2VSZA

Crystal structure of the elmo1 ph domain
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
147
structure length
141
Chain Sequence
GPLGSPILELKEKIQPEILELIKQQRLNRLVEGTCFRKLNARRRQDKFWYCRLSPNHKVLHYGDLEESPQGEVPHDSLQDKLPVADIKAVVTGKDCPHMKENKEVLELAFSILYDSNCQLNFIAPDKHEYCIWTDGLNALL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Apoptosis
molecule keywords ENGULFMENT AND CELL MOTILITY PROTEIN 1
publication title An Alpha-Helical Extension of the Elmo1 Pleckstrin Homology Domain Mediates Direct Interaction to Dock180 and is Critical in Rac Signaling.
pubmed doi rcsb
source organism Homo sapiens
total genus 37
structure length 141
sequence length 147
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16457 PH_12 Pleckstrin homology domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2vszA02
1P5TA 5FI0A 2L1CA 4GPTB 2HE7A 3T06A 1EGXA 4YL8A 2IFSA 4TKNA 1K5DB 1U29A 4HB0B 1U5DA 4A6FA 2D9VA 1ZSQA 3TW1A 2Z0QA 2YT0A 4ZRKA 2M14A 4YONA 5D3VA 4KHAA 2LG1A 2DTCA 4HAVB 2OTXA 2P8VA 5DIFB 2ROZB 2H7DA 2EMTA 2RVBB 4F7HA 1U2BA 2KCJA 4HAYB 2M38A 4XWXA 3FM8C 4A6KA 2D4QA 1ZC3B 3VIAA 1FB8A 3DXDA 4CHMA 1NU2A 1FHOA 2NMBA 2W2WA 2KUPA 5C16A 4HHVA 2ADZA 2MKRA 3BINA 2AL6A 1X86A 3AU5A 3PSCA 2YSZA 2GCLA 2BCJA 4BBKA 5C5BA 2GCJA 3U8ZA 2CRFA 1UNPA 5KCVA 5C6RA 2J0KA 4Y94A 4HAUB 1NTVA 3FSSA 3IVFA 4PQ0A 4Z2NA 1V5UA 1RJ2A 2G35A 5D3WA 4C0AA 1X1FA 4K2OA 2I1KA 2EC1A 5EFXA 3SV1A 1XR0B 4IFSA 2J0MA 2Y8GA 5HE3A 4DX90 4ZRIA 1V89A 4PNKA 2I5FA 1FGYA 1WGUA 2VKIA 2GJYA 1Y19B 1X05A 5J3QA 5HE2A 3RCPA 2E2XA 3AJ4A 5JLJB 2VSZA 3QWMA 2MFQA 4HAXB 2DLWA 3SYXA 2D9ZA 1U27A 2DYNA 3NSUA 4CYEA 1LB1A 2LOXA 3P6AA 3P7ZA 2DKQA 1DBHA 3D8EA 2R0DA 2J0JA 2YS1A 2RGNB 2LYDA 5C5BB 4F7UP 1W1HA 2K2JA 4IAPA 2PZ1A 3WA0A 3TFMA 1U5FA 3VOQA 1FHXA 4KHOA 3KZ1A 1DROA 1ISNA 3AU4A 1Y5OA 1M7EA 2CY5A 5CLLB 4K2PA 4KAXB 1MIZB 1FAOA 2YRYA 1OY2A 4H8SA 1ZM0A 4WJ7A 3GYOA 3U7DA 3CIKA 1EF1A 4WVFB 4ZRJA 1UPQA 2IYBA 1KZ7A 3SUZA 2RNRB 2CODA 1X11A 2UZRA 5KQ4A 4CHJA 1ZVRA 2EJ8A 3PP2A 4K81A 2D11A 3BJIA 4GZUA 2MWNB 1N3HA 1PLSA 2DHJA 3A8QA 1H4RA 4GMVA 5JHHA 1NTYA 2RLOA 3D8FA 5DHFB 4HB3B 4HDOA 5GOWB 1XODA 2LKOA 1WJ1A 3MDBC 1AQCA 3CXBB 1SGHA 2Y8FA 4K17A 2K00A 1GC6A 4EJNA 2D10A 4MK0A 1UNRA 3QBVB 3ML4A 1RRPB 4A6FB 1FOEA 1Q67A 2N23A 5D3YA 2V76A 2COAA 1BAKA 2YVCA 5LOPB 2ROVA 4DXAB 2HTHB 2QKMA 3ODOA 2ELBA 3PEGA 2N0YA 3HW2B 4A6HA 4HDQA 2P0HA 4KHBB 1BTKA 4DX8A 5CLQB 2OQBA 4DBBA 1FHWA 1XCGA 2I5CA 4HATB 1MKEA 1UEFA 2D2QA 1AWEA 3FEHA 3PVWA 3OANA 2L2IA 4MY6A 3A8PA 1XKEA 2AEHA 2VRWB 2YF0A 5DH9B 3TCAA 4Z2MB 1P3RA 3WYFB 1GG3A 2JP2A 1K5GB 1WJMA 1H10A 3G9WA 1X1GA 1WG7A 1MAIA 2DHIA 2Y7BA 3PG7A 3LJUX 3KSYA 2UVMA 2Z0PA 5J3YA 5LONB 4WSFA 4KVGB 1DDWA 1U5GA 3KY9A 2I1JA 3ZVRA 1WI1A 5DHAB 2P0DA 1UNQA 4HAWB 5D3XA 2ELAA 2FJLA 3M1IB 5J3TA 1UPRA 1QQGA 2DHKA 4EMOA 1U5EA 4D0NB 4HB2B 2YT1A 1SHCA 5C79A 1Z87A 5KQ1A 2UZSA 5JHGA 1DDVA 2LOZA 2D9WA 4P7IA 1E5WA 1QC6A 5L81A 1MPHA 2RUKB 2CAYA 3ULCA 5JP4A 