2VSZA

Crystal structure of the elmo1 ph domain
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
147
structure length
141
Chain Sequence
GPLGSPILELKEKIQPEILELIKQQRLNRLVEGTCFRKLNARRRQDKFWYCRLSPNHKVLHYGDLEESPQGEVPHDSLQDKLPVADIKAVVTGKDCPHMKENKEVLELAFSILYDSNCQLNFIAPDKHEYCIWTDGLNALL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title An Alpha-Helical Extension of the Elmo1 Pleckstrin Homology Domain Mediates Direct Interaction to Dock180 and is Critical in Rac Signaling.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Apoptosis
molecule keywords ENGULFMENT AND CELL MOTILITY PROTEIN 1
total genus 37
structure length 141
sequence length 147
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16457 PH_12 Pleckstrin homology domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2vszA02
1BAKA 1ZVRA 2P8VA 2DN6A 4ZRIA 2CRFA 5DIFB 2DFKA 2X18A 4EMOA 2D9YA 2KCJA 3TO1A 2LOZA 2OTXA 4K2PA 2W2XD 3KZ1A 3U7DA 2Y8FA 1ZSQA 1W1DA 3UZTA 5HE3A 4K17A 4K81A 1M7RA 1XODA 2HTHB 2G35A 1MPHA 3DXCA 1FOEA 4K2OA 1GC6A 3PP2A 2K2JA 2YS3A 2D2QA 4HDQA 1FGZA 1P6SA 2LYDA 1K5GB 4PNKA 2D9XA 4F7GA 1KI1B 2UZRA 2ELBA 2ZPYA 5C5BB 2D10A 2Q13A 2DA0A 2YS5A 1RJ2A 5HE1A 5JP4A 5D3VA 3HW2B 1QC6A 4Z2NA 3VOQA 4GXBA 1XX0A 1ZC4B 1Y5OA 5D3WA 1U5FA 3PG7A 2Z0QA 5C79A 1U5GA 1FAOA 2YF0A 3SO6A 3P6AA 1UPQA 1DDVA 2YT0A 1BWNA 4HAZB 5DHAB 4NY0A 4A6HA 2L1CA 2LULA 2RVBB 1UNPA 1UNQA 1DDWA 2M14A 2UVMA 3ODXA 5FI1A 2EC1A 5JHGA 2GJYA 1GC7A 3PVUA 2RUKB 1TQZA 2YS1A 1AQCA 2CAYA 1OY2A 5J3YA 3GYOA 2YVCA 1SGHA 1U29A 1X05A 4KVGB 1NI2A 2DYQA 4GN1A 2NZ8B 3TVVA 4C0AA 3QWMA 3RCPA 4MT7A 3F5RA 1GG3A 4DX90 2UZSA 2MWNB 1V5UA 4EKUA 3SUZA 1MIXA 2COCA 4Z2MB 1XD4A 4D0NB 2P0HA 3TCAA 1AWEA 3U8ZA 2P0DA 3BJIA 1I7AA 4CHJA 2DYNA 1MK7B 2CY4A 2E2XA 5C5BA 5KQ4A 2XQNM 5C6RA 1LW3A 5D3XA 1WGUA 1TXDA 4HB0B 5JHHA 4B6HA 2ROVA 3KSYA 1U5DA 4HAYB 1K5DB 1Z87A 2LKOA 1M7EA 1WVHA 2J0MA 4ZRKA 1KZ7A 4IAPA 1WG7A 2D9WA 3D8EA 4WVFB 2ELAA 1MIZB 3LJUX 3AU5A 2K00A 4HDOA 4BBKA 2D9ZA 1V89A 4F7HA 5KCVA 3V5WA 3MPXA 2COFA 5D3YA 1EF1A 2GCLA 3QBVB 1UNRA 2NMBA 3M1IB 1EGXA 1FHOA 2I5FA 3QIJA 1MAIA 2J0JA 4HB4B 1J0WA 2CY5A 4Y94A 1W1GA 2YRYA 4YONA 3SV1A 4CHMA 2FJLA 4WJ7A 4A5KA 3DXEA 1B55A 2DHJA 3ZVRA 3SYXA 1WI1A 5L81A 3PVWA 1EVHA 2CODA 3FEHA 1V61A 5EFXA 4HAUB 4MY6A 2MKRA 3WA0A 3A98B 1NTVA 1KZGA 2RSGA 3KRWA 4KHBB 3FM8C 4GZUA 2ADZA 1NU2A 1MK9B 2J59M 4GPTB 2J0KA 1WGQA 2BCJA 2QKLA 3BINA 1ZC3B 4IOYX 2AL6A 2YT1A 4TYZA 3KRXA 2MDXA 2KGXB 2H7DA 2M38A 2V76A 2GCJA 3NSUA 3KY9A 4GMVA 1V5MA 1XCGA 5HE2A 5HE0A 4ZRJA 3F0WA 2I1JA 1ISNA 1SHCA 1DROA 1P3RA 1BTKA 1TJ6A 2DLWA 5C16A 1V88A 1OMWA 2VKIA 1U27A 1WJMA 2DHKA 1X86A 2W2WA 3PEGA 2N0YA 4YL8A 1PMSA 3CXBB 2EJ8A 4KHOA 5DHFB 2H7EA 2GS0A 2W2XC 1X1GA 2MFQA 4DBBA 1DBHA 1RRPB 2I1KA 2DX1A 2D9VA 1UPRA 4KHAA 2JP2A 4L6EA 2D4QA 4HB3B 3ODWA 2IFSA 1PFJA 1EAZA 2RLOA 1QQGA 2RGNB 5GOWB 2VRWB 3PVLA 4H8SA 5KQ1A 2KUPA 2QKMA 3DXDA 3GYPA 2Y7BA 3TFMA 3OANA 2YSZA 2R0DA 2HE7A 