2VSZA

Crystal structure of the elmo1 ph domain
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
147
structure length
141
Chain Sequence
GPLGSPILELKEKIQPEILELIKQQRLNRLVEGTCFRKLNARRRQDKFWYCRLSPNHKVLHYGDLEESPQGEVPHDSLQDKLPVADIKAVVTGKDCPHMKENKEVLELAFSILYDSNCQLNFIAPDKHEYCIWTDGLNALL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ENGULFMENT AND CELL MOTILITY PROTEIN 1
publication title An Alpha-Helical Extension of the Elmo1 Pleckstrin Homology Domain Mediates Direct Interaction to Dock180 and is Critical in Rac Signaling.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Apoptosis
total genus 37
structure length 141
sequence length 147
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16457 PH_12 Pleckstrin homology domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2vszA02
4DX90 3SO6A 1MKEA 4HB3B 1KZ7A 5DH9B 3P7ZA 1Q67A 1U2BA 1TXDA 5FI1A 2LOXA 3O96A 2W2WA 2MFQA 1M7EA 4PNKA 2YRYA 3QIJA 3BINA 5D3VA 3TW1A 5D3WA 3IVFA 1ZSQA 2RLOA 1X11A 1U5DA 2D9XA 5LONB 1P5TA 2IYBA 2YT1A 1BAKA 4HB0B 4WSFA 3ODOA 1ZC4B 4TKNA 3ULCA 2R0DA 1FHXA 1EVHA 1MIZB 2CY4A 3SNHA 1MAIA 2UZSA 5KQ1A 2HE7A 4IAPA 4MY6A 4HAUB 2YT0A 3BJIA 2HTHB 3GYOA 1WGUA 1ZC3B 1LB1A 4EJNA 2KGXB 3PZDA 5DHFB 2R09A 3TO1A 2LULA 1UNRA 3CIKA 4HAYB 5HE3A 2DKQA 1V5MA 4A5KA 4HATB 2XQNM 1AWEA 1V5PA 4BBKA 2LYDA 3WYFB 1BTNA 1WJMA 2YVCA 2QKLA 1X1GA 2G35A 4HB2B 4H8SA 4GPTB 4NSWA 1EGXA 2DHJA 1WI1A 4K17A 3PG7A 1KZGA 3ML4A 2J0JA 4GZUA 3ULBA 5CLLB 2AL6A 5KQ4A 2BCJA 3V5WA 3MDBC 2PZ1A 1TQZA 1OY2A 4F7HA 5J3QA 1XKEA 1DYNA 1XX0A 2J0KA 3QBVB 2YSZA 3WA0A 3M1IB 4L6EA 1BWNA 2DKPA 4K2OA 2D10A 2H7DA 1GC6A 1H4RA 1FGZA 2CY5A 5JHGA 1XCGA 2MWNB 3MPXA 1U27A 5LOPB 3SUZA 2NMBA 2VKIA 2VSZA 4KVGB 4PQ0A 3U8ZA 2LKOA 1W1GA 1Y5OA 2D11A 2COAA 4ZRIA 3A8QA 5L81A 2RSGA 2H7EA 2KCJA 4K2PA 2EJ8A 4HDOA 4D0NB 1Z87A 1XR0B 2IFSA 3TCAA 5KCVA 2YS3A 5FI0A 3AU4A 1U5GA 2P0HA 2EC1A 2K2UA 1P6SA 3KSYA 2D4QA 5JHHA 3PEGA 3D8EA 1B55A 4NY0A 1EAZA 1I2HA 5DIFB 4F7GA 2Y7BA 4CYEA 3RCPA 4DX8A 3TVVA 1BTKA 1QQGA 2DX1A 3PVUA 2E2XA 3HK0A 2RGNB 1V5UA 5C5BB 1UEFA 1KI1B 4A6KA 4MT7A 1E5WA 3LJUX 1NI2A 4K81A 2ZPYA 1RRPB 3HQCA 1X1FA 2P0DA 2D9YA 1PFJA 1H10A 1MK9B 1FOEA 2D2QA 5C5BA 4A6FB 2FJLA 1W1HA 1N3HA 4HAWB 4EKUA 4DBBA 3GYPA 5J3YA 2DYQA 2JP2A 2EMTA 1PMSA 2Y8GA 2MDXA 3U7DA 2AEHA 1GG3A 4GXBA 4KHOA 4ZRJA 2YS5A 2J59M 1RJ2A 4A6FA 1OMWA 3PP2A 1DBHA 2Z0QA 1NU2A 5CLQB 3X23A 2GCJA 4HAVB 1GC7A 2ELBA 2YF0A 3A98B 2L1CA 1V89A 5JLJB 3KZ1A 1ZVRA 1X86A 3FM8C 3ODWA 4HAZB 3ZDTA 1U5FA 2I1KA 3F5RA 1J19A 3D8DA 5HE2A 1FHWA 3KRXA 2D9VA 1DDVA 5HE1A 1ISNA 3AJ4A 4MK0A 3VOQA 4CHMA 2LOZA 1K5DB 1P3RA 4EMOA 2P0FA 2L2IA 2M38A 1WVHA 1XD4A 1DDWA 1MIXA 1MK7B 3OANA 1FHOA 1SGHA 3F0WA 4KHAA 2K00A 2RNRB 3UZTA 3D8FA 1M7RA 4HB4B 2D9ZA 2KUPA 2ROVA 3TFMA 3VIAA 2J0MA 2CRFA 1IRSA 4Z2MB 2Q13A 1XODA 1FAOA 2MKRA 2LG1A 3SYXA 2Y8FA 4KHBB 2N0YA 2Z0PA 2GS0A 2ROZB 3FEHA 4Z2NA 1OQNA 1UNPA 4CHJA 1DDMA 2EMSA 3ODXA 2DX5A 2RUKB 4IOYX 1QC6A 