1IRSA 3HQCA 1TXDA 3SO6A 1V61A 2R09A 1V88A 2COFA 1WGQA 4F7GA 2Q13A 3QIJA 2DX5A 2D9YA 1DYNA 2KGXB 4GMXB 3GYPA 1EVHA 2P0FA 2DYQA 3O96A 4NY0A 5HE1A 2RSGA 5D27A 1P6SA 3ZDTA 2ZPYA 2DX1A 4EKUA 3KRWA 2GS0A 1DDMA 3D8DA 4HB4B 1PMSA 1V5MA 2LULA 1I2HA 1KZGA 1ZC4B 3DXCA 3ULBA 1B55A 4NSWA 3A98B 1W1DA 3V5WA 2DA0A 1MK9B 1M7RA 1GC7A 2EMSA 2DFKA 2H7EA 2W2XD 1OMWA 2MDXA 4B6HA 1PFJA 2NZ8B 4MT7A 4IOYX 2XQNM 2D9XA 2X18A 3KRXA 1LW3A 1J0WA 1V5PA 1WVHA 1FGZA 1BTNA 3TVVA 1I7AA 3PVUA 4HAZB 1BWNA 2J59M 1NI2A 1OQNA 1MK7B 2W2XC 3X23A 5HE0A 1XX0A 3SNHA 3UZTA 5DI9B 1KI1B 1TJ6A 2Z0OA 4GN1A 1XD4A 2COCA 2YS5A 3F5RA 1W1GA 2YS3A 2QKLA 3ODWA 1MIXA 3MPXA 2K2UA 3N7CA 5FI1A 1J19A 2DN6A 3TO1A 3HK0A 3PVLA 3F0WA 3ODXA 4TYZA 1TQZA 3DXEA 4A5KA 2DKPA 4GXBA 1EAZA 2CY4A 4L6EA 3PZDA
chains in the Genus database with same CATH superfamily
1P5TA 5FI0A 2L1CA 4GPTB 2HE7A 3T06A 1EGXA 4YL8A 2IFSA 4TKNA 1K5DB 1U29A 4HB0B 1U5DA 2KUQA 2D9VA 4A6FA 1ZSQA 3TW1A 2Z0QA 2YT0A 4ZRKA 2M14A 4YONA 5D3VA 4KHAA 2LG1A 3NWDA 1MI1A 2DTCA 4HAVB 2FJUB 2OTXA 2P8VA 5DIFB 2ROZB 2H7DA 2EMTA 2RVBB 4F7HA 1U2BA 2KCJA 3DCXA 4HAYB 2M38A 4XWXA 3FM8C 4A6KA 2D4QA 1ZC3B 3VIAA 5I2SA 1FB8A 3DXDA 4CHMA 1NU2A 1FHOA 2NMBA 2K8EA 2W2WA 2KUPA 5C16A 4HHVA 2ADZA 2MKRA 3BINA 2AL6A 1X86A 3AU5A 3PSCA 2YSZA 2Z4DA 2GCLA 2BCJA 4BBKA 5C5BA 2GCJA 3U8ZA 2CRFA 1UNPA 5KCVA 5C6RA 2J0KA 4Y94A 4HAUB 1NTVA 5IRSA 3FSSA 3IVFA 4PQ0A 4Z2NA 1V5UA 1RJ2A 2G35A 5D3WA 4C0AA 1X1FA 4K2OA 2I1KA 2EC1A 5EFXA 3SV1A 3HSAA 1XR0B 2ZKMX 4IFSA 2J0MA 2Y8GA 5HE3A 4DX90 4ZRIA 1V89A 4PNKA 2I5FA 1FGYA 1WGUA 2VKIA 2GJYA 1Y19B 1X05A 5J3QA 5HE2A 3RCPA 2E2XA 3AJ4A 2GUMA 5JLJB 2VSZA 3QWMA 2MFQA 4HAXB 2DLWA 3SYXA 2D9ZA 1U27A 2DYNA 3NSUA 4CYEA 1LB1A 2LOXA 3P6AA 3P7ZA 4QJ4B 2DKQA 2RRFA 1DBHA 3A58A 3D8EA 2R0DA 2J0JA 2YS1A 5I2MA 5M4YB 2RGNB 2LYDA 5C5BB 4F7UP 1W1HA 2K2JA 3B77A 4IAPA 2PZ1A 3WA0A 3TFMA 2KR0A 1U5FA 3VOQA 1FHXA 4KHOA 3KZ1A 1DROA 1ISNA 3AU4A 1Y5OA 1M7EA 2CY5A 5CLLB 4K2PA 4KAXB 1MIZB 1FAOA 2YRYA 1OY2A 4H8SA 1ZM0A 4WJ7A 3GYOA 4KHBA 3U7DA 3CIKA 1EF1A 4WVFB 2KIGA 4ZRJA 1UPQA 2IYBA 1KZ7A 3SUZA 2RNRB 2CODA 1X11A 2UZRA 5KQ4A 1ZYIA 4CHJA 1ZVRA 2EJ8A 3PP2A 4K81A 4L1RA 2D11A 3BJIA 4GZUA 2MWNB 1N3HA 1PLSA 2DHJA 2Z59A 3A8QA 1H4RA 4GMVA 5JHHA 1NTYA 2RLOA 3D8FA 5DHFB 4HB3B 3OHMB 4HDOA 5GOWB 1XODA 2LKOA 1WJ1A 3MDBC 1T77A 1AQCA 3CXBB 1SGHA 2Y8FA 4K17A 2K00A 1GC6A 4EJNA 2D10A 4MK0A 1UNRA 3QBVB 3ML4A 1RRPB 4A6FB 1FOEA 1Q67A 2N23A 4OT1A 5D3YA 2V76A 2COAA 1BAKA 2YVCA 5LOPB 2ROVA 4DXAB 2HTHB 2QKMA 3ODOA 2ELBA 3PEGA 2N0YA 3HW2B 4A6HA 4HDQA 2P0HA 4KHBB 1BTKA 4DX8A 5CLQB 2OQBA 4DBBA 1FHWA 1XCGA 2I5CA 4HATB 1MKEA 1UEFA 2D2QA 1AWEA 3FEHA 3PVWA 3OANA 2L2IA 4MY6A 5LG4B 3A8PA 1XKEA 4QJ5B 2AEHA 2VRWB 2YF0A 5DH9B 3TCAA 4Z2MB 1P3RA 3WYFB 1GG3A 2JP2A 1K5GB 1WJMA 1H10A 3G9WA 1X1GA 1WG7A 1MAIA 2DHIA 2Y7BA 3PG7A 3LJUX 3KSYA 2UVMA 2Z0PA 5J3YA 5LONB 4WSFA 4KVGB 1DDWA 1U5GA 3KY9A 2I1JA 3ZVRA 1WI1A 5DHAB 2P0DA 1UNQA 4HAWB 5D3XA 2ELAA 2FJLA 