4GMXB 1H10A 3ULCA 1DYNA 1U2BA 1DDMA 3P7ZA 3PZDA 2COAA 1PLSA 3AJ4A 3ODOA 1FHWA 2I5CA 1BTNA 1LB1A 1IRSA 3X23A 3PSCA 5CLQB 4DXAB 3VIAA 2R09A 2Z0OA 5D27A 1UEFA 4HATB 3A8QA 3ML4A 2Y8GA 4KAXB 4HAWB 3ZDTA 3TW1A 5LONB 5LOPB 2EMSA 4F7UP 4PQ0A 2PZ1A 4NSWA 1E5WA 2RNRB 3CIKA 1X1FA 2VSZA 3G9WA 2DTCA 4HHVA 2K2UA 2ROZB 4A6FB 1NTYA 2OQBA 1FHXA 2DKQA 3FSSA 2Z0PA 4A6KA 4EJNA 4CYEA 5J3QA 2LG1A 1W1HA 1V5PA 2DHIA 4TKNA 4XWXA 3D8DA 3D8FA 1XKEA 3A8PA 1XR0B 3O96A 4DX8A 1U5EA 3N7CA 4HAVB 4A6FA 3ULBA 5FI0A 3WYFB 2IYBA 1J19A 1Q67A 1WJ1A 1FB8A 4IFSA 5DH9B 3T06A 3MDBC 1OQNA 2DKPA 1X11A 3HQCA 2LOXA 1P5TA 2L2IA 1H4RA 2EMTA 3IVFA 2P0FA 3AU4A 3HK0A 5CLLB 1Y19B 2DX5A 1ZM0A 1FGYA 1N3HA 2D11A 4P7IA 5JLJB 2AEHA 5DI9B 4MK0A 4WSFA 3SNHA 2N23A 1I2HA 5J3TA 1MKEA 4HAXB 4HB2B
chains in the Genus database with same CATH superfamily
1BAKA 1ZVRA 2P8VA 2DN6A 4ZRIA 2CRFA 5DIFB 2DFKA 2X18A 4EMOA 2D9YA 2KCJA 3TO1A 2LOZA 2OTXA 4K2PA 2W2XD 3KZ1A 3HSAA 2YT2A 3U7DA 2Y8FA 1ZSQA 1W1DA 3UZTA 5HE3A 4K17A 4K81A 1M7RA 1XODA 2HTHB 2G35A 1MPHA 3DXCA 1FOEA 4K2OA 1GC6A 3PP2A 2K2JA 3B77A 2YS3A 2D2QA 4HDQA 1FGZA 1P6SA 2LYDA 1K5GB 4PNKA 2D9XA 4F7GA 1KI1B 2UZRA 2ELBA 2ZPYA 5C5BB 2D10A 2Q13A 2DA0A 2YS5A 1RJ2A 5HE1A 5JP4A 5D3VA 3HW2B 1QC6A 3DCXA 4Z2NA 3VOQA 4GXBA 1XX0A 1ZC4B 1Y5OA 5D3WA 2RRFA 1U5FA 3PG7A 2Z0QA 5C79A 1U5GA 1FAOA 2YF0A 3SO6A 3P6AA 1UPQA 1DDVA 2YT0A 1BWNA 4HAZB 5DHAB 4NY0A 4A6HA 4DIXA 2L1CA 2LULA 2RVBB 1UNPA 1UNQA 1DDWA 2M14A 2UVMA 3ODXA 5FI1A 2EC1A 5JHGA 2GJYA 1GC7A 5I2MA 3PVUA 2RUKB 1TQZA 2YS1A 1AQCA 2CAYA 2KIEA 1OY2A 5J3YA 3GYOA 2YVCA 1SGHA 1U29A 1X05A 4KVGB 1NI2A 2FJUB 2DYQA 4GN1A 2NZ8B 1MI1A 3TVVA 4C0AA 3A58A 3QWMA 3RCPA 4MT7A 2Z4DA 3F5RA 1GG3A 4DX90 2UZSA 2MWNB 1V5UA 4QJ5B 5LG4B 4EKUA 3SUZA 1MIXA 2COCA 4Z2MB 1XD4A 4D0NB 2P0HA 3TCAA 3NW8A 1AWEA 3U8ZA 4CSQA 2P0DA 3BJIA 1I7AA 4CHJA 2DYNA 2K8EA 4HSIA 1MK7B 2CY4A 3U12A 2E2XA 5C5BA 5KQ4A 2XQNM 4D6WA 5C6RA 1LW3A 2KIGA 5D3XA 2GUMA 1WGUA 1TXDA 4HB0B 5JHHA 4B6HA 2ROVA 3KSYA 1U5DA 4HAYB 5IRSA 1K5DB 1Z87A 2LKOA 1M7EA 1WVHA 2J0MA 4ZRKA 1KZ7A 1WG7A 2D9WA 4IAPA 3D8EA 4WVFB 2ELAA 4GOUA 1MIZB 3LJUX 3AU5A 2K00A 2KR0A 4HDOA 4BBKA 2D9ZA 1V89A 4F7HA 5KCVA 3V5WA 3MPXA 2COFA 5D3YA 1EF1A 2GCLA 4GNKB 2R2YA 3QBVB 1UNRA 2NMBA 3M1IB 2Z14A 1EGXA 1FHOA 3NWDA 2I5FA 2Z59A 3QIJA 1MAIA 2J0JA 4HB4B 1J0WA 2CY5A 4Y94A 1W1GA 2YRYA 4YONA 3SV1A 4CHMA 2FJLA 4WJ7A 4A5KA 3DXEA 1B55A 2DHJA 3ZVRA 3SYXA 1WI1A 5L81A 3PVWA 1EVHA 2CODA 3FEHA 3HIEA 1V61A 5EFXA 5I2SA 4HAUB 4MY6A 2MKRA 4QJ3B 3WA0A 3A98B 1NTVA 1KZGA 2RSGA 3KRWA 4KHBB 3FM8C 4GZUA 2ADZA 1NU2A 1MK9B 2J59M 4GPTB 2J0KA 1WGQA 2BCJA 2QKLA 3BINA 1ZC3B 4IOYX 1ZYIA 2AL6A 2YT1A 4TYZA 3KRXA 2MDXA 2KGXB 2H7DA 2M38A 2V76A 2GCJA 3NSUA 3KY9A 4GMVA 1V5MA 1XCGA 5HE2A 5HE0A 4ZRJA 3F0WA 2I1JA 1T77A 1ISNA 1SHCA 1DROA 1P3RA 1BTKA 1TJ6A 2DLWA 5C16A 1V88A 1OMWA 2VKIA 3OHMB 1U27A 1WJMA 2DHKA 1X86A 2W2WA 3PEGA 2KUQA 2N0YA 4YL8A 1PMSA 3CXBB 2EJ8A 4KHOA 5DHFB 2H7EA 2GS0A 2W2XC 1X1GA 