3FSSA 3NSUA 4B6HA 2COFA 5C6RA 5GOWB 2D9WA 5C79A 2I5CA 4XWXA 2DHKA 5C16A 5EFXA 2UZRA 4HDQA 5DI9B 1ZM0A 3KY9A 4DXAB 2DHIA 2ADZA 2Z0OA 2I1JA 1WJ1A 1EF1A 1V61A 1J0WA 4YL8A 2I5FA 1U5EA 2OQBA 2OTXA 2GJYA 1W1DA 3P6AA 1TJ6A 2YS1A 5D27A 1FGYA 2QKMA 1WG7A 2DYNA 2N23A 1FB8A 4KAXB 5D3YA 2X18A 1AQCA 2RVBB 1NTYA 4YONA 2M14A 1K5GB 2K2JA 3PSCA 4C0AA 4HAXB 5DHAB 1UNQA 4A6HA 3KRWA 4WJ7A 2P8VA 1LW3A 3PVLA 5HE0A 3HW2B 1DROA 3AU5A 1WGQA 2DFKA 1MPHA 4GN1A 2VRWB 2UVMA 4GMVA 4ZRKA 5D3XA 4Y94A 3T06A 2ELAA 1Y19B 1V88A 5JP4A 1UPRA 3DXDA 2V76A 2DN6A 3PVWA 4IFSA 4F7UP 4P7IA 3G9WA 3CXBB 4TYZA 2COCA 4WVFB 2W2XC 2DTCA 2W2XD 1I7AA 2GCLA 4HHVA 1X05A 1U29A 2NZ8B 3N7CA 2CODA 3DXCA 2DLWA 3DXEA 3SV1A 1NTVA 3ZVRA 3QWMA 3A8PA 1PLSA 4GMXB 5J3TA 1SHCA 1UPQA 2DA0A 2CAYA
chains in the Genus database with same CATH superfamily
4DX90 3SO6A 1MKEA 3NWDA 1KZ7A 4HB3B 5DH9B 3P7ZA 4QJ3B 1Q67A 1U2BA 1TXDA 5FI1A 2LOXA 3O96A 2W2WA 2MFQA 1M7EA 4PNKA 2YRYA 3QIJA 3BINA 5D3VA 3TW1A 5D3WA 3IVFA 1ZSQA 2RLOA 1X11A 1U5DA 2D9XA 5LONB 1P5TA 2IYBA 4OSNA 2YT1A 1BAKA 4HB0B 4WSFA 3ODOA 1ZC4B 4TKNA 3ULCA 2R0DA 1FHXA 1EVHA 5I2MA 1MIZB 2CY4A 3SNHA 1MAIA 2UZSA 5KQ1A 3NWAA 2HE7A 4IAPA 4MY6A 4HAUB 2YT0A 3BJIA 2HTHB 3GYOA 1WGUA 1ZC3B 1LB1A 4EJNA 2KGXB 3PZDA 5DHFB 2R09A 3TO1A 2LULA 1UNRA 3CIKA 4HAYB 5HE3A 2DKQA 1V5MA 4A5KA 4HATB 2XQNM 1AWEA 1V5PA 4BBKA 2LYDA 3WYFB 1BTNA 1MI1A 1WJMA 2YVCA 2QKLA 1X1GA 2G35A 4HB2B 4H8SA 4GPTB 4NSWA 2YT2A 2DHJA 1EGXA 2NBVA 5LG4B 1WI1A 4K17A 3PG7A 1KZGA 3ML4A 2J0JA 4GZUA 3ULBA 5CLLB 2AL6A 5KQ4A 2BCJA 3V5WA 3MDBC 2PZ1A 1TQZA 1OY2A 4F7HA 5J3QA 1XKEA 1DYNA 1XX0A 2J0KA 3QBVB 2YSZA 3WA0A 3M1IB 4L6EA 1BWNA 2DKPA 4K2OA 2D10A 2H7DA 4D6WA 1GC6A 1H4RA 1FGZA 3DCXA 2CY5A 5JHGA 1XCGA 2MWNB 3MPXA 1U27A 5LOPB 3SUZA 2NMBA 2VKIA 2VSZA 4KVGB 4PQ0A 3U8ZA 2LKOA 3OHMB 1W1GA 1Y5OA 2ZKMX 2D11A 2COAA 4ZRIA 3A8QA 5L81A 2RSGA 2H7EA 2KCJA 4K2PA 2EJ8A 4HDOA 4D0NB 1Z87A 1XR0B 2IFSA 2FJUB 3TCAA 5KCVA 2YS3A 5FI0A 4OT1A 3AU4A 1U5GA 2P0HA 2EC1A 2K2UA 1P6SA 3KSYA 2D4QA 5JHHA 3PEGA 3D8EA 1B55A 4NY0A 1EAZA 1I2HA 5DIFB 4F7GA 2Y7BA 4CYEA 3RCPA 4DX8A 3TVVA 1BTKA 2KIGA 1QQGA 2DX1A 3PVUA 2E2XA 3HK0A 2RGNB 1V5UA 5C5BB 1UEFA 1KI1B 4A6KA 4MT7A 1E5WA 3LJUX 1NI2A 4K81A 4DIXA 2ZPYA 1RRPB 3HQCA 1X1FA 4KHBA 2P0DA 2D9YA 1PFJA 1H10A 1MK9B 1FOEA 2D2QA 2Z59A 5C5BA 4A6FB 2FJLA 3B77A 1W1HA 1N3HA 4HAWB 4EKUA 4DBBA 3GYPA 5J3YA 2DYQA 2JP2A 2EMTA 1PMSA 2Y8GA 4GOUA 2MDXA 3U7DA 2AEHA 1GG3A 2KIEA 4GXBA 4KHOA 4ZRJA 2YS5A 2KR0A 2J59M 1RJ2A 4A6FA 3NWFA 1OMWA 2Z4DA 3PP2A 1DBHA 2Z0QA 1NU2A 5CLQB 3X23A 3FVCA 2GCJA 4HAVB 1GC7A 2ELBA 2YF0A 3A98B 2R2YA 2L1CA 1V89A 5JLJB 3KZ1A 2K8EA 1ZVRA 1X86A 3FM8C 3ODWA 4HAZB 3ZDTA 1U5FA 2I1KA 3F5RA 5I2SA 4QXAB 1J19A 4QJ5B 3D8DA 1ZYIA 5HE2A 1FHWA 3KRXA 2D9VA 1DDVA 5HE1A 1ISNA 3AJ4A 4MK0A 3VOQA 4CHMA 5M4YB 2LOZA 1K5DB 1P3RA 4EMOA 2P0FA 2L2IA 2M38A 3HIEA 3U12A 1WVHA 1XD4A 1DDWA 1MIXA 1MK7B 3OANA 1FHOA 1SGHA 2RRFA 3F0WA 4KHAA 2K00A 2RNRB 3UZTA 3D8FA 