3M1IB 5J3TA 1UPRA 1QQGA 2DHKA 4EMOA 1U5EA 4D0NB 4GNKB 4DIXA 4HB2B 2YT1A 1SHCA 5C79A 1Z87A 5KQ1A 2UZSA 5JHGA 3NW8A 2R2YA 1DDVA 2LOZA 2D9WA 4P7IA 1E5WA 1QC6A 5L81A 1MPHA 2RUKB 3NWAA 2CAYA 3ULCA 5JP4A 2NBVA 1IRSA 3HQCA 1TXDA 3SO6A 1V61A 2R09A 1V88A 3NWFA 2COFA 1WGQA 2K49A 4F7GA 2Q13A 3QIJA 2DX5A 2D9YA 1DYNA 2KGXB 4GMXB 3GYPA 1EVHA 2P0FA 2DYQA 3O96A 4NY0A 5HE1A 2RSGA 5D27A 1P6SA 3ZDTA 2ZPYA 2DX1A 4EKUA 3KRWA 2GS0A 1DDMA 3D8DA 4HB4B 1PMSA 1V5MA 2LULA 4HSIA 1I2HA 1KZGA 1ZC4B 3DXCA 3ULBA 1B55A 2Z14A 4NSWA 3A98B 1W1DA 3V5WA 2YT2A 2DA0A 1MK9B 1M7RA 1GC7A 2EMSA 2DFKA 2H7EA 2W2XD 1OMWA 2MDXA 4B6HA 1PFJA 2NZ8B 4GOUA 4MT7A 4QJ3B 4IOYX 2XQNM 2D9XA 2X18A 3KRXA 1LW3A 1J0WA 1V5PA 1WVHA 1FGZA 1BTNA 3TVVA 1I7AA 3PVUA 4HAZB 1BWNA 2J59M 4QXAB 1NI2A 1OQNA 2Z13A 1MK7B 2W2XC 3X23A 5HE0A 1XX0A 3SNHA 3UZTA 5DI9B 1KI1B 1TJ6A 3U12A 2Z0OA 4GN1A 1XD4A 4CSQA 2COCA 2YS5A 3F5RA 1W1GA 2YS3A 2QKLA 3ODWA 1MIXA 3MPXA 4D6WA 3HIEA 4OSNA 2KIEA 2K2UA 3N7CA 5FI1A 1J19A 2DN6A 3TO1A 3HK0A 3PVLA 3F0WA 3ODXA 4TYZA 1TQZA 3DXEA 4A5KA 2DKPA 4GXBA 1EAZA 2CY4A 4L6EA 3FVCA 3PZDA
chains in the Genus database with same CATH topology
1P5TA 5FI0A 2L1CA 4GPTB 2HE7A 3T06A 1EGXA 4YL8A 2IFSA 4TKNA 1K5DB 1U29A 4HB0B 1U5DA 4A6FA 2D9VA 1ZSQA 3TW1A 2Z0QA 2YT0A 4ZRKA 2M14A 4YONA 5D3VA 4KHAA 2LG1A 2DTCA 4HAVB 2OTXA 2P8VA 5DIFB 2ROZB 2H7DA 2EMTA 2RVBB 4F7HA 1U2BA 2KCJA 4HAYB 2M38A 4XWXA 3FM8C 4A6KA 2D4QA 1ZC3B 3VIAA 1FB8A 3DXDA 4CHMA 1NU2A 1FHOA 2NMBA 2W2WA 2KUPA 5C16A 4HHVA 2ADZA 2MKRA 3BINA 2AL6A 1X86A 3AU5A 3PSCA 2YSZA 2GCLA 2BCJA 4BBKA 5C5BA 2GCJA 3U8ZA 2CRFA 1UNPA 5KCVA 5C6RA 2J0KA 4Y94A 4HAUB 1NTVA 3FSSA 3IVFA 4PQ0A 4Z2NA 1V5UA 1RJ2A 2G35A 5D3WA 4C0AA 1X1FA 4K2OA 2I1KA 2EC1A 5EFXA 3SV1A 1XR0B 4IFSA 2J0MA 2Y8GA 5HE3A 4DX90 4ZRIA 1V89A 4PNKA 2I5FA 1FGYA 1WGUA 2VKIA 2GJYA 1Y19B 1X05A 5J3QA 5HE2A 3RCPA 2E2XA 3AJ4A 5JLJB 2VSZA 3QWMA 2MFQA 4HAXB 2DLWA 3SYXA 2D9ZA 1U27A 2DYNA 3NSUA 4CYEA 1LB1A 2LOXA 3P6AA 3P7ZA 2DKQA 1DBHA 3D8EA 2R0DA 2J0JA 2YS1A 2RGNB 2LYDA 5C5BB 4F7UP 1W1HA 2K2JA 4IAPA 2PZ1A 3WA0A 3TFMA 1U5FA 3VOQA 1FHXA 4KHOA 3KZ1A 1DROA 1ISNA 3AU4A 1Y5OA 1M7EA 2CY5A 5CLLB 4K2PA 4KAXB 1MIZB 1FAOA 2YRYA 1OY2A 4H8SA 1ZM0A 4WJ7A 3GYOA 3U7DA 3CIKA 1EF1A 4WVFB 4ZRJA 1UPQA 2IYBA 1KZ7A 3SUZA 2RNRB 2CODA 1X11A 2UZRA 5KQ4A 4CHJA 1ZVRA 2EJ8A 3PP2A 4K81A 2D11A 3BJIA 4GZUA 2MWNB 1N3HA 1PLSA 2DHJA 3A8QA 1H4RA 4GMVA 5JHHA 1NTYA 2RLOA 3D8FA 5DHFB 4HB3B 4HDOA 5GOWB 1XODA 2LKOA 1WJ1A 3MDBC 1AQCA 3CXBB 1SGHA 2Y8FA 4K17A 2K00A 1GC6A 4EJNA 2D10A 4MK0A 1UNRA 3QBVB 3ML4A 1RRPB 4A6FB 1FOEA 1Q67A 2N23A 5D3YA 2V76A 2COAA 1BAKA 2YVCA 5LOPB 2ROVA 4DXAB 2HTHB 2QKMA 3ODOA 2ELBA 3PEGA 2N0YA 3HW2B 4A6HA 4HDQA 2P0HA 4KHBB 1BTKA 4DX8A 5CLQB 2OQBA 4DBBA 1FHWA 1XCGA 2I5CA 4HATB 1MKEA 1UEFA 2D2QA 1AWEA 3FEHA 3PVWA 3OANA 2L2IA 4MY6A 3A8PA 1XKEA 2AEHA 2VRWB 2YF0A 5DH9B 3TCAA 4Z2MB 1P3RA 3WYFB 1GG3A 2JP2A 1K5GB 1WJMA 1H10A 3G9WA 1X1GA 1WG7A 1MAIA 2DHIA 2Y7BA 3PG7A 3LJUX 