2MFQA 4OT1A 4DBBA 1DBHA 1RRPB 2I1KA 2DX1A 2D9VA 1UPRA 4KHAA 2JP2A 3NWAA 4L6EA 2D4QA 4KHBA 4HB3B 3ODWA 2IFSA 1PFJA 1EAZA 2RLOA 1QQGA 2RGNB 5GOWB 2VRWB 3PVLA 4H8SA 5KQ1A 2KUPA 2QKMA 3DXDA 3GYPA 2Y7BA 3TFMA 3OANA 2YSZA 2R0DA 2HE7A 4GMXB 1H10A 3ULCA 1DYNA 1U2BA 4QXAB 1DDMA 3P7ZA 3PZDA 4QJ4B 2NBVA 2COAA 1PLSA 3AJ4A 3ODOA 1FHWA 2I5CA 1BTNA 1LB1A 1IRSA 4L1RA 3PSCA 5CLQB 3X23A 4DXAB 3VIAA 2R09A 2Z0OA 5D27A 1UEFA 4HATB 3A8QA 3ML4A 2Y8GA 4KAXB 3FVCA 4HAWB 3ZDTA 3TW1A 5LONB 5LOPB 2EMSA 4F7UP 4PQ0A 2PZ1A 2ZKMX 4NSWA 1E5WA 2RNRB 3CIKA 1X1FA 2VSZA 3G9WA 2DTCA 4HHVA 2K2UA 2ROZB 4A6FB 1NTYA 2OQBA 1FHXA 2DKQA 3FSSA 2Z0PA 4A6KA 4EJNA 4CYEA 5J3QA 2LG1A 1W1HA 1V5PA 2DHIA 4TKNA 4XWXA 3D8DA 3D8FA 1XKEA 3A8PA 1XR0B 3O96A 4DX8A 1U5EA 3N7CA 4HAVB 4A6FA 3ULBA 5FI0A 3WYFB 5M4YB 2IYBA 1J19A 1Q67A 1WJ1A 1FB8A 3NWFA 4OSNA 4IFSA 5DH9B 3T06A 3MDBC 1OQNA 2DKPA 1X11A 3HQCA 2LOXA 1P5TA 2L2IA 1H4RA 2EMTA 3IVFA 2P0FA 3AU4A 3HK0A 5CLLB 2Z13A 1Y19B 2DX5A 1ZM0A 1FGYA 1N3HA 2D11A 4P7IA 5JLJB 2AEHA 5DI9B 4MK0A 4WSFA 2K49A 3SNHA 2N23A 1I2HA 5J3TA 1MKEA 4HAXB 4HB2B
chains in the Genus database with same CATH topology
1BAKA 1ZVRA 2P8VA 2DN6A 4ZRIA 2CRFA 5DIFB 2DFKA 2X18A 4EMOA 2D9YA 2KCJA 3TO1A 2LOZA 2OTXA 4K2PA 2W2XD 3KZ1A 3U7DA 2Y8FA 1ZSQA 1W1DA 3UZTA 5HE3A 4K17A 4K81A 1M7RA 1XODA 2HTHB 2G35A 1MPHA 3DXCA 1FOEA 4K2OA 1GC6A 3PP2A 2K2JA 2YS3A 2D2QA 4HDQA 1FGZA 1P6SA 2LYDA 1K5GB 4PNKA 2D9XA 4F7GA 1KI1B 2UZRA 2ELBA 2ZPYA 5C5BB 2D10A 2Q13A 2DA0A 2YS5A 1RJ2A 5HE1A 5JP4A 5D3VA 3HW2B 1QC6A 4Z2NA 3VOQA 4GXBA 1XX0A 1ZC4B 1Y5OA 5D3WA 1U5FA 3PG7A 2Z0QA 5C79A 1U5GA 1FAOA 2YF0A 3SO6A 3P6AA 1UPQA 1DDVA 2YT0A 1BWNA 4HAZB 5DHAB 4NY0A 4A6HA 2L1CA 2LULA 2RVBB 1UNPA 1UNQA 1DDWA 2M14A 2UVMA 3ODXA 5FI1A 2EC1A 5JHGA 2GJYA 1GC7A 3PVUA 2RUKB 1TQZA 2YS1A 1AQCA 2CAYA 1OY2A 5J3YA 3GYOA 2YVCA 1SGHA 1U29A 1X05A 4KVGB 1NI2A 2DYQA 4GN1A 2NZ8B 3TVVA 4C0AA 3QWMA 3RCPA 4MT7A 3F5RA 1GG3A 4DX90 2UZSA 2MWNB 1V5UA 4EKUA 3SUZA 1MIXA 2COCA 4Z2MB 1XD4A 4D0NB 2P0HA 3TCAA 1AWEA 3U8ZA 2P0DA 3BJIA 1I7AA 4CHJA 2DYNA 1MK7B 2CY4A 2E2XA 5C5BA 5KQ4A 2XQNM 5C6RA 1LW3A 5D3XA 1WGUA 1TXDA 4HB0B 5JHHA 4B6HA 2ROVA 3KSYA 1U5DA 4HAYB 1K5DB 1Z87A 2LKOA 1M7EA 1WVHA 2J0MA 4ZRKA 1KZ7A 4IAPA 1WG7A 2D9WA 3D8EA 4WVFB 2ELAA 1MIZB 3LJUX 3AU5A 2K00A 4HDOA 4BBKA 2D9ZA 1V89A 4F7HA 5KCVA 3V5WA 3MPXA 2COFA 5D3YA 1EF1A 2GCLA 3QBVB 1UNRA 2NMBA 3M1IB 1EGXA 1FHOA 2I5FA 3QIJA 1MAIA 2J0JA 4HB4B 1J0WA 2CY5A 4Y94A 1W1GA 2YRYA 4YONA 3SV1A 4CHMA 2FJLA 4WJ7A 4A5KA 3DXEA 1B55A 2DHJA 3ZVRA 3SYXA 1WI1A 5L81A 3PVWA 1EVHA 2CODA 3FEHA 1V61A 5EFXA 4HAUB 4MY6A 2MKRA 3WA0A 3A98B 1NTVA 1KZGA 2RSGA 3KRWA 4KHBB 3FM8C 4GZUA 2ADZA 1NU2A 1MK9B 2J59M 4GPTB 2J0KA 1WGQA 2BCJA 2QKLA 3BINA 1ZC3B 4IOYX 2AL6A 2YT1A 4TYZA 3KRXA 2MDXA 2KGXB 2H7DA 2M38A 2V76A 2GCJA 3NSUA 3KY9A 4GMVA 1V5MA 1XCGA 5HE2A 5HE0A 4ZRJA 3F0WA 2I1JA 1ISNA 1SHCA 1DROA 1P3RA 1BTKA 1TJ6A 2DLWA 5C16A 1V88A 1OMWA 2VKIA 1U27A 1WJMA 2DHKA 1X86A 2W2WA 