2K49A 1M7RA 4HB4B 2D9ZA 2KUPA 2ROVA 3TFMA 3VIAA 2J0MA 2CRFA 1IRSA 4Z2MB 2Q13A 1XODA 1FAOA 2MKRA 2LG1A 3SYXA 2Y8FA 4KHBB 2N0YA 2Z0PA 4CSQA 2GS0A 2ROZB 4GNKB 3FEHA 4Z2NA 1OQNA 1UNPA 4CHJA 1DDMA 2EMSA 2KUQA 3ODXA 2DX5A 2RUKB 4IOYX 1QC6A 3FSSA 3NSUA 4B6HA 2COFA 5C6RA 5GOWB 2D9WA 5C79A 2I5CA 4XWXA 2DHKA 5C16A 5EFXA 2UZRA 4HDQA 5DI9B 1ZM0A 3KY9A 4QJ4B 4DXAB 2DHIA 2ADZA 2Z0OA 2I1JA 1WJ1A 1EF1A 1V61A 1J0WA 4YL8A 2I5FA 1U5EA 2OQBA 2OTXA 1T77A 2GJYA 1W1DA 3P6AA 1TJ6A 2YS1A 5D27A 1FGYA 2Z13A 2QKMA 1WG7A 2DYNA 3NW8A 2N23A 1FB8A 4KAXB 5D3YA 2X18A 1AQCA 2RVBB 1NTYA 4YONA 2M14A 1K5GB 2K2JA 3PSCA 4C0AA 4HAXB 5DHAB 1UNQA 4A6HA 3KRWA 4WJ7A 2P8VA 1LW3A 3PVLA 5HE0A 3HW2B 1DROA 3AU5A 1WGQA 2DFKA 1MPHA 4GN1A 2VRWB 2UVMA 4GMVA 4ZRKA 5D3XA 4HSIA 4Y94A 3T06A 2ELAA 1Y19B 1V88A 5JP4A 2GUMA 3DXDA 1UPRA 2V76A 2DN6A 3A58A 5IRSA 3PVWA 4IFSA 4F7UP 4P7IA 3G9WA 4L1RA 3CXBB 4TYZA 2COCA 4WVFB 2W2XC 2DTCA 2W2XD 1I7AA 2GCLA 4HHVA 1X05A 1U29A 2NZ8B 2Z14A 3N7CA 2CODA 3DXCA 2DLWA 3DXEA 3SV1A 1NTVA 3ZVRA 3QWMA 3A8PA 1PLSA 4GMXB 5J3TA 1SHCA 3HSAA 1UPQA 2DA0A 2CAYA
chains in the Genus database with same CATH topology
4DX90 3SO6A 1MKEA 4HB3B 1KZ7A 5DH9B 3P7ZA 1Q67A 1U2BA 1TXDA 5FI1A 2LOXA 3O96A 2W2WA 2MFQA 1M7EA 4PNKA 2YRYA 3QIJA 3BINA 5D3VA 3TW1A 5D3WA 3IVFA 1ZSQA 2RLOA 1X11A 1U5DA 2D9XA 5LONB 1P5TA 2IYBA 2YT1A 1BAKA 4HB0B 4WSFA 3ODOA 1ZC4B 4TKNA 3ULCA 2R0DA 1FHXA 1EVHA 1MIZB 2CY4A 3SNHA 1MAIA 2UZSA 5KQ1A 2HE7A 4IAPA 4MY6A 4HAUB 2YT0A 3BJIA 2HTHB 3GYOA 1WGUA 1ZC3B 1LB1A 4EJNA 2KGXB 3PZDA 5DHFB 2R09A 3TO1A 2LULA 1UNRA 3CIKA 4HAYB 5HE3A 2DKQA 1V5MA 4A5KA 4HATB 2XQNM 1AWEA 1V5PA 4BBKA 2LYDA 3WYFB 1BTNA 1WJMA 2YVCA 2QKLA 1X1GA 2G35A 4HB2B 4H8SA 4GPTB 4NSWA 1EGXA 2DHJA 1WI1A 4K17A 3PG7A 1KZGA 3ML4A 2J0JA 4GZUA 3ULBA 5CLLB 2AL6A 5KQ4A 2BCJA 3V5WA 3MDBC 2PZ1A 1TQZA 1OY2A 4F7HA 5J3QA 1XKEA 1DYNA 1XX0A 2J0KA 3QBVB 2YSZA 3WA0A 3M1IB 4L6EA 1BWNA 2DKPA 4K2OA 2D10A 2H7DA 1GC6A 1H4RA 1FGZA 2CY5A 5JHGA 1XCGA 2MWNB 3MPXA 1U27A 5LOPB 3SUZA 2NMBA 2VKIA 2VSZA 4KVGB 4PQ0A 3U8ZA 2LKOA 1W1GA 1Y5OA 2D11A 2COAA 4ZRIA 3A8QA 5L81A 2RSGA 2H7EA 2KCJA 4K2PA 2EJ8A 4HDOA 4D0NB 1Z87A 1XR0B 2IFSA 3TCAA 5KCVA 2YS3A 5FI0A 3AU4A 1U5GA 2P0HA 2EC1A 2K2UA 1P6SA 3KSYA 2D4QA 5JHHA 3PEGA 3D8EA 1B55A 4NY0A 1EAZA 1I2HA 5DIFB 4F7GA 2Y7BA 4CYEA 3RCPA 4DX8A 3TVVA 1BTKA 1QQGA 2DX1A 3PVUA 2E2XA 3HK0A 2RGNB 1V5UA 5C5BB 1UEFA 1KI1B 4A6KA 4MT7A 1E5WA 3LJUX 1NI2A 4K81A 2ZPYA 1RRPB 3HQCA 1X1FA 2P0DA 2D9YA 1PFJA 1H10A 1MK9B 1FOEA 2D2QA 5C5BA 4A6FB 2FJLA 1W1HA 1N3HA 4HAWB 4EKUA 4DBBA 3GYPA 5J3YA 2DYQA 2JP2A 2EMTA 1PMSA 2Y8GA 2MDXA 3U7DA 2AEHA 1GG3A 4GXBA 4KHOA 4ZRJA 2YS5A 2J59M 1RJ2A 4A6FA 1OMWA 3PP2A 1DBHA 2Z0QA 1NU2A 5CLQB 3X23A 2GCJA 4HAVB 1GC7A 2ELBA 2YF0A 3A98B 2L1CA 1V89A 5JLJB 3KZ1A 1ZVRA 1X86A 3FM8C 3ODWA 4HAZB 3ZDTA 1U5FA 2I1KA 3F5RA 1J19A 3D8DA 5HE2A 1FHWA 3KRXA 2D9VA 1DDVA 5HE1A 1ISNA 3AJ4A 4MK0A 3VOQA 4CHMA 2LOZA 1K5DB 1P3RA 4EMOA 2P0FA 2L2IA 2M38A 1WVHA 