3KSYA 2UVMA 2Z0PA 5J3YA 5LONB 4WSFA 4KVGB 1DDWA 1U5GA 3KY9A 2I1JA 3ZVRA 1WI1A 5DHAB 2P0DA 1UNQA 4HAWB 5D3XA 2ELAA 2FJLA 3M1IB 5J3TA 1UPRA 1QQGA 2DHKA 4EMOA 1U5EA 4D0NB 4HB2B 2YT1A 1SHCA 5C79A 1Z87A 5KQ1A 2UZSA 5JHGA 1DDVA 2LOZA 2D9WA 4P7IA 1E5WA 1QC6A 5L81A 1MPHA 2RUKB 2CAYA 3ULCA 5JP4A 1IRSA 3HQCA 1TXDA 3SO6A 1V61A 2R09A 1V88A 2COFA 1WGQA 4F7GA 2Q13A 3QIJA 2DX5A 2D9YA 1DYNA 2KGXB 4GMXB 3GYPA 1EVHA 2P0FA 2DYQA 3O96A 4NY0A 5HE1A 2RSGA 5D27A 1P6SA 3ZDTA 2ZPYA 2DX1A 4EKUA 3KRWA 2GS0A 1DDMA 3D8DA 4HB4B 1PMSA 1V5MA 2LULA 1I2HA 1KZGA 1ZC4B 3DXCA 3ULBA 1B55A 4NSWA 3A98B 1W1DA 3V5WA 2DA0A 1MK9B 1M7RA 1GC7A 2EMSA 2DFKA 2H7EA 2W2XD 1OMWA 2MDXA 4B6HA 1PFJA 2NZ8B 4MT7A 4IOYX 2XQNM 2D9XA 2X18A 3KRXA 1LW3A 1J0WA 1V5PA 1WVHA 1FGZA 1BTNA 3TVVA 1I7AA 3PVUA 4HAZB 1BWNA 2J59M 1NI2A 1OQNA 1MK7B 2W2XC 3X23A 5HE0A 1XX0A 3SNHA 3UZTA 5DI9B 1KI1B 1TJ6A 2Z0OA 4GN1A 1XD4A 2COCA 2YS5A 3F5RA 1W1GA 2YS3A 2QKLA 3ODWA 1MIXA 3MPXA 2K2UA 3N7CA 5FI1A 1J19A 2DN6A 3TO1A 3HK0A 3PVLA 3F0WA 3ODXA 4TYZA 1TQZA 3DXEA 4A5KA 2DKPA 4GXBA 1EAZA 2CY4A 4L6EA 3PZDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P5T A;  5FI0 A;  2L1C A;  4GPT B;  2HE7 A;  3T06 A;  1EGX A;  4YL8 A;  2IFS A;  4TKN A;  1K5D B;  1U29 A;  4HB0 B;  1U5D A;  4A6F A;  2D9V A;  1ZSQ A;  3TW1 A;  2Z0Q A;  2YT0 A;  4ZRK A;  2M14 A;  4YON A;  5D3V A;  4KHA A;  2LG1 A;  2DTC A;  4HAV B;  2OTX A;  2P8V A;  5DIF B;  2ROZ B;  2H7D A;  2EMT A;  2RVB B;  4F7H A;  1U2B A;  2KCJ A;  4HAY B;  2M38 A;  4XWX A;  3FM8 C;  4A6K A;  2D4Q A;  1ZC3 B;  3VIA A;  1FB8 A;  3DXD A;  4CHM A;  1NU2 A;  1FHO A;  2NMB A;  2W2W A;  2KUP A;  5C16 A;  4HHV A;  2ADZ A;  2MKR A;  3BIN A;  2AL6 A;  1X86 A;  3AU5 A;  3PSC A;  2YSZ A;  2GCL A;  2BCJ A;  4BBK A;  5C5B A;  2GCJ A;  3U8Z A;  2CRF A;  1UNP A;  5KCV A;  5C6R A;  2J0K A;  4Y94 A;  4HAU B;  1NTV A;  3FSS A;  3IVF A;  4PQ0 A;  4Z2N A;  1V5U A;  1RJ2 A;  2G35 A;  5D3W A;  4C0A A;  1X1F A;  4K2O A;  2I1K A;  2EC1 A;  5EFX A;  3SV1 A;  1XR0 B;  4IFS A;  2J0M A;  2Y8G A;  5HE3 A;  4DX9 0;  4ZRI A;  1V89 A;  4PNK A;  2I5F A;  1FGY A;  1WGU A;  2VKI A;  2GJY A;  1Y19 B;  1X05 A;  5J3Q A;  5HE2 A;  3RCP A;  2E2X A;  3AJ4 A;  5JLJ B;  2VSZ A;  3QWM A;  2MFQ A;  4HAX B;  2DLW A;  3SYX A;  2D9Z A;  1U27 A;  2DYN A;  3NSU A;  4CYE A;  1LB1 A;  2LOX A;  3P6A A;  3P7Z A;  2DKQ A;  1DBH A;  3D8E A;  2R0D A;  2J0J A;  2YS1 A;  2RGN B;  2LYD A;  5C5B B;  4F7U P;  1W1H A;  2K2J A;  4IAP A;  2PZ1 A;  3WA0 A;  3TFM A;  1U5F A;  3VOQ A;  1FHX A;  4KHO A;  3KZ1 A;  1DRO A;  1ISN A;  3AU4 A;  1Y5O A;  1M7E A;  2CY5 A;  5CLL B;  4K2P A;  4KAX B;  1MIZ B;  1FAO A;  2YRY A;  1OY2 A;  4H8S A;  1ZM0 A;  4WJ7 A;  3GYO A;  3U7D A;  3CIK A;  1EF1 A;  4WVF B;  4ZRJ A;  1UPQ A;  2IYB A;  1KZ7 A;  3SUZ A;  2RNR B;  2COD A;  1X11 A;  2UZR A;  5KQ4 A;  4CHJ A;  1ZVR A;  2EJ8 A;  3PP2 A;  4K81 A;  2D11 A;  3BJI A;  4GZU A;  2MWN B;  1N3H A;  1PLS A;  