3PEGA 2N0YA 4YL8A 1PMSA 3CXBB 2EJ8A 4KHOA 5DHFB 2H7EA 2GS0A 2W2XC 1X1GA 2MFQA 4DBBA 1DBHA 1RRPB 2I1KA 2DX1A 2D9VA 1UPRA 4KHAA 2JP2A 4L6EA 2D4QA 4HB3B 3ODWA 2IFSA 1PFJA 1EAZA 2RLOA 1QQGA 2RGNB 5GOWB 2VRWB 3PVLA 4H8SA 5KQ1A 2KUPA 2QKMA 3DXDA 3GYPA 2Y7BA 3TFMA 3OANA 2YSZA 2R0DA 2HE7A 4GMXB 1H10A 3ULCA 1DYNA 1U2BA 1DDMA 3P7ZA 3PZDA 2COAA 1PLSA 3AJ4A 3ODOA 1FHWA 2I5CA 1BTNA 1LB1A 1IRSA 3X23A 3PSCA 5CLQB 4DXAB 3VIAA 2R09A 2Z0OA 5D27A 1UEFA 4HATB 3A8QA 3ML4A 2Y8GA 4KAXB 4HAWB 3ZDTA 3TW1A 5LONB 5LOPB 2EMSA 4F7UP 4PQ0A 2PZ1A 4NSWA 1E5WA 2RNRB 3CIKA 1X1FA 2VSZA 3G9WA 2DTCA 4HHVA 2K2UA 2ROZB 4A6FB 1NTYA 2OQBA 1FHXA 2DKQA 3FSSA 2Z0PA 4A6KA 4EJNA 4CYEA 5J3QA 2LG1A 1W1HA 1V5PA 2DHIA 4TKNA 4XWXA 3D8DA 3D8FA 1XKEA 3A8PA 1XR0B 3O96A 4DX8A 1U5EA 3N7CA 4HAVB 4A6FA 3ULBA 5FI0A 3WYFB 2IYBA 1J19A 1Q67A 1WJ1A 1FB8A 4IFSA 5DH9B 3T06A 3MDBC 1OQNA 2DKPA 1X11A 3HQCA 2LOXA 1P5TA 2L2IA 1H4RA 2EMTA 3IVFA 2P0FA 3AU4A 3HK0A 5CLLB 1Y19B 2DX5A 1ZM0A 1FGYA 1N3HA 2D11A 4P7IA 5JLJB 2AEHA 5DI9B 4MK0A 4WSFA 3SNHA 2N23A 1I2HA 5J3TA 1MKEA 4HAXB 4HB2B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BAK A;  1ZVR A;  2P8V A;  2DN6 A;  4ZRI A;  2CRF A;  5DIF B;  2DFK A;  2X18 A;  4EMO A;  2D9Y A;  2KCJ A;  3TO1 A;  2LOZ A;  2OTX A;  4K2P A;  2W2X D;  3KZ1 A;  3U7D A;  2Y8F A;  1ZSQ A;  1W1D A;  3UZT A;  5HE3 A;  4K17 A;  4K81 A;  1M7R A;  1XOD A;  2HTH B;  2G35 A;  1MPH A;  3DXC A;  1FOE A;  4K2O A;  1GC6 A;  3PP2 A;  2K2J A;  2YS3 A;  2D2Q A;  4HDQ A;  1FGZ A;  1P6S A;  2LYD A;  1K5G B;  4PNK A;  2D9X A;  4F7G A;  1KI1 B;  2UZR A;  2ELB A;  2ZPY A;  5C5B B;  2D10 A;  2Q13 A;  2DA0 A;  2YS5 A;  1RJ2 A;  5HE1 A;  5JP4 A;  5D3V A;  3HW2 B;  1QC6 A;  4Z2N A;  3VOQ A;  4GXB A;  1XX0 A;  1ZC4 B;  1Y5O A;  5D3W A;  1U5F A;  3PG7 A;  2Z0Q A;  5C79 A;  1U5G A;  1FAO A;  2YF0 A;  3SO6 A;  3P6A A;  1UPQ A;  1DDV A;  2YT0 A;  1BWN A;  4HAZ B;  5DHA B;  4NY0 A;  4A6H A;  2L1C A;  2LUL A;  2RVB B;  1UNP A;  1UNQ A;  1DDW A;  2M14 A;  2UVM A;  3ODX A;  5FI1 A;  2EC1 A;  5JHG A;  2GJY A;  1GC7 A;  3PVU A;  2RUK B;  1TQZ A;  2YS1 A;  1AQC A;  2CAY A;  1OY2 A;  5J3Y A;  3GYO A;  2YVC A;  1SGH A;  1U29 A;  1X05 A;  4KVG B;  1NI2 A;  2DYQ A;  4GN1 A;  2NZ8 B;  3TVV A;  4C0A A;  3QWM A;  3RCP A;  4MT7 A;  3F5R A;  1GG3 A;  4DX9 0;  2UZS A;  2MWN B;  1V5U A;  4EKU A;  3SUZ A;  1MIX A;  2COC A;  4Z2M B;  1XD4 A;  4D0N B;  2P0H A;  3TCA A;  1AWE A;  3U8Z A;  2P0D A;  3BJI A;  1I7A A;  4CHJ A;  2DYN A;  1MK7 B;  2CY4 A;  2E2X A;  5C5B A;  5KQ4 A;  2XQN M;  5C6R A;  1LW3 A;  5D3X A;  1WGU A;  1TXD A;  4HB0 B;  5JHH A;  4B6H A;  2ROV A;  3KSY A;  1U5D A;  4HAY B;  1K5D B;  1Z87 A;  2LKO A;  1M7E A;  1WVH A;  2J0M A;  4ZRK A;  1KZ7 A;  4IAP A;  1WG7 A;  2D9W A;  3D8E A;  4WVF B;  2ELA A;  1MIZ B;  3LJU X;  3AU5 A;  2K00 A;  4HDO A;  4BBK A;  2D9Z A;  1V89 A;  4F7H A;  5KCV A;  3V5W A;  3MPX A;  2COF A;  5D3Y A;  1EF1 A;  2GCL A;  3QBV