1XD4A 1DDWA 1MIXA 1MK7B 3OANA 1FHOA 1SGHA 3F0WA 4KHAA 2K00A 2RNRB 3UZTA 3D8FA 1M7RA 4HB4B 2D9ZA 2KUPA 2ROVA 3TFMA 3VIAA 2J0MA 2CRFA 1IRSA 4Z2MB 2Q13A 1XODA 1FAOA 2MKRA 2LG1A 3SYXA 2Y8FA 4KHBB 2N0YA 2Z0PA 2GS0A 2ROZB 3FEHA 4Z2NA 1OQNA 1UNPA 4CHJA 1DDMA 2EMSA 3ODXA 2DX5A 2RUKB 4IOYX 1QC6A 3FSSA 3NSUA 4B6HA 2COFA 5C6RA 5GOWB 2D9WA 5C79A 2I5CA 4XWXA 2DHKA 5C16A 5EFXA 2UZRA 4HDQA 5DI9B 1ZM0A 3KY9A 4DXAB 2DHIA 2ADZA 2Z0OA 2I1JA 1WJ1A 1EF1A 1V61A 1J0WA 4YL8A 2I5FA 1U5EA 2OQBA 2OTXA 2GJYA 1W1DA 3P6AA 1TJ6A 2YS1A 5D27A 1FGYA 2QKMA 1WG7A 2DYNA 2N23A 1FB8A 4KAXB 5D3YA 2X18A 1AQCA 2RVBB 1NTYA 4YONA 2M14A 1K5GB 2K2JA 3PSCA 4C0AA 4HAXB 5DHAB 1UNQA 4A6HA 3KRWA 4WJ7A 2P8VA 1LW3A 3PVLA 5HE0A 3HW2B 1DROA 3AU5A 1WGQA 2DFKA 1MPHA 4GN1A 2VRWB 2UVMA 4GMVA 4ZRKA 5D3XA 4Y94A 3T06A 2ELAA 1Y19B 1V88A 5JP4A 1UPRA 3DXDA 2V76A 2DN6A 3PVWA 4IFSA 4F7UP 4P7IA 3G9WA 3CXBB 4TYZA 2COCA 4WVFB 2W2XC 2DTCA 2W2XD 1I7AA 2GCLA 4HHVA 1X05A 1U29A 2NZ8B 3N7CA 2CODA 3DXCA 2DLWA 3DXEA 3SV1A 1NTVA 3ZVRA 3QWMA 3A8PA 1PLSA 4GMXB 5J3TA 1SHCA 1UPQA 2DA0A 2CAYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DX9 0;  3SO6 A;  1MKE A;  4HB3 B;  1KZ7 A;  5DH9 B;  3P7Z A;  1Q67 A;  1U2B A;  1TXD A;  5FI1 A;  2LOX A;  3O96 A;  2W2W A;  2MFQ A;  1M7E A;  4PNK A;  2YRY A;  3QIJ A;  3BIN A;  5D3V A;  3TW1 A;  5D3W A;  3IVF A;  1ZSQ A;  2RLO A;  1X11 A;  1U5D A;  2D9X A;  5LON B;  1P5T A;  2IYB A;  2YT1 A;  1BAK A;  4HB0 B;  4WSF A;  3ODO A;  1ZC4 B;  4TKN A;  3ULC A;  2R0D A;  1FHX A;  1EVH A;  1MIZ B;  2CY4 A;  3SNH A;  1MAI A;  2UZS A;  5KQ1 A;  2HE7 A;  4IAP A;  4MY6 A;  4HAU B;  2YT0 A;  3BJI A;  2HTH B;  3GYO A;  1WGU A;  1ZC3 B;  1LB1 A;  4EJN A;  2KGX B;  3PZD A;  5DHF B;  2R09 A;  3TO1 A;  2LUL A;  1UNR A;  3CIK A;  4HAY B;  5HE3 A;  2DKQ A;  1V5M A;  4A5K A;  4HAT B;  2XQN M;  1AWE A;  1V5P A;  4BBK A;  2LYD A;  3WYF B;  1BTN A;  1WJM A;  2YVC A;  2QKL A;  1X1G A;  2G35 A;  4HB2 B;  4H8S A;  4GPT B;  4NSW A;  1EGX A;  2DHJ A;  1WI1 A;  4K17 A;  3PG7 A;  1KZG A;  3ML4 A;  2J0J A;  4GZU A;  3ULB A;  5CLL B;  2AL6 A;  5KQ4 A;  2BCJ A;  3V5W A;  3MDB C;  2PZ1 A;  1TQZ A;  1OY2 A;  4F7H A;  5J3Q A;  1XKE A;  1DYN A;  1XX0 A;  2J0K A;  3QBV B;  2YSZ A;  3WA0 A;  3M1I B;  4L6E A;  1BWN A;  2DKP A;  4K2O A;  2D10 A;  2H7D A;  1GC6 A;  1H4R A;  1FGZ A;  2CY5 A;  5JHG A;  1XCG A;  2MWN B;  3MPX A;  1U27 A;  5LOP B;  3SUZ A;  2NMB A;  2VKI A;  2VSZ A;  4KVG B;  4PQ0 A;  3U8Z A;  2LKO A;  1W1G A;  1Y5O A;  2D11 A;  2COA A;  4ZRI A;  3A8Q A;  5L81 A;  2RSG A;  2H7E A;  2KCJ A;  4K2P A;  2EJ8 A;  4HDO A;  4D0N B;  1Z87 A;  1XR0 B;  2IFS A;  3TCA A;  5KCV A;  2YS3 A;  5FI0 A;  3AU4 A;  1U5G A;  2P0H A;  2EC1 A;  2K2U A;  1P6S A;  3KSY A;  2D4Q A;  5JHH A;  3PEG A;  3D8E A;  1B55 A;  4NY0 A;  1EAZ A;  1I2H A;  5DIF B;  4F7G A;  2Y7B A;  4CYE A;  3RCP A;  4DX8 A;  3TVV A;  1BTK A;  1QQG A;  2DX1 A;  3PVU A;  2E2X A;  3HK0 A;  2RGN