PVU A;  4TKN A;  5KCV A;  5D3W A;  4ZRJ A;  5GOW B;  3WYF B;  2RNR B;  2W2X C;  2ROZ B;  5C5B B;  1WJ1 A;  1NTY A;  4L6E A;  2P8V A;  4Y94 A;  1UNP A;  4YL8 A;  1Y5O A;  1FHO A;  2D9X A;  1LW3 A;  2DHJ A;  5DHA B;  1W1D A;  1XOD A;  2MKR A;  2M38 A;  1P5T A;  4GXB A;  2VKI A;  4IAP A;  3KY9 A;  1V89 A;  1FGY A;  1KZ7 A;  2OTX A;  1NI2 A;  1PMS A;  1WGU A;  4HHV A;  3ODW A;  2UZR A;  3KZ1 A;  2CY4 A;  4CYE A;  2D11 A;  1OMW A;  2UVM A;  4HB0 B;  1I7A A;  2P0F A;  2W2X D;  1PLS A;  2YSZ A;  2D9Z A;  2L1C A;  3OAN A;  2I1J A;  2DX5 A;  2D9W A;  4IFS A;  2ADZ A;  2CAY A;  4DBB A;  1MK9 B;  3ULB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...