B;  1UNR A;  2NMB A;  3M1I B;  1EGX A;  1FHO A;  2I5F A;  3QIJ A;  1MAI A;  2J0J A;  4HB4 B;  1J0W A;  2CY5 A;  4Y94 A;  1W1G A;  2YRY A;  4YON A;  3SV1 A;  4CHM A;  2FJL A;  4WJ7 A;  4A5K A;  3DXE A;  1B55 A;  2DHJ A;  3ZVR A;  3SYX A;  1WI1 A;  5L81 A;  3PVW A;  1EVH A;  2COD A;  3FEH A;  1V61 A;  5EFX A;  4HAU B;  4MY6 A;  2MKR A;  3WA0 A;  3A98 B;  1NTV A;  1KZG A;  2RSG A;  3KRW A;  4KHB B;  3FM8 C;  4GZU A;  2ADZ A;  1NU2 A;  1MK9 B;  2J59 M;  4GPT B;  2J0K A;  1WGQ A;  2BCJ A;  2QKL A;  3BIN A;  1ZC3 B;  4IOY X;  2AL6 A;  2YT1 A;  4TYZ A;  3KRX A;  2MDX A;  2KGX B;  2H7D A;  2M38 A;  2V76 A;  2GCJ A;  3NSU A;  3KY9 A;  4GMV A;  1V5M A;  1XCG A;  5HE2 A;  5HE0 A;  4ZRJ A;  3F0W A;  2I1J A;  1ISN A;  1SHC A;  1DRO A;  1P3R A;  1BTK A;  1TJ6 A;  2DLW A;  5C16 A;  1V88 A;  1OMW A;  2VKI A;  1U27 A;  1WJM A;  2DHK A;  1X86 A;  2W2W A;  3PEG A;  2N0Y A;  4YL8 A;  1PMS A;  3CXB B;  2EJ8 A;  4KHO A;  5DHF B;  2H7E A;  2GS0 A;  2W2X C;  1X1G A;  2MFQ A;  4DBB A;  1DBH A;  1RRP B;  2I1K A;  2DX1 A;  2D9V A;  1UPR A;  4KHA A;  2JP2 A;  4L6E A;  2D4Q A;  4HB3 B;  3ODW A;  2IFS A;  1PFJ A;  1EAZ A;  2RLO A;  1QQG A;  2RGN B;  5GOW B;  2VRW B;  3PVL A;  4H8S A;  5KQ1 A;  2KUP A;  2QKM A;  3DXD A;  3GYP A;  2Y7B A;  3TFM A;  3OAN A;  2YSZ A;  2R0D A;  2HE7 A;  4GMX B;  1H10 A;  3ULC A;  1DYN A;  1U2B A;  1DDM A;  3P7Z A;  3PZD A;  2COA A;  1PLS A;  3AJ4 A;  3ODO A;  1FHW A;  2I5C A;  1BTN A;  1LB1 A;  1IRS A;  3X23 A;  3PSC A;  5CLQ B;  4DXA B;  3VIA A;  2R09 A;  2Z0O A;  5D27 A;  1UEF A;  4HAT B;  3A8Q A;  3ML4 A;  2Y8G A;  4KAX B;  4HAW B;  3ZDT A;  3TW1 A;  5LON B;  5LOP B;  2EMS A;  4F7U P;  4PQ0 A;  2PZ1 A;  4NSW A;  1E5W A;  2RNR B;  3CIK A;  1X1F A;  2VSZ A;  3G9W A;  2DTC A;  4HHV A;  2K2U A;  2ROZ B;  4A6F B;  1NTY A;  2OQB A;  1FHX A;  2DKQ A;  3FSS A;  2Z0P A;  4A6K A;  4EJN A;  4CYE A;  5J3Q A;  2LG1 A;  1W1H A;  1V5P A;  2DHI A;  4TKN A;  4XWX A;  3D8D A;  3D8F A;  1XKE A;  3A8P A;  1XR0 B;  3O96 A;  4DX8 A;  1U5E A;  3N7C A;  4HAV B;  4A6F A;  3ULB A;  5FI0 A;  3WYF B;  2IYB A;  1J19 A;  1Q67 A;  1WJ1 A;  1FB8 A;  4IFS A;  5DH9 B;  3T06 A;  3MDB C;  1OQN A;  2DKP A;  1X11 A;  3HQC A;  2LOX A;  1P5T A;  2L2I A;  1H4R A;  2EMT A;  3IVF A;  2P0F A;  3AU4 A;  3HK0 A;  5CLL B;  1Y19 B;  2DX5 A;  1ZM0 A;  1FGY A;  1N3H A;  2D11 A;  4P7I A;  5JLJ B;  2AEH A;  5DI9 B;  4MK0 A;  4WSF A;  3SNH A;  2N23 A;  1I2H A;  5J3T A;  1MKE A;  4HAX B;  4HB2 B; 
#chains in the Genus database with same CATH topology
