1OQNA

Crystal structure of the phosphotyrosine binding domain (ptb) of mouse disabled 1 (dab1)
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
150
structure length
150
Chain Sequence
RSEATLIKRFKGEGVRYKAKLIGIDEVSAARGDKLCQDSMMKLKGVVAGARSKGEHKQKIFLTISFGGIKIFDEKTGALQHHHAVHEISYIAKDITDHRAFGYVCGKEGNHRFVAIKTAQAAEPVILDLRDLFQLIYELKQREELEKKAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Disabled homolog 1
publication title Crystal structures of the Dab homology domains of mouse disabled 1 and 2
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
total genus 47
structure length 150
sequence length 150
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00640 PID Phosphotyrosine interaction domain (PTB/PID)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1oqnA00
2ROZB 2D10A 5LOPB 3FEHA 3PZDA 1IRSA 2Z0QA 4HATB 2XQNM 4D0NB 2RLOA 4HB2B 1J19A 2L2IA 3CIKA 1WGQA 3LJUX 1Z87A 2GCJA 4K2PA 3A8QA 3ZDTA 1GC6A 4C0AA 1MAIA 2I5FA 1FOEA 2KUPA 4KHOA 4EMOA 2FJLA 3TO1A 1MPHA 4K2OA 3KRWA 2DHIA 2QKMA 2COFA 4YONA 2P8VA 5CLLB 5HE2A 3D8EA 1PFJA 1QC6A 1PLSA 2ZPYA 5L81A 4MY6A 4NSWA 1DROA 2DLWA 4WJ7A 4PQ0A 2EMSA 1AWEA 1E5WA 3A8PA 2CY4A 1XR0B 2VRWB 4ZRKA 1ZC3B 4HAWB 2YT1A 1X1FA 4IAPA 5DHAB 1GG3A 1V5MA 1EAZA 1AQCA 2EMTA 4TKNA 2D11A 2DFKA 1K5DB 1LB1A 2EC1A 1Y19B 4Z2NA 1WJ1A 3VOQA 2LYDA 4L6EA 3FM8C 4Z2MB 1ZM0A 1V5PA 4A6FA 2LOZA 1FAOA 1KZGA 3BINA 3VIAA 1U29A 1GC7A 3UZTA 3HK0A 2Z0OA 2D9VA 1W1GA 3D8FA 3P7ZA 3TW1A 4IFSA 1UPQA 1U27A 3M1IB 5C5BB 2PZ1A 2COCA 2IYBA 2YS5A 3AU5A 4ZRIA 4DXAB 1OQNA 1I2HA 2K00A 3SUZA 3TFMA 4GZUA 3QBVB 1FHOA 3P6AA 4A6HA 2YF0A 5HE1A 1UPRA 2AL6A 2R09A 2R0DA 2CODA 2D9XA 3G9WA 5FI1A 5LONB 1WI1A 3ODXA 3O96A 1NU2A 2Y7BA 4CYEA 1K5GB 3F0WA 4A5KA 1H10A 3D8DA 4HDQA 1X86A 2ROVA 4WSFA 5DH9B 3SO6A 5CLQB 5C16A 2DTCA 3KRXA 1W1HA 1WVHA 3AU4A 1BTKA 3PSCA 4F7GA 2I5CA 1LW3A 3HQCA 2MDXA 1SGHA 1X11A 2HTHB 