B;  1V5U A;  5C5B B;  1UEF A;  1KI1 B;  4A6K A;  4MT7 A;  1E5W A;  3LJU X;  1NI2 A;  4K81 A;  2ZPY A;  1RRP B;  3HQC A;  1X1F A;  2P0D A;  2D9Y A;  1PFJ A;  1H10 A;  1MK9 B;  1FOE A;  2D2Q A;  5C5B A;  4A6F B;  2FJL A;  1W1H A;  1N3H A;  4HAW B;  4EKU A;  4DBB A;  3GYP A;  5J3Y A;  2DYQ A;  2JP2 A;  2EMT A;  1PMS A;  2Y8G A;  2MDX A;  3U7D A;  2AEH A;  1GG3 A;  4GXB A;  4KHO A;  4ZRJ A;  2YS5 A;  2J59 M;  1RJ2 A;  4A6F A;  1OMW A;  3PP2 A;  1DBH A;  2Z0Q A;  1NU2 A;  5CLQ B;  3X23 A;  2GCJ A;  4HAV B;  1GC7 A;  2ELB A;  2YF0 A;  3A98 B;  2L1C A;  1V89 A;  5JLJ B;  3KZ1 A;  1ZVR A;  1X86 A;  3FM8 C;  3ODW A;  4HAZ B;  3ZDT A;  1U5F A;  2I1K A;  3F5R A;  1J19 A;  3D8D A;  5HE2 A;  1FHW A;  3KRX A;  2D9V A;  1DDV A;  5HE1 A;  1ISN A;  3AJ4 A;  4MK0 A;  3VOQ A;  4CHM A;  2LOZ A;  1K5D B;  1P3R A;  4EMO A;  2P0F A;  2L2I A;  2M38 A;  1WVH A;  1XD4 A;  1DDW A;  1MIX A;  1MK7 B;  3OAN A;  1FHO A;  1SGH A;  3F0W A;  4KHA A;  2K00 A;  2RNR B;  3UZT A;  3D8F A;  1M7R A;  4HB4 B;  2D9Z A;  2KUP A;  2ROV A;  3TFM A;  3VIA A;  2J0M A;  2CRF A;  1IRS A;  4Z2M B;  2Q13 A;  1XOD A;  1FAO A;  2MKR A;  2LG1 A;  3SYX A;  2Y8F A;  4KHB B;  2N0Y A;  2Z0P A;  2GS0 A;  2ROZ B;  3FEH A;  4Z2N A;  1OQN A;  1UNP A;  4CHJ A;  1DDM A;  2EMS A;  3ODX A;  2DX5 A;  2RUK B;  4IOY X;  1QC6 A;  3FSS A;  3NSU A;  4B6H A;  2COF A;  5C6R A;  5GOW B;  2D9W A;  5C79 A;  2I5C A;  4XWX A;  2DHK A;  5C16 A;  5EFX A;  2UZR A;  4HDQ A;  5DI9 B;  1ZM0 A;  3KY9 A;  4DXA B;  2DHI A;  2ADZ A;  2Z0O A;  2I1J A;  1WJ1 A;  1EF1 A;  1V61 A;  1J0W A;  4YL8 A;  2I5F A;  1U5E A;  2OQB A;  2OTX A;  2GJY A;  1W1D A;  3P6A A;  1TJ6 A;  2YS1 A;  5D27 A;  1FGY A;  2QKM A;  1WG7 A;  2DYN A;  2N23 A;  1FB8 A;  4KAX B;  5D3Y A;  2X18 A;  1AQC A;  2RVB B;  1NTY A;  4YON A;  2M14 A;  1K5G B;  2K2J A;  3PSC A;  4C0A A;  4HAX B;  5DHA B;  1UNQ A;  4A6H A;  3KRW A;  4WJ7 A;  2P8V A;  1LW3 A;  3PVL A;  5HE0 A;  3HW2 B;  1DRO A;  3AU5 A;  1WGQ A;  2DFK A;  1MPH A;  4GN1 A;  2VRW B;  2UVM A;  4GMV A;  4ZRK A;  5D3X A;  4Y94 A;  3T06 A;  2ELA A;  1Y19 B;  1V88 A;  5JP4 A;  1UPR A;  3DXD A;  2V76 A;  2DN6 A;  3PVW A;  4IFS A;  4F7U P;  4P7I A;  3G9W A;  3CXB B;  4TYZ A;  2COC A;  4WVF B;  2W2X C;  2DTC A;  2W2X D;  1I7A A;  2GCL A;  4HHV A;  1X05 A;  1U29 A;  2NZ8 B;  3N7C A;  2COD A;  3DXC A;  2DLW A;  3DXE A;  3SV1 A;  1NTV A;  3ZVR A;  3QWM A;  3A8P A;  1PLS A;  4GMX B;  5J3T A;  1SHC A;  1UPQ A;  2DA0 A;  2CAY A; 
#chains in the Genus database with same CATH topology