 1BAK A;  1ZVR A;  2P8V A;  2DN6 A;  4ZRI A;  2CRF A;  5DIF B;  2DFK A;  2X18 A;  4EMO A;  2D9Y A;  2KCJ A;  3TO1 A;  2LOZ A;  2OTX A;  4K2P A;  2W2X D;  3KZ1 A;  3HSA A;  2YT2 A;  3U7D A;  2Y8F A;  1ZSQ A;  1W1D A;  3UZT A;  5HE3 A;  4K17 A;  4K81 A;  1M7R A;  1XOD A;  2HTH B;  2G35 A;  1MPH A;  3DXC A;  1FOE A;  4K2O A;  1GC6 A;  3PP2 A;  2K2J A;  3B77 A;  2YS3 A;  2D2Q A;  4HDQ A;  1FGZ A;  1P6S A;  2LYD A;  1K5G B;  4PNK A;  2D9X A;  4F7G A;  1KI1 B;  2UZR A;  2ELB A;  2ZPY A;  5C5B B;  2D10 A;  2Q13 A;  2DA0 A;  2YS5 A;  1RJ2 A;  5HE1 A;  5JP4 A;  5D3V A;  3HW2 B;  1QC6 A;  3DCX A;  4Z2N A;  3VOQ A;  4GXB A;  1XX0 A;  1ZC4 B;  1Y5O A;  5D3W A;  2RRF A;  1U5F A;  3PG7 A;  2Z0Q A;  5C79 A;  1U5G A;  1FAO A;  2YF0 A;  3SO6 A;  3P6A A;  1UPQ A;  1DDV A;  2YT0 A;  1BWN A;  4HAZ B;  5DHA B;  4NY0 A;  4A6H A;  4DIX A;  2L1C A;  2LUL A;  2RVB B;  1UNP A;  1UNQ A;  1DDW A;  2M14 A;  2UVM A;  3ODX A;  5FI1 A;  2EC1 A;  5JHG A;  2GJY A;  1GC7 A;  5I2M A;  3PVU A;  2RUK B;  1TQZ A;  2YS1 A;  1AQC A;  2CAY A;  2KIE A;  1OY2 A;  5J3Y A;  3GYO A;  2YVC A;  1SGH A;  1U29 A;  1X05 A;  4KVG B;  1NI2 A;  2FJU B;  2DYQ A;  4GN1 A;  2NZ8 B;  1MI1 A;  3TVV A;  4C0A A;  3A58 A;  3QWM A;  3RCP A;  4MT7 A;  2Z4D A;  3F5R A;  1GG3 A;  4DX9 0;  2UZS A;  2MWN B;  1V5U A;  4QJ5 B;  5LG4 B;  4EKU A;  3SUZ A;  1MIX A;  2COC A;  4Z2M B;  1XD4 A;  4D0N B;  2P0H A;  3TCA A;  3NW8 A;  1AWE A;  3U8Z A;  4CSQ A;  2P0D A;  3BJI A;  1I7A A;  4CHJ A;  2DYN A;  2K8E A;  4HSI A;  1MK7 B;  2CY4 A;  3U12 A;  2E2X A;  5C5B A;  5KQ4 A;  2XQN M;  4D6W A;  5C6R A;  1LW3 A;  2KIG A;  5D3X A;  2GUM A;  1WGU A;  1TXD A;  4HB0 B;  5JHH A;  4B6H A;  2ROV A;  3KSY A;  1U5D A;  4HAY B;  5IRS A;  1K5D B;  1Z87 A;  2LKO A;  1M7E A;  1WVH A;  2J0M A;  4ZRK A;  1KZ7 A;  1WG7 A;  2D9W A;  4IAP A;  3D8E A;  4WVF B;  2ELA A;  4GOU A;  1MIZ B;  3LJU X;  3AU5 A;  2K00 A;  2KR0 A;  4HDO A;  4BBK A;  2D9Z A;  1V89 A;  4F7H A;  5KCV A;  3V5W A;  3MPX A;  2COF A;  5D3Y A;  1EF1 A;  2GCL A;  4GNK B;  2R2Y A;  3QBV B;  1UNR A;  2NMB A;  3M1I B;  2Z14 A;  1EGX A;  1FHO A;  3NWD A;  2I5F A;  2Z59 A;  3QIJ A;  1MAI A;  2J0J A;  4HB4 B;  1J0W A;  2CY5 A;  4Y94 A;  1W1G A;  2YRY A;  4YON A;  3SV1 A;  4CHM A;  2FJL A;  4WJ7 A;  4A5K A;  3DXE A;  1B55 A;  2DHJ A;  3ZVR A;  3SYX A;  1WI1 A;  5L81 A;  3PVW A;  1EVH A;  2COD A;  3FEH A;  3HIE A;  1V61 A;  5EFX A;  5I2S A;  4HAU B;  4MY6 A;  2MKR A;  4QJ3 B;  3WA0 A;  3A98 B;  1NTV A;  1KZG A;  2RSG A;  3KRW A;  4KHB B;  3FM8 C;  4GZU A;  2ADZ A;  1NU2 A;  1MK9 B;  2J59 M;  4GPT B;  2J0K A;  1WGQ A;  2BCJ A;  2QKL A;  3BIN A;  1ZC3 B;  4IOY X;  1ZYI A;  2AL6 A;  2YT1 A;  4TYZ A;  3KRX A;  2MDX A;  2KGX B;  2H7D A;  2M38 A;  2V76 A;  2GCJ A;  3NSU A;  3KY9 A;  4GMV A;  1V5M A;  1XCG A;  5HE2 A;  5HE0 A;  4ZRJ A;  3F0W A;  2I1J A;  1T77 A;  1ISN A;  1SHC A;  1DRO A;  1P3R A;  1BTK A;  1TJ6 A;  2DLW A;  5C16 A;  1V88 A;  1OMW A;  2VKI A;  3OHM B;  1U27 A;  1WJM A;  2DHK A;  1X86 A;  2W2W A;  3PEG A;  2KUQ A;  2N0Y A;  4YL8 A;  1PMS A;  3CXB B;  2EJ8 A;  4KHO A;  5DHF B;  2H7E A;  2GS0 A;  2W2X C;  1X1G A;  2MFQ A;  4OT1 A;  4DBB A;  1DBH A;  1RRP B;  2I1K A;  2DX1 A;  2D9V A;  1UPR A;  4KHA A;  2JP2 A;  3NWA A;  4L6E A;  2D4Q A;  4KHB A;  4HB3 B;  3ODW A;  2IFS