2DHJ A;  3A8Q A;  1H4R A;  4GMV A;  5JHH A;  1NTY A;  2RLO A;  3D8F A;  5DHF B;  4HB3 B;  4HDO A;  5GOW B;  1XOD A;  2LKO A;  1WJ1 A;  3MDB C;  1AQC A;  3CXB B;  1SGH A;  2Y8F A;  4K17 A;  2K00 A;  1GC6 A;  4EJN A;  2D10 A;  4MK0 A;  1UNR A;  3QBV B;  3ML4 A;  1RRP B;  4A6F B;  1FOE A;  1Q67 A;  2N23 A;  5D3Y A;  2V76 A;  2COA A;  1BAK A;  2YVC A;  5LOP B;  2ROV A;  4DXA B;  2HTH B;  2QKM A;  3ODO A;  2ELB A;  3PEG A;  2N0Y A;  3HW2 B;  4A6H A;  4HDQ A;  2P0H A;  4KHB B;  1BTK A;  4DX8 A;  5CLQ B;  2OQB A;  4DBB A;  1FHW A;  1XCG A;  2I5C A;  4HAT B;  1MKE A;  1UEF A;  2D2Q A;  1AWE A;  3FEH A;  3PVW A;  3OAN A;  2L2I A;  4MY6 A;  3A8P A;  1XKE A;  2AEH A;  2VRW B;  2YF0 A;  5DH9 B;  3TCA A;  4Z2M B;  1P3R A;  3WYF B;  1GG3 A;  2JP2 A;  1K5G B;  1WJM A;  1H10 A;  3G9W A;  1X1G A;  1WG7 A;  1MAI A;  2DHI A;  2Y7B A;  3PG7 A;  3LJU X;  3KSY A;  2UVM A;  2Z0P A;  5J3Y A;  5LON B;  4WSF A;  4KVG B;  1DDW A;  1U5G A;  3KY9 A;  2I1J A;  3ZVR A;  1WI1 A;  5DHA B;  2P0D A;  1UNQ A;  4HAW B;  5D3X A;  2ELA A;  2FJL A;  3M1I B;  5J3T A;  1UPR A;  1QQG A;  2DHK A;  4EMO A;  1U5E A;  4D0N B;  4HB2 B;  2YT1 A;  1SHC A;  5C79 A;  1Z87 A;  5KQ1 A;  2UZS A;  5JHG A;  1DDV A;  2LOZ A;  2D9W A;  4P7I A;  1E5W A;  1QC6 A;  5L81 A;  1MPH A;  2RUK B;  2CAY A;  3ULC A;  5JP4 A;  1IRS A;  3HQC A;  1TXD A;  3SO6 A;  1V61 A;  2R09 A;  1V88 A;  2COF A;  1WGQ A;  4F7G A;  2Q13 A;  3QIJ A;  2DX5 A;  2D9Y A;  1DYN A;  2KGX B;  4GMX B;  3GYP A;  1EVH A;  2P0F A;  2DYQ A;  3O96 A;  4NY0 A;  5HE1 A;  2RSG A;  5D27 A;  1P6S A;  3ZDT A;  2ZPY A;  2DX1 A;  4EKU A;  3KRW A;  2GS0 A;  1DDM A;  3D8D A;  4HB4 B;  1PMS A;  1V5M A;  2LUL A;  1I2H A;  1KZG A;  1ZC4 B;  3DXC A;  3ULB A;  1B55 A;  4NSW A;  3A98 B;  1W1D A;  3V5W A;  2DA0 A;  1MK9 B;  1M7R A;  1GC7 A;  2EMS A;  2DFK A;  2H7E A;  2W2X D;  1OMW A;  2MDX A;  4B6H A;  1PFJ A;  2NZ8 B;  4MT7 A;  4IOY X;  2XQN M;  2D9X A;  2X18 A;  3KRX A;  1LW3 A;  1J0W A;  1V5P A;  1WVH A;  1FGZ A;  1BTN A;  3TVV A;  1I7A A;  3PVU A;  4HAZ B;  1BWN A;  2J59 M;  1NI2 A;  1OQN A;  1MK7 B;  2W2X C;  3X23 A;  5HE0 A;  1XX0 A;  3SNH A;  3UZT A;  5DI9 B;  1KI1 B;  1TJ6 A;  2Z0O A;  4GN1 A;  1XD4 A;  2COC A;  2YS5 A;  3F5R A;  1W1G A;  2YS3 A;  2QKL A;  3ODW A;  1MIX A;  3MPX A;  2K2U A;  3N7C A;  5FI1 A;  1J19 A;  2DN6 A;  3TO1 A;  3HK0 A;  3PVL A;  3F0W A;  3ODX A;  4TYZ A;  1TQZ A;  3DXE A;  4A5K A;  2DKP A;  4GXB A;  1EAZ A;  2CY4 A;  4L6E A;  3PZD A; 
#chains in the Genus database with same CATH topology