 4DX9 0;  3SO6 A;  1MKE A;  3NWD A;  1KZ7 A;  4HB3 B;  5DH9 B;  3P7Z A;  4QJ3 B;  1Q67 A;  1U2B A;  1TXD A;  5FI1 A;  2LOX A;  3O96 A;  2W2W A;  2MFQ A;  1M7E A;  4PNK A;  2YRY A;  3QIJ A;  3BIN A;  5D3V A;  3TW1 A;  5D3W A;  3IVF A;  1ZSQ A;  2RLO A;  1X11 A;  1U5D A;  2D9X A;  5LON B;  1P5T A;  2IYB A;  4OSN A;  2YT1 A;  1BAK A;  4HB0 B;  4WSF A;  3ODO A;  1ZC4 B;  4TKN A;  3ULC A;  2R0D A;  1FHX A;  1EVH A;  5I2M A;  1MIZ B;  2CY4 A;  3SNH A;  1MAI A;  2UZS A;  5KQ1 A;  3NWA A;  2HE7 A;  4IAP A;  4MY6 A;  4HAU B;  2YT0 A;  3BJI A;  2HTH B;  3GYO A;  1WGU A;  1ZC3 B;  1LB1 A;  4EJN A;  2KGX B;  3PZD A;  5DHF B;  2R09 A;  3TO1 A;  2LUL A;  1UNR A;  3CIK A;  4HAY B;  5HE3 A;  2DKQ A;  1V5M A;  4A5K A;  4HAT B;  2XQN M;  1AWE A;  1V5P A;  4BBK A;  2LYD A;  3WYF B;  1BTN A;  1MI1 A;  1WJM A;  2YVC A;  2QKL A;  1X1G A;  2G35 A;  4HB2 B;  4H8S A;  4GPT B;  4NSW A;  2YT2 A;  2DHJ A;  1EGX A;  2NBV A;  5LG4 B;  1WI1 A;  4K17 A;  3PG7 A;  1KZG A;  3ML4 A;  2J0J A;  4GZU A;  3ULB A;  5CLL B;  2AL6 A;  5KQ4 A;  2BCJ A;  3V5W A;  3MDB C;  2PZ1 A;  1TQZ A;  1OY2 A;  4F7H A;  5J3Q A;  1XKE A;  1DYN A;  1XX0 A;  2J0K A;  3QBV B;  2YSZ A;  3WA0 A;  3M1I B;  4L6E A;  1BWN A;  2DKP A;  4K2O A;  2D10 A;  2H7D A;  4D6W A;  1GC6 A;  1H4R A;  1FGZ A;  3DCX A;  2CY5 A;  5JHG A;  1XCG A;  2MWN B;  3MPX A;  1U27 A;  5LOP B;  3SUZ A;  2NMB A;  2VKI A;  2VSZ A;  4KVG B;  4PQ0 A;  3U8Z A;  2LKO A;  3OHM B;  1W1G A;  1Y5O A;  2ZKM X;  2D11 A;  2COA A;  4ZRI A;  3A8Q A;  5L81 A;  2RSG A;  2H7E A;  2KCJ A;  4K2P A;  2EJ8 A;  4HDO A;  4D0N B;  1Z87 A;  1XR0 B;  2IFS A;  2FJU B;  3TCA A;  5KCV A;  2YS3 A;  5FI0 A;  4OT1 A;  3AU4 A;  1U5G A;  2P0H A;  2EC1 A;  2K2U A;  1P6S A;  3KSY A;  2D4Q A;  5JHH A;  3PEG A;  3D8E A;  1B55 A;  4NY0 A;  1EAZ A;  1I2H A;  5DIF B;  4F7G A;  2Y7B A;  4CYE A;  3RCP A;  4DX8 A;  3TVV A;  1BTK A;  2KIG A;  1QQG A;  2DX1 A;  3PVU A;  2E2X A;  3HK0 A;  2RGN B;  1V5U A;  5C5B B;  1UEF A;  1KI1 B;  4A6K A;  4MT7 A;  1E5W A;  3LJU X;  1NI2 A;  4K81 A;  4DIX A;  2ZPY A;  1RRP B;  3HQC A;  1X1F A;  4KHB A;  2P0D A;  2D9Y A;  1PFJ A;  1H10 A;  1MK9 B;  1FOE A;  2D2Q A;  2Z59 A;  5C5B A;  4A6F B;  2FJL A;  3B77 A;  1W1H A;  1N3H A;  4HAW B;  4EKU A;  4DBB A;  3GYP A;  5J3Y A;  2DYQ A;  2JP2 A;  2EMT A;  1PMS A;  2Y8G A;  4GOU A;  2MDX A;  3U7D A;  2AEH A;  1GG3 A;  2KIE A;  4GXB A;  4KHO A;  4ZRJ A;  2YS5 A;  2KR0 A;  2J59 M;  1RJ2 A;  4A6F A;  3NWF A;  1OMW A;  2Z4D A;  3PP2 A;  1DBH A;  2Z0Q A;  1NU2 A;  5CLQ B;  3X23 A;  3FVC A;  2GCJ A;  4HAV B;  1GC7 A;  2ELB A;  2YF0 A;  3A98 B;  2R2Y A;  2L1C A;  1V89 A;  5JLJ B;  3KZ1 A;  2K8E A;  1ZVR A;  1X86 A;  3FM8 C;  3ODW A;  4HAZ B;  3ZDT A;  1U5F A;  2I1K A;  3F5R A;  5I2S A;  4QXA B;  1J19 A;  4QJ5 B;  3D8D A;  1ZYI A;  5HE2 A;  1FHW A;  3KRX A;  2D9V A;  1DDV A;  5HE1 A;  1ISN A;  3AJ4 A;  4MK0 A;  3VOQ A;  4CHM A;  5M4Y B;  2LOZ A;  1K5D B;  1P3R A;  4EMO A;  2P0F A;  2L2I A;  2M38 A;  3HIE A;  3U12 A;  1WVH A;  1XD4 A;  1DDW A;  1MIX A;  1MK7 B;  3OAN A;  1FHO A;  1SGH A;  2RRF A;  3F0W A;  4KHA A;  2K00 A;  2RNR B;  3UZT A;  3D8F A;  2K49 A;  1M7R A;  4HB4 B;  2D9Z A;  2KUP A;  2ROV A;  3TFM A;  3VIA A;  2J0M A;  2CRF A;  1IRS A;  4Z2M B;  2Q13 A;  1XOD A;  1FAO A;  2MKR A;  2LG1 A;  3SYX