2RSGA 2KCJA 3X23A 4GMVA 4F7HA 5KQ1A 1BAKA 1M7EA 2YSZA 1RJ2A 2COAA 2D9YA 4HHVA 4YL8A 4Y94A 4DBBA 3CXBB 3KZ1A 2P0HA 4NY0A 3WA0A 2J0JA 4IOYX 2KGXB 3PVLA 2D2QA 2Q13A 2GS0A 4KHBB 2W2XC 2D9ZA 1MIZB 2LKOA 3ML4A 1X05A 2QKLA 3NSUA 1BTNA 1MK9B 1U5DA 4XWXA 4MT7A 2LG1A 5DIFB 3KSYA 1Q67A 2MKRA 2UZSA 4GN1A 4CHMA 1XODA 2GCLA 1FHWA 1X1GA 3MPXA 2H7DA 5JHHA 2DKPA 1Y5OA 2I1KA 5JHGA 1I7AA 3WYFB 2YRYA 2X18A 3PVWA 5D27A 3PG7A 2G35A 5GOWB 3U7DA 3KY9A 2K2UA 2P0DA 3DXEA 5KCVA 2W2XD 5D3YA 1FB8A 1U5EA 1ZVRA 2D9WA 3A98B 2N0YA 2ELAA 5DI9B 2RNRB 4ZRJA 2K2JA 2LOXA 2YT0A 5J3QA 3TVVA 1DYNA 2J59M 2DHJA 2H7EA 1DDMA 2CRFA 3IVFA 4A6KA 5HE0A 3OANA 3ODOA 2DN6A 3V5WA 1RRPB 1P5TA 4K17A 2RUKB 3AJ4A 2RVBB 1U5GA 4HAXB 3GYPA 1TXDA 3MDBC 2M14A 2Y8FA 3HW2B 1MKEA 3ULBA 3SV1A 3RCPA 2ELBA 4DX8A 2DHKA 2V76A 3SNHA 1V89A 5C5BA 5D3XA 1DDWA 1MIXA 2OQBA 1ISNA 2UZRA 1SHCA 3BJIA 2VSZA 4GXBA 4PNKA 5C6RA 4EJNA 2YS1A 1W1DA 2Y8GA 1U5FA 4K81A 1PMSA 5JLJB 1N3HA 1V88A 4HB3B 1UNPA 2Z0PA 1XX0A 1V61A 3ZVRA 1TQZA 2DA0A 3N7CA 5KQ4A 4A6FB 3DXDA 1KI1B 5D3WA 2LULA 1FGYA 2DX5A 2VKIA 4BBKA 2YS3A 2D4QA 2DYNA 2DKQA 2OTXA 1B55A 1XCGA 2E2XA 4HAYB 3ODWA 4GPTB 3PVUA 4DX90 3PP2A 2DYQA 3U8ZA 3GYOA 4GMXB 2N23A 2AEHA 1DDVA 1TJ6A 1WG7A 5FI0A 4HAVB 3QWMA 2GJYA 5D3VA 4HDOA 3F5RA 4F7UP 5J3YA 4H8SA 1EVHA 5J3TA 1WGUA 2JP2A 1DBHA 1QQGA 3FSSA 1EF1A 4TYZA 3SYXA 4B6HA 5EFXA 1EGXA 1UNRA 1P3RA 2J0KA 4HB4B 2W2WA 2M38A 2ADZA 1OMWA 2RGNB 2DX1A 1M7RA 5C79A 3ULCA 4EKUA 4P7IA 1FGZA 2P0FA 3DXCA 3PEGA 4KVGB 2YVCA 2MWNB 2CAYA 4HB0B 2L1CA 1UNQA 5DHFB 1XD4A 5HE3A 1P6SA 1XKEA 1H4RA 1U2BA 2CY5A 2NMBA 1NTYA 4KAXB 2J0MA 5JP4A 3QIJA 4MK0A 1MK7B 1V5UA 1OY2A 2HE7A 4HAZB 2NZ8B 1KZ7A 1J0WA 1WJMA 2I1JA 1ZC4B 4HAUB 4KHAA 2IFSA 3TCAA 2EJ8A 4WVFB 1ZSQA 3T06A 1NI2A 4CHJA 2BCJA 1NTVA 1BWNA 1UEFA 2MFQA 2UVMA 1FHXA
chains in the Genus database with same CATH superfamily