A;  1PFJ A;  1EAZ A;  2RLO A;  1QQG A;  2RGN B;  5GOW B;  2VRW B;  3PVL A;  4H8S A;  5KQ1 A;  2KUP A;  2QKM A;  3DXD A;  3GYP A;  2Y7B A;  3TFM A;  3OAN A;  2YSZ A;  2R0D A;  2HE7 A;  4GMX B;  1H10 A;  3ULC A;  1DYN A;  1U2B A;  4QXA B;  1DDM A;  3P7Z A;  3PZD A;  4QJ4 B;  2NBV A;  2COA A;  1PLS A;  3AJ4 A;  3ODO A;  1FHW A;  2I5C A;  1BTN A;  1LB1 A;  1IRS A;  4L1R A;  3PSC A;  5CLQ B;  3X23 A;  4DXA B;  3VIA A;  2R09 A;  2Z0O A;  5D27 A;  1UEF A;  4HAT B;  3A8Q A;  3ML4 A;  2Y8G A;  4KAX B;  3FVC A;  4HAW B;  3ZDT A;  3TW1 A;  5LON B;  5LOP B;  2EMS A;  4F7U P;  4PQ0 A;  2PZ1 A;  2ZKM X;  4NSW A;  1E5W A;  2RNR B;  3CIK A;  1X1F A;  2VSZ A;  3G9W A;  2DTC A;  4HHV A;  2K2U A;  2ROZ B;  4A6F B;  1NTY A;  2OQB A;  1FHX A;  2DKQ A;  3FSS A;  2Z0P A;  4A6K A;  4EJN A;  4CYE A;  5J3Q A;  2LG1 A;  1W1H A;  1V5P A;  2DHI A;  4TKN A;  4XWX A;  3D8D A;  3D8F A;  1XKE A;  3A8P A;  1XR0 B;  3O96 A;  4DX8 A;  1U5E A;  3N7C A;  4HAV B;  4A6F A;  3ULB A;  5FI0 A;  3WYF B;  5M4Y B;  2IYB A;  1J19 A;  1Q67 A;  1WJ1 A;  1FB8 A;  3NWF A;  4OSN A;  4IFS A;  5DH9 B;  3T06 A;  3MDB C;  1OQN A;  2DKP A;  1X11 A;  3HQC A;  2LOX A;  1P5T A;  2L2I A;  1H4R A;  2EMT A;  3IVF A;  2P0F A;  3AU4 A;  3HK0 A;  5CLL B;  2Z13 A;  1Y19 B;  2DX5 A;  1ZM0 A;  1FGY A;  1N3H A;  2D11 A;  4P7I A;  5JLJ B;  2AEH A;  5DI9 B;  4MK0 A;  4WSF A;  2K49 A;  3SNH A;  2N23 A;  1I2H A;  5J3T A;  1MKE A;  4HAX B;  4HB2 B; 
#chains in the Genus database with same CATH homology
 1BAK A;  1ZVR A;  2P8V A;  2DN6 A;  4ZRI A;  2CRF A;  5DIF B;  2DFK A;  2X18 A;  4EMO A;  2D9Y A;  2KCJ A;  3TO1 A;  2LOZ A;  2OTX A;  4K2P A;  2W2X D;  3KZ1 A;  3U7D A;  2Y8F A;  1ZSQ A;  1W1D A;  3UZT A;  5HE3 A;  4K17 A;  4K81 A;  1M7R A;  1XOD A;  2HTH B;  2G35 A;  1MPH A;  3DXC A;  1FOE A;  4K2O A;  1GC6 A;  3PP2 A;  2K2J A;  2YS3 A;  2D2Q A;  4HDQ A;  1FGZ A;  1P6S A;  2LYD A;  1K5G B;  4PNK A;  2D9X A;  4F7G A;  1KI1 B;  2UZR A;  2ELB A;  2ZPY A;  5C5B B;  2D10 A;  2Q13 A;  2DA0 A;  2YS5 A;  1RJ2 A;  5HE1 A;  5JP4 A;  5D3V A;  3HW2 B;  1QC6 A;  4Z2N A;  3VOQ A;  4GXB A;  1XX0 A;  1ZC4 B;  1Y5O A;  5D3W A;  1U5F A;  3PG7 A;  2Z0Q A;  5C79 A;  1U5G A;  1FAO A;  2YF0 A;  3SO6 A;  3P6A A;  1UPQ A;  1DDV A;  2YT0 A;  1BWN A;  4HAZ B;  5DHA B;  4NY0 A;  4A6H A;  2L1C A;  2LUL A;  2RVB B;  1UNP A;  1UNQ A;  1DDW A;  2M14 A;  2UVM A;  3ODX A;  5FI1 A;  2EC1 A;  5JHG A;  2GJY A;  1GC7 A;  3PVU A;  2RUK B;  1TQZ A;  2YS1 A;  1AQC A;  2CAY A;  1OY2 A;  5J3Y A;  3GYO A;  2YVC A;  1SGH A;  1U29 A;  1X05 A;  4KVG B;  1NI2 A;  2DYQ A;  4GN1 A;  2NZ8 B;  3TVV A;  4C0A A;  3QWM A;  3RCP A;  4MT7 A;  3F5R A;  1GG3 A;  4DX9 0;  2UZS A;  2MWN B;  1V5U A;  4EKU A;  3SUZ A;  1MIX A;  2COC A;  4Z2M B;  1XD4 A;  4D0N B;  2P0H A;  3TCA A;  1AWE A;  3U8Z A;  2P0D A;  3BJI A;  1I7A A;  4CHJ A;  2DYN A;  1MK7 B;  2CY4 A;  2E2X A;  5C5B A;  5KQ4 A;  2XQN M;  5C6R