A;  2Y8F A;  4KHB B;  2N0Y A;  2Z0P A;  4CSQ A;  2GS0 A;  2ROZ B;  4GNK B;  3FEH A;  4Z2N A;  1OQN A;  1UNP A;  4CHJ A;  1DDM A;  2EMS A;  2KUQ A;  3ODX A;  2DX5 A;  2RUK B;  4IOY X;  1QC6 A;  3FSS A;  3NSU A;  4B6H A;  2COF A;  5C6R A;  5GOW B;  2D9W A;  5C79 A;  2I5C A;  4XWX A;  2DHK A;  5C16 A;  5EFX A;  2UZR A;  4HDQ A;  5DI9 B;  1ZM0 A;  3KY9 A;  4QJ4 B;  4DXA B;  2DHI A;  2ADZ A;  2Z0O A;  2I1J A;  1WJ1 A;  1EF1 A;  1V61 A;  1J0W A;  4YL8 A;  2I5F A;  1U5E A;  2OQB A;  2OTX A;  1T77 A;  2GJY A;  1W1D A;  3P6A A;  1TJ6 A;  2YS1 A;  5D27 A;  1FGY A;  2Z13 A;  2QKM A;  1WG7 A;  2DYN A;  3NW8 A;  2N23 A;  1FB8 A;  4KAX B;  5D3Y A;  2X18 A;  1AQC A;  2RVB B;  1NTY A;  4YON A;  2M14 A;  1K5G B;  2K2J A;  3PSC A;  4C0A A;  4HAX B;  5DHA B;  1UNQ A;  4A6H A;  3KRW A;  4WJ7 A;  2P8V A;  1LW3 A;  3PVL A;  5HE0 A;  3HW2 B;  1DRO A;  3AU5 A;  1WGQ A;  2DFK A;  1MPH A;  4GN1 A;  2VRW B;  2UVM A;  4GMV A;  4ZRK A;  5D3X A;  4HSI A;  4Y94 A;  3T06 A;  2ELA A;  1Y19 B;  1V88 A;  5JP4 A;  2GUM A;  3DXD A;  1UPR A;  2V76 A;  2DN6 A;  3A58 A;  5IRS A;  3PVW A;  4IFS A;  4F7U P;  4P7I A;  3G9W A;  4L1R A;  3CXB B;  4TYZ A;  2COC A;  4WVF B;  2W2X C;  2DTC A;  2W2X D;  1I7A A;  2GCL A;  4HHV A;  1X05 A;  1U29 A;  2NZ8 B;  2Z14 A;  3N7C A;  2COD A;  3DXC A;  2DLW A;  3DXE A;  3SV1 A;  1NTV A;  3ZVR A;  3QWM A;  3A8P A;  1PLS A;  4GMX B;  5J3T A;  1SHC A;  3HSA A;  1UPQ A;  2DA0 A;  2CAY A; 
#chains in the Genus database with same CATH homology
 4DX9 0;  3SO6 A;  1MKE A;  4HB3 B;  1KZ7 A;  5DH9 B;  3P7Z A;  1Q67 A;  1U2B A;  1TXD A;  5FI1 A;  2LOX A;  3O96 A;  2W2W A;  2MFQ A;  1M7E A;  4PNK A;  2YRY A;  3QIJ A;  3BIN A;  5D3V A;  3TW1 A;  5D3W A;  3IVF A;  1ZSQ A;  2RLO A;  1X11 A;  1U5D A;  2D9X A;  5LON B;  1P5T A;  2IYB A;  2YT1 A;  1BAK A;  4HB0 B;  4WSF A;  3ODO A;  1ZC4 B;  4TKN A;  3ULC A;  2R0D A;  1FHX A;  1EVH A;  1MIZ B;  2CY4 A;  3SNH A;  1MAI A;  2UZS A;  5KQ1 A;  2HE7 A;  4IAP A;  4MY6 A;  4HAU B;  2YT0 A;  3BJI A;  2HTH B;  3GYO A;  1WGU A;  1ZC3 B;  1LB1 A;  4EJN A;  2KGX B;  3PZD A;  5DHF B;  2R09 A;  3TO1 A;  2LUL A;  1UNR A;  3CIK A;  4HAY B;  5HE3 A;  2DKQ A;  1V5M A;  4A5K A;  4HAT B;  2XQN M;  1AWE A;  1V5P A;  4BBK A;  2LYD A;  3WYF B;  1BTN A;  1WJM A;  2YVC A;  2QKL A;  1X1G A;  2G35 A;  4HB2 B;  4H8S A;  4GPT B;  4NSW A;  1EGX A;  2DHJ A;  1WI1 A;  4K17 A;  3PG7 A;  1KZG A;  3ML4 A;  2J0J A;  4GZU A;  3ULB A;  5CLL B;  2AL6 A;  5KQ4 A;  2BCJ A;  3V5W A;  3MDB C;  2PZ1 A;  1TQZ A;  1OY2 A;  4F7H A;  5J3Q A;  1XKE A;  1DYN A;  1XX0 A;  2J0K A;  3QBV B;  2YSZ A;  3WA0 A;  3M1I B;  4L6E A;  1BWN A;  2DKP A;  4K2O A;  2D10 A;  2H7D A;  1GC6 A;  1H4R A;  1FGZ A;  2CY5 A;  5JHG A;  1XCG A;  2MWN B;  3MPX A;  1U27 A;  5LOP B;  3SUZ A;  2NMB A;  2VKI A;  2VSZ A;  4KVG B;  4PQ0 A;  3U8Z A;  2LKO A;  1W1G A;  1Y5O A;  2D11 A;  2COA A;  4ZRI A;  3A8Q A;  5L81 A;  2RSG