2ROZB 2D10A 5LOPB 3FEHA 3PZDA 1IRSA 2Z0QA 4HATB 2XQNM 4D0NB 2RLOA 4HB2B 1J19A 2L2IA 3CIKA 1WGQA 3LJUX 1Z87A 2GCJA 4K2PA 3A8QA 3ZDTA 1GC6A 4C0AA 1MAIA 2I5FA 1FOEA 2KUPA 4KHOA 4EMOA 2FJLA 3TO1A 1MPHA 4K2OA 3KRWA 2DHIA 2QKMA 2COFA 4YONA 4HSIA 2P8VA 5CLLB 5HE2A 3D8EA 1PFJA 1QC6A 1PLSA 2ZPYA 5L81A 4MY6A 3FVCA 4NSWA 1DROA 2DLWA 4WJ7A 4PQ0A 2EMSA 1AWEA 1E5WA 3A8PA 2CY4A 1XR0B 2VRWB 4GOUA 4ZRKA 1ZC3B 4HAWB 2YT1A 1X1FA 4IAPA 5DHAB 1GG3A 1V5MA 2ZKMX 1EAZA 1AQCA 2EMTA 4TKNA 2D11A 2DFKA 1K5DB 1LB1A 2EC1A 1Y19B 3NWFA 1WJ1A 4Z2NA 3VOQA 2LYDA 4L6EA 3FM8C 4Z2MB 1ZM0A 1V5PA 1T77A 4A6FA 2LOZA 1FAOA 2KIGA 1KZGA 3BINA 4DIXA 3VIAA 1U29A 1GC7A 3UZTA 3HK0A 2Z0OA 2D9VA 1W1GA 3D8FA 3P7ZA 3TW1A 4IFSA 1UPQA 1U27A 3M1IB 5C5BB 2PZ1A 2COCA 2IYBA 2YS5A 3AU5A 4ZRIA 4DXAB 1OQNA 4OT1A 1I2HA 2K00A 3SUZA 3TFMA 4GZUA 3QBVB 1FHOA 3P6AA 4A6HA 2YF0A 5HE1A 1UPRA 2AL6A 2R09A 2R0DA 2YT2A 2CODA 2D9XA 3G9WA 5FI1A 5LONB 1WI1A 3ODXA 3O96A 1NU2A 1ZYIA 2Y7BA 1K5GB 3F0WA 4A5KA 4CYEA 1H10A 3D8DA 4HDQA 1X86A 2ROVA 5IRSA 4WSFA 5DH9B 2NBVA 3SO6A 5CLQB 5C16A 2DTCA 3KRXA 1W1HA 1WVHA 3AU4A 1BTKA 3PSCA 4QJ3B 4F7GA 2I5CA 1LW3A 3HQCA 2MDXA 1SGHA 1X11A 2HTHB 2RSGA 2KCJA 3X23A 4GMVA 4D6WA 4F7HA 5KQ1A 1BAKA 1M7EA 2YSZA 1RJ2A 2COAA 2D9YA 4HHVA 4YL8A 4Y94A 4DBBA 3CXBB 3KZ1A 2P0HA 4NY0A 3WA0A 2J0JA 4QJ5B 4IOYX 2KGXB 3PVLA 2D2QA 2Q13A 2GS0A 4KHBB 2W2XC 2D9ZA 3U12A 1MIZB 2LKOA 3ML4A 1X05A 2QKLA 3NSUA 1BTNA 1MK9B 3B77A 1U5DA 4XWXA 4MT7A 5LG4B 2LG1A 5DIFB 4QXAB 3KSYA 1Q67A 2MKRA 4CSQA 2UZSA 4GN1A 4CHMA 1XODA 2GCLA 1FHWA 2Z13A 2GUMA 2K8EA 1X1GA 3MPXA 4L1RA 2H7DA 5JHHA 2DKPA 1Y5OA 2I1KA 5JHGA 1I7AA 3WYFB 3NW8A 2Z14A 2YRYA 2X18A 3PVWA 5D27A 3PG7A 4GNKB 2G35A 5GOWB 3U7DA 3KY9A 2K2UA 2P0DA 4KHBA 3DXEA 5M4YB 5KCVA 2W2XD 5D3YA 1FB8A 1U5EA 1ZVRA 2D9WA 3A98B 2N0YA 2ELAA 2FJUB 4QJ4B 5DI9B 2RNRB 4ZRJA 2K2JA 2LOXA 2YT0A 5J3QA 3TVVA 1DYNA 2J59M 2DHJA 2H7EA 1DDMA 2CRFA 3IVFA 4A6KA 5HE0A 3OANA 3ODOA 2DN6A 