 1P5T A;  5FI0 A;  2L1C A;  4GPT B;  2HE7 A;  3T06 A;  1EGX A;  4YL8 A;  2IFS A;  4TKN A;  1K5D B;  1U29 A;  4HB0 B;  1U5D A;  2KUQ A;  2D9V A;  4A6F A;  1ZSQ A;  3TW1 A;  2Z0Q A;  2YT0 A;  4ZRK A;  2M14 A;  4YON A;  5D3V A;  4KHA A;  2LG1 A;  3NWD A;  1MI1 A;  2DTC A;  4HAV B;  2FJU B;  2OTX A;  2P8V A;  5DIF B;  2ROZ B;  2H7D A;  2EMT A;  2RVB B;  4F7H A;  1U2B A;  2KCJ A;  3DCX A;  4HAY B;  2M38 A;  4XWX A;  3FM8 C;  4A6K A;  2D4Q A;  1ZC3 B;  3VIA A;  5I2S A;  1FB8 A;  3DXD A;  4CHM A;  1NU2 A;  1FHO A;  2NMB A;  2K8E A;  2W2W A;  2KUP A;  5C16 A;  4HHV A;  2ADZ A;  2MKR A;  3BIN A;  2AL6 A;  1X86 A;  3AU5 A;  3PSC A;  2YSZ A;  2Z4D A;  2GCL A;  2BCJ A;  4BBK A;  5C5B A;  2GCJ A;  3U8Z A;  2CRF A;  1UNP A;  5KCV A;  5C6R A;  2J0K A;  4Y94 A;  4HAU B;  1NTV A;  5IRS A;  3FSS A;  3IVF A;  4PQ0 A;  4Z2N A;  1V5U A;  1RJ2 A;  2G35 A;  5D3W A;  4C0A A;  1X1F A;  4K2O A;  2I1K A;  2EC1 A;  5EFX A;  3SV1 A;  3HSA A;  1XR0 B;  2ZKM X;  4IFS A;  2J0M A;  2Y8G A;  5HE3 A;  4DX9 0;  4ZRI A;  1V89 A;  4PNK A;  2I5F A;  1FGY A;  1WGU A;  2VKI A;  2GJY A;  1Y19 B;  1X05 A;  5J3Q A;  5HE2 A;  3RCP A;  2E2X A;  3AJ4 A;  2GUM A;  5JLJ B;  2VSZ A;  3QWM A;  2MFQ A;  4HAX B;  2DLW A;  3SYX A;  2D9Z A;  1U27 A;  2DYN A;  3NSU A;  4CYE A;  1LB1 A;  2LOX A;  3P6A A;  3P7Z A;  4QJ4 B;  2DKQ A;  2RRF A;  1DBH A;  3A58 A;  3D8E A;  2R0D A;  2J0J A;  2YS1 A;  5I2M A;  5M4Y B;  2RGN B;  2LYD A;  5C5B B;  4F7U P;  1W1H A;  2K2J A;  3B77 A;  4IAP A;  2PZ1 A;  3WA0 A;  3TFM A;  2KR0 A;  1U5F A;  3VOQ A;  1FHX A;  4KHO A;  3KZ1 A;  1DRO A;  1ISN A;  3AU4 A;  1Y5O A;  1M7E A;  2CY5 A;  5CLL B;  4K2P A;  4KAX B;  1MIZ B;  1FAO A;  2YRY A;  1OY2 A;  4H8S A;  1ZM0 A;  4WJ7 A;  3GYO A;  4KHB A;  3U7D A;  3CIK A;  1EF1 A;  4WVF B;  2KIG A;  4ZRJ A;  1UPQ A;  2IYB A;  1KZ7 A;  3SUZ A;  2RNR B;  2COD A;  1X11 A;  2UZR A;  5KQ4 A;  1ZYI A;  4CHJ A;  1ZVR A;  2EJ8 A;  3PP2 A;  4K81 A;  4L1R A;  2D11 A;  3BJI A;  4GZU A;  2MWN B;  1N3H A;  1PLS A;  2DHJ A;  2Z59 A;  3A8Q A;  1H4R A;  4GMV A;  5JHH A;  1NTY A;  2RLO A;  3D8F A;  5DHF B;  4HB3 B;  3OHM B;  4HDO A;  5GOW B;  1XOD A;  2LKO A;  1WJ1 A;  3MDB C;  1T77 A;  1AQC A;  3CXB B;  1SGH A;  2Y8F A;  4K17 A;  2K00 A;  1GC6 A;  4EJN A;  2D10 A;  4MK0 A;  1UNR A;  3QBV B;  3ML4 A;  1RRP B;  4A6F B;  1FOE A;  1Q67 A;  2N23 A;  4OT1 A;  5D3Y A;  2V76 A;  2COA A;  1BAK A;  2YVC A;  5LOP B;  2ROV A;  4DXA B;  2HTH B;  2QKM A;  3ODO A;  2ELB A;  3PEG A;  2N0Y A;  3HW2 B;  4A6H A;  4HDQ A;  2P0H A;  4KHB B;  1BTK A;  4DX8 A;  5CLQ B;  2OQB A;  4DBB A;  1FHW A;  1XCG A;  2I5C A;  4HAT B;  1MKE A;  1UEF A;  2D2Q A;  1AWE A;  3FEH A;  3PVW A;  3OAN A;  2L2I A;  4MY6 A;  5LG4 B;  3A8P A;  1XKE A;  4QJ5 B;  2AEH A;  2VRW B;  2YF0 A;  5DH9 B;  3TCA A;  4Z2M B;  1P3R A;  3WYF B;  1GG3 A;  2JP2 A;  1K5G B;  1WJM A;  1H10 A;  3G9W A;  1X1G A;  1WG7 A;  1MAI A;  2DHI A;  2Y7B A;  3PG7 A;  3LJU X;  3KSY A;  2UVM A;  2Z0P A;  5J3Y A;  5LON B;  4WSF A;  4KVG B;  1DDW A;  1U5G A;  3KY9 A;  2I1J A;  3ZVR A;  1WI1 A;  5DHA B;  2P0D A;  1UNQ A;  4HAW B;  5D3X A;  2ELA A;  2FJL A;  3M1I B;  5J3T A;  1UPR A;  1QQG A;  2DHK A;  4EMO A;  1U5E A;  4D0N B;  4GNK B;  4DIX A;  4HB2 B;  2YT1 A;  1SHC A;  5C79 A;  1Z87 A;  5KQ1 A;  2UZS A;  5JHG A;  3NW8 