A;  2H7E A;  2KCJ A;  4K2P A;  2EJ8 A;  4HDO A;  4D0N B;  1Z87 A;  1XR0 B;  2IFS A;  3TCA A;  5KCV A;  2YS3 A;  5FI0 A;  3AU4 A;  1U5G A;  2P0H A;  2EC1 A;  2K2U A;  1P6S A;  3KSY A;  2D4Q A;  5JHH A;  3PEG A;  3D8E A;  1B55 A;  4NY0 A;  1EAZ A;  1I2H A;  5DIF B;  4F7G A;  2Y7B A;  4CYE A;  3RCP A;  4DX8 A;  3TVV A;  1BTK A;  1QQG A;  2DX1 A;  3PVU A;  2E2X A;  3HK0 A;  2RGN B;  1V5U A;  5C5B B;  1UEF A;  1KI1 B;  4A6K A;  4MT7 A;  1E5W A;  3LJU X;  1NI2 A;  4K81 A;  2ZPY A;  1RRP B;  3HQC A;  1X1F A;  2P0D A;  2D9Y A;  1PFJ A;  1H10 A;  1MK9 B;  1FOE A;  2D2Q A;  5C5B A;  4A6F B;  2FJL A;  1W1H A;  1N3H A;  4HAW B;  4EKU A;  4DBB A;  3GYP A;  5J3Y A;  2DYQ A;  2JP2 A;  2EMT A;  1PMS A;  2Y8G A;  2MDX A;  3U7D A;  2AEH A;  1GG3 A;  4GXB A;  4KHO A;  4ZRJ A;  2YS5 A;  2J59 M;  1RJ2 A;  4A6F A;  1OMW A;  3PP2 A;  1DBH A;  2Z0Q A;  1NU2 A;  5CLQ B;  3X23 A;  2GCJ A;  4HAV B;  1GC7 A;  2ELB A;  2YF0 A;  3A98 B;  2L1C A;  1V89 A;  5JLJ B;  3KZ1 A;  1ZVR A;  1X86 A;  3FM8 C;  3ODW A;  4HAZ B;  3ZDT A;  1U5F A;  2I1K A;  3F5R A;  1J19 A;  3D8D A;  5HE2 A;  1FHW A;  3KRX A;  2D9V A;  1DDV A;  5HE1 A;  1ISN A;  3AJ4 A;  4MK0 A;  3VOQ A;  4CHM A;  2LOZ A;  1K5D B;  1P3R A;  4EMO A;  2P0F A;  2L2I A;  2M38 A;  1WVH A;  1XD4 A;  1DDW A;  1MIX A;  1MK7 B;  3OAN A;  1FHO A;  1SGH A;  3F0W A;  4KHA A;  2K00 A;  2RNR B;  3UZT A;  3D8F A;  1M7R A;  4HB4 B;  2D9Z A;  2KUP A;  2ROV A;  3TFM A;  3VIA A;  2J0M A;  2CRF A;  1IRS A;  4Z2M B;  2Q13 A;  1XOD A;  1FAO A;  2MKR A;  2LG1 A;  3SYX A;  2Y8F A;  4KHB B;  2N0Y A;  2Z0P A;  2GS0 A;  2ROZ B;  3FEH A;  4Z2N A;  1OQN A;  1UNP A;  4CHJ A;  1DDM A;  2EMS A;  3ODX A;  2DX5 A;  2RUK B;  4IOY X;  1QC6 A;  3FSS A;  3NSU A;  4B6H A;  2COF A;  5C6R A;  5GOW B;  2D9W A;  5C79 A;  2I5C A;  4XWX A;  2DHK A;  5C16 A;  5EFX A;  2UZR A;  4HDQ A;  5DI9 B;  1ZM0 A;  3KY9 A;  4DXA B;  2DHI A;  2ADZ A;  2Z0O A;  2I1J A;  1WJ1 A;  1EF1 A;  1V61 A;  1J0W A;  4YL8 A;  2I5F A;  1U5E A;  2OQB A;  2OTX A;  2GJY A;  1W1D A;  3P6A A;  1TJ6 A;  2YS1 A;  5D27 A;  1FGY A;  2QKM A;  1WG7 A;  2DYN A;  2N23 A;  1FB8 A;  4KAX B;  5D3Y A;  2X18 A;  1AQC A;  2RVB B;  1NTY A;  4YON A;  2M14 A;  1K5G B;  2K2J A;  3PSC A;  4C0A A;  4HAX B;  5DHA B;  1UNQ A;  4A6H A;  3KRW A;  4WJ7 A;  2P8V A;  1LW3 A;  3PVL A;  5HE0 A;  3HW2 B;  1DRO A;  3AU5 A;  1WGQ A;  2DFK A;  1MPH A;  4GN1 A;  2VRW B;  2UVM A;  4GMV A;  4ZRK A;  5D3X A;  4Y94 A;  3T06 A;  2ELA A;  1Y19 B;  1V88 A;  5JP4 A;  1UPR A;  3DXD A;  2V76 A;  2DN6 A;  3PVW A;  4IFS A;  4F7U P;  4P7I A;  3G9W A;  3CXB B;  4TYZ A;  2COC A;  4WVF B;  2W2X C;  2DTC A;  2W2X D;  1I7A A;  2GCL A;  4HHV A;  1X05 A;  1U29 A;  2NZ8 B;  3N7C A;  2COD A;  3DXC A;  2DLW A;  3DXE A;  3SV1 A;  1NTV A;  3ZVR A;  3QWM A;  3A8P A;  1PLS A;  4GMX B;  5J3T A;  1SHC A;  1UPQ A;  2DA0 A;  2CAY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...