A;  1LW3 A;  5D3X A;  1WGU A;  1TXD A;  4HB0 B;  5JHH A;  4B6H A;  2ROV A;  3KSY A;  1U5D A;  4HAY B;  1K5D B;  1Z87 A;  2LKO A;  1M7E A;  1WVH A;  2J0M A;  4ZRK A;  1KZ7 A;  4IAP A;  1WG7 A;  2D9W A;  3D8E A;  4WVF B;  2ELA A;  1MIZ B;  3LJU X;  3AU5 A;  2K00 A;  4HDO A;  4BBK A;  2D9Z A;  1V89 A;  4F7H A;  5KCV A;  3V5W A;  3MPX A;  2COF A;  5D3Y A;  1EF1 A;  2GCL A;  3QBV B;  1UNR A;  2NMB A;  3M1I B;  1EGX A;  1FHO A;  2I5F A;  3QIJ A;  1MAI A;  2J0J A;  4HB4 B;  1J0W A;  2CY5 A;  4Y94 A;  1W1G A;  2YRY A;  4YON A;  3SV1 A;  4CHM A;  2FJL A;  4WJ7 A;  4A5K A;  3DXE A;  1B55 A;  2DHJ A;  3ZVR A;  3SYX A;  1WI1 A;  5L81 A;  3PVW A;  1EVH A;  2COD A;  3FEH A;  1V61 A;  5EFX A;  4HAU B;  4MY6 A;  2MKR A;  3WA0 A;  3A98 B;  1NTV A;  1KZG A;  2RSG A;  3KRW A;  4KHB B;  3FM8 C;  4GZU A;  2ADZ A;  1NU2 A;  1MK9 B;  2J59 M;  4GPT B;  2J0K A;  1WGQ A;  2BCJ A;  2QKL A;  3BIN A;  1ZC3 B;  4IOY X;  2AL6 A;  2YT1 A;  4TYZ A;  3KRX A;  2MDX A;  2KGX B;  2H7D A;  2M38 A;  2V76 A;  2GCJ A;  3NSU A;  3KY9 A;  4GMV A;  1V5M A;  1XCG A;  5HE2 A;  5HE0 A;  4ZRJ A;  3F0W A;  2I1J A;  1ISN A;  1SHC A;  1DRO A;  1P3R A;  1BTK A;  1TJ6 A;  2DLW A;  5C16 A;  1V88 A;  1OMW A;  2VKI A;  1U27 A;  1WJM A;  2DHK A;  1X86 A;  2W2W A;  3PEG A;  2N0Y A;  4YL8 A;  1PMS A;  3CXB B;  2EJ8 A;  4KHO A;  5DHF B;  2H7E A;  2GS0 A;  2W2X C;  1X1G A;  2MFQ A;  4DBB A;  1DBH A;  1RRP B;  2I1K A;  2DX1 A;  2D9V A;  1UPR A;  4KHA A;  2JP2 A;  4L6E A;  2D4Q A;  4HB3 B;  3ODW A;  2IFS A;  1PFJ A;  1EAZ A;  2RLO A;  1QQG A;  2RGN B;  5GOW B;  2VRW B;  3PVL A;  4H8S A;  5KQ1 A;  2KUP A;  2QKM A;  3DXD A;  3GYP A;  2Y7B A;  3TFM A;  3OAN A;  2YSZ A;  2R0D A;  2HE7 A;  4GMX B;  1H10 A;  3ULC A;  1DYN A;  1U2B A;  1DDM A;  3P7Z A;  3PZD A;  2COA A;  1PLS A;  3AJ4 A;  3ODO A;  1FHW A;  2I5C A;  1BTN A;  1LB1 A;  1IRS A;  3X23 A;  3PSC A;  5CLQ B;  4DXA B;  3VIA A;  2R09 A;  2Z0O A;  5D27 A;  1UEF A;  4HAT B;  3A8Q A;  3ML4 A;  2Y8G A;  4KAX B;  4HAW B;  3ZDT A;  3TW1 A;  5LON B;  5LOP B;  2EMS A;  4F7U P;  4PQ0 A;  2PZ1 A;  4NSW A;  1E5W A;  2RNR B;  3CIK A;  1X1F A;  2VSZ A;  3G9W A;  2DTC A;  4HHV A;  2K2U A;  2ROZ B;  4A6F B;  1NTY A;  2OQB A;  1FHX A;  2DKQ A;  3FSS A;  2Z0P A;  4A6K A;  4EJN A;  4CYE A;  5J3Q A;  2LG1 A;  1W1H A;  1V5P A;  2DHI A;  4TKN A;  4XWX A;  3D8D A;  3D8F A;  1XKE A;  3A8P A;  1XR0 B;  3O96 A;  4DX8 A;  1U5E A;  3N7C A;  4HAV B;  4A6F A;  3ULB A;  5FI0 A;  3WYF B;  2IYB A;  1J19 A;  1Q67 A;  1WJ1 A;  1FB8 A;  4IFS A;  5DH9 B;  3T06 A;  3MDB C;  1OQN A;  2DKP A;  1X11 A;  3HQC A;  2LOX A;  1P5T A;  2L2I A;  1H4R A;  2EMT A;  3IVF A;  2P0F A;  3AU4 A;  3HK0 A;  5CLL B;  1Y19 B;  2DX5 A;  1ZM0 A;  1FGY A;  1N3H A;  2D11 A;  4P7I A;  5JLJ B;  2AEH A;  5DI9 B;  4MK0 A;  4WSF A;  3SNH A;  2N23 A;  1I2H A;  5J3T A;  1MKE A;  4HAX B;  4HB2 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...