A;  2R2Y A;  1DDV A;  2LOZ A;  2D9W A;  4P7I A;  1E5W A;  1QC6 A;  5L81 A;  1MPH A;  2RUK B;  3NWA A;  2CAY A;  3ULC A;  5JP4 A;  2NBV A;  1IRS A;  3HQC A;  1TXD A;  3SO6 A;  1V61 A;  2R09 A;  1V88 A;  3NWF A;  2COF A;  1WGQ A;  2K49 A;  4F7G A;  2Q13 A;  3QIJ A;  2DX5 A;  2D9Y A;  1DYN A;  2KGX B;  4GMX B;  3GYP A;  1EVH A;  2P0F A;  2DYQ A;  3O96 A;  4NY0 A;  5HE1 A;  2RSG A;  5D27 A;  1P6S A;  3ZDT A;  2ZPY A;  2DX1 A;  4EKU A;  3KRW A;  2GS0 A;  1DDM A;  3D8D A;  4HB4 B;  1PMS A;  1V5M A;  2LUL A;  4HSI A;  1I2H A;  1KZG A;  1ZC4 B;  3DXC A;  3ULB A;  1B55 A;  2Z14 A;  4NSW A;  3A98 B;  1W1D A;  3V5W A;  2YT2 A;  2DA0 A;  1MK9 B;  1M7R A;  1GC7 A;  2EMS A;  2DFK A;  2H7E A;  2W2X D;  1OMW A;  2MDX A;  4B6H A;  1PFJ A;  2NZ8 B;  4GOU A;  4MT7 A;  4QJ3 B;  4IOY X;  2XQN M;  2D9X A;  2X18 A;  3KRX A;  1LW3 A;  1J0W A;  1V5P A;  1WVH A;  1FGZ A;  1BTN A;  3TVV A;  1I7A A;  3PVU A;  4HAZ B;  1BWN A;  2J59 M;  4QXA B;  1NI2 A;  1OQN A;  2Z13 A;  1MK7 B;  2W2X C;  3X23 A;  5HE0 A;  1XX0 A;  3SNH A;  3UZT A;  5DI9 B;  1KI1 B;  1TJ6 A;  3U12 A;  2Z0O A;  4GN1 A;  1XD4 A;  4CSQ A;  2COC A;  2YS5 A;  3F5R A;  1W1G A;  2YS3 A;  2QKL A;  3ODW A;  1MIX A;  3MPX A;  4D6W A;  3HIE A;  4OSN A;  2KIE A;  2K2U A;  3N7C A;  5FI1 A;  1J19 A;  2DN6 A;  3TO1 A;  3HK0 A;  3PVL A;  3F0W A;  3ODX A;  4TYZ A;  1TQZ A;  3DXE A;  4A5K A;  2DKP A;  4GXB A;  1EAZ A;  2CY4 A;  4L6E A;  3FVC A;  3PZD A; 
#chains in the Genus database with same CATH homology
 1P5T A;  5FI0 A;  2L1C A;  4GPT B;  2HE7 A;  3T06 A;  1EGX A;  4YL8 A;  2IFS A;  4TKN A;  1K5D B;  1U29 A;  4HB0 B;  1U5D A;  4A6F A;  2D9V A;  1ZSQ A;  3TW1 A;  2Z0Q A;  2YT0 A;  4ZRK A;  2M14 A;  4YON A;  5D3V A;  4KHA A;  2LG1 A;  2DTC A;  4HAV B;  2OTX A;  2P8V A;  5DIF B;  2ROZ B;  2H7D A;  2EMT A;  2RVB B;  4F7H A;  1U2B A;  2KCJ A;  4HAY B;  2M38 A;  4XWX A;  3FM8 C;  4A6K A;  2D4Q A;  1ZC3 B;  3VIA A;  1FB8 A;  3DXD A;  4CHM A;  1NU2 A;  1FHO A;  2NMB A;  2W2W A;  2KUP A;  5C16 A;  4HHV A;  2ADZ A;  2MKR A;  3BIN A;  2AL6 A;  1X86 A;  3AU5 A;  3PSC A;  2YSZ A;  2GCL A;  2BCJ A;  4BBK A;  5C5B A;  2GCJ A;  3U8Z A;  2CRF A;  1UNP A;  5KCV A;  5C6R A;  2J0K A;  4Y94 A;  4HAU B;  1NTV A;  3FSS A;  3IVF A;  4PQ0 A;  4Z2N A;  1V5U A;  1RJ2 A;  2G35 A;  5D3W A;  4C0A A;  1X1F A;  4K2O A;  2I1K A;  2EC1 A;  5EFX A;  3SV1 A;  1XR0 B;  4IFS A;  2J0M A;  2Y8G A;  5HE3 A;  4DX9 0;  4ZRI A;  1V89 A;  4PNK A;  2I5F A;  1FGY A;  1WGU A;  2VKI A;  2GJY A;  1Y19 B;  1X05 A;  5J3Q A;  5HE2 A;  3RCP A;  2E2X A;  3AJ4 A;  5JLJ B;  2VSZ A;  3QWM A;  2MFQ A;  4HAX B;  2DLW A;  3SYX A;  2D9Z A;  1U27 A;  2DYN A;  3NSU A;  4CYE A;  1LB1 A;  2LOX A;  3P6A A;  3P7Z A;  2DKQ A;  1DBH A;  3D8E A;  2R0D A;  2J0J A;  2YS1 A;  2RGN B;  2LYD A;  5C5B B;  4F7U P;  1W1H A;  2K2J A;  4IAP A;  2PZ1 A;  3WA0 A;  3TFM A;  1U5F A;  3VOQ A;  1FHX A;  4KHO A;  3KZ1 A;  1DRO A;  1ISN A;  3AU4 A;  1Y5O A;  1M7E A;  2CY5 A;  5CLL B;  4K2P A;  4KAX B;  1MIZ B;  1FAO A;  2YRY A;  1OY2 A;  4H8S A;  1ZM0 A;  4WJ7 A;  3GYO A;  3U7D A;  3CIK A;  1EF1 A;  4WVF B;  4ZRJ A;  1UPQ A;  2IYB A;  1KZ7 A;  3SUZ A;  2RNR B;  2COD A;  1X11 A;  2UZR A;  5KQ4 A;  4CHJ A;  1ZVR A;  2EJ8 A;  3PP2 A;  4K81 A;  2D11 A;  3BJI A;  4GZU A;  2MWN B;  1N3H A;  1PLS A;  2DHJ A;  3A8Q A;  1H4R A;  4GMV A;  5JHH A;  1NTY A;  2RLO A;  3D8F A;  5DHF B;  4HB3 B;  4HDO A;  5GOW B;  1XOD A;  2LKO A;  1WJ1 A;  3MDB C;  1AQC A;  3CXB B;  1SGH A;  2Y8F A;  4K17 A;  2K00 A;  1GC6 A;  4EJN A;  2D10 A;  4MK0 A;  1UNR A;  3QBV B;  3ML4 A;  1RRP B;  4A6F B;  1FOE A;  1Q67 A;  2N23 A;  5D3Y A;  2V76 A;  2COA A;  1BAK A;  2YVC A;  5LOP B;  2ROV A;  4DXA B;  2HTH B;  2QKM A;  3ODO A;  2ELB A;  3PEG A;  2N0Y A;  3HW2 B;  4A6H A;  4HDQ A;  2P0H A;  4KHB B;  1BTK A;  4DX8 A;  5CLQ B;  2OQB A;  4DBB A;  1FHW A;  1XCG A;  2I5C A;  4HAT B;  1MKE A;  1UEF A;  2D2Q A;  1AWE A;  3FEH A;  3PVW A;  3OAN A;  2L2I A;  4MY6 A;  3A8P A;  1XKE A;  2AEH A;  2VRW B;  2YF0 A;  5DH9 B;  3TCA A;  4Z2M B;  1P3R A;  3WYF B;  1GG3 A;  2JP2 A;  1K5G B;  1WJM A;  1H10 A;  3G9W A;  1X1G A;  1WG7 A;  1MAI A;  2DHI A;  2Y7B A;  3PG7 A;  3LJU X;  3KSY A;  2UVM A;  2Z0P A;  5J3Y A;  5LON B;  4WSF A;  4KVG B;  1DDW A;  1U5G A;  3KY9 A;  2I1J A;  3ZVR A;  1WI1 A;  5DHA B;  2P0D A;  1UNQ A;  4HAW B;  5D3X A;  2ELA A;  2FJL A;  3M1I B;  5J3T A;  1UPR A;  1QQG A;  2DHK A;  4EMO A;  1U5E A;  4D0N B;  4HB2 B;  2YT1 A;  1SHC A;  5C79 A;  1Z87 A;  5KQ1 A;  2UZS A;  5JHG A;  1DDV A;  2LOZ A;  2D9W A;  4P7I A;  1E5W A;  1QC6 A;  5L81 A;  1MPH A;  2RUK B;  2CAY A;  3ULC A;  5JP4 A;  1IRS A;  3HQC A;  1TXD A;  3SO6 A;  1V61 A;  2R09 A;  1V88 A;  2COF A;  1WGQ A;  4F7G A;  2Q13 A;  3QIJ A;  2DX5 A;  2D9Y A;  1DYN A;  2KGX B;  4GMX B;  3GYP A;  1EVH A;  2P0F A;  2DYQ A;  3O96 A;  4NY0 A;  5HE1 A;  2RSG A;  5D27 A;  1P6S A;  3ZDT A;  2ZPY A;  2DX1 A;  4EKU A;  3KRW A;  2GS0 A;  1DDM A;  3D8D A;  4HB4 B;  1PMS A;  1V5M A;  2LUL A;  1I2H A;  1KZG A;  1ZC4 B;  3DXC A;  3ULB A;  1B55 A;  4NSW A;  3A98 B;  1W1D A;  3V5W A;  2DA0 A;  1MK9 B;  1M7R A;  1GC7 A;  2EMS A;  2DFK A;  2H7E A;  2W2X D;  1OMW A;  2MDX A;  4B6H A;  1PFJ A;  2NZ8 B;  4MT7 A;  4IOY X;  2XQN M;  2D9X A;  2X18 A;  3KRX A;  1LW3 A;  1J0W A;  1V5P A;  1WVH A;  1FGZ A;  1BTN A;  3TVV A;  1I7A A;  3PVU A;  4HAZ B;  1BWN A;  2J59 M;  1NI2 A;  1OQN A;  1MK7 B;  2W2X C;  3X23 A;  5HE0 A;  1XX0 A;  3SNH A;  3UZT A;  5DI9 B;  1KI1 B;  1TJ6 A;  2Z0O A;  4GN1 A;  1XD4 A;  2COC A;  2YS5 A;  3F5R A;  1W1G A;  2YS3 A;  2QKL A;  3ODW A;  1MIX A;  3MPX A;  2K2U A;  3N7C A;  5FI1 A;  1J19 A;  2DN6 A;  3TO1 A;  3HK0 A;  3PVL A;  3F0W A;  3ODX A;  4TYZ A;  1TQZ A;  3DXE A;  4A5K A;  2DKP A;  4GXB A;  1EAZ A;  2CY4 A;  4L6E A;  3PZD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...