3V5WA 1RRPB 1P5TA 4K17A 2RUKB 3AJ4A 5I2SA 2RVBB 1U5GA 4HAXB 3GYPA 1TXDA 3MDBC 2M14A 2Y8FA 3HW2B 1MKEA 3ULBA 3SV1A 3RCPA 2ELBA 4DX8A 5I2MA 2DHKA 2V76A 4OSNA 1V89A 3SNHA 5C5BA 5D3XA 1DDWA 1MIXA 2OQBA 1ISNA 2UZRA 1SHCA 3BJIA 2VSZA 4GXBA 4PNKA 5C6RA 4EJNA 2YS1A 1W1DA 2Y8GA 1U5FA 3OHMB 4K81A 3NWDA 1PMSA 5JLJB 1N3HA 1V88A 4HB3B 1UNPA 2Z0PA 1XX0A 1V61A 3ZVRA 1TQZA 2DA0A 3N7CA 5KQ4A 4A6FB 3DXDA 1KI1B 5D3WA 2LULA 1FGYA 2KUQA 2DX5A 2VKIA 4BBKA 2YS3A 2D4QA 2DYNA 2DKQA 2OTXA 1B55A 1XCGA 2E2XA 4HAYB 3A58A 3ODWA 4GPTB 3PVUA 2K49A 4DX90 3PP2A 2DYQA 3U8ZA 3GYOA 4GMXB 2KR0A 2N23A 2AEHA 1DDVA 1TJ6A 1WG7A 5FI0A 4HAVB 3QWMA 2GJYA 5D3VA 2RRFA 3HSAA 4HDOA 3F5RA 4F7UP 5J3YA 4H8SA 1EVHA 5J3TA 1WGUA 2JP2A 3NWAA 1DBHA 1QQGA 3FSSA 1EF1A 4TYZA 3SYXA 4B6HA 5EFXA 1EGXA 1UNRA 1P3RA 2J0KA 4HB4B 3DCXA 2W2WA 2M38A 2ADZA 1OMWA 2RGNB 2DX1A 1M7RA 5C79A 3ULCA 4EKUA 4P7IA 1FGZA 2P0FA 3DXCA 3PEGA 2KIEA 4KVGB 2YVCA 2MWNB 2CAYA 4HB0B 2L1CA 1UNQA 5DHFB 2Z4DA 1XD4A 5HE3A 1P6SA 1XKEA 1H4RA 1U2BA 2CY5A 2NMBA 1NTYA 4KAXB 2J0MA 5JP4A 2Z59A 3QIJA 4MK0A 1MK7B 1V5UA 1OY2A 2HE7A 4HAZB 2NZ8B 1KZ7A 1MI1A 1J0WA 1WJMA 2I1JA 1ZC4B 4HAUB 4KHAA 2IFSA 3TCAA 2EJ8A 3HIEA 4WVFB 1ZSQA 3T06A 1NI2A 4CHJA 2BCJA 1NTVA 1BWNA 1UEFA 2MFQA 2R2YA 2UVMA 1FHXA
chains in the Genus database with same CATH topology
2ROZB 2D10A 5LOPB 3FEHA 3PZDA 1IRSA 2Z0QA 4HATB 2XQNM 4D0NB 2RLOA 4HB2B 1J19A 2L2IA 3CIKA 1WGQA 3LJUX 1Z87A 2GCJA 4K2PA 3A8QA 3ZDTA 1GC6A 4C0AA 1MAIA 2I5FA 1FOEA 2KUPA 4KHOA 4EMOA 2FJLA 3TO1A 1MPHA 4K2OA 3KRWA 2DHIA 2QKMA 2COFA 4YONA 2P8VA 5CLLB 5HE2A 3D8EA 1PFJA 1QC6A 1PLSA 2ZPYA 5L81A 4MY6A 4NSWA 1DROA 2DLWA 4WJ7A 4PQ0A 2EMSA 1AWEA 1E5WA 3A8PA 2CY4A 1XR0B 2VRWB 4ZRKA 1ZC3B 4HAWB 2YT1A 1X1FA 4IAPA 5DHAB 1GG3A 1V5MA 1EAZA 1AQCA 2EMTA 4TKNA 2D11A 2DFKA 1K5DB 1LB1A 2EC1A 1Y19B 4Z2NA 1WJ1A 3VOQA 2LYDA 4L6EA 3FM8C 4Z2MB 1ZM0A 1V5PA 4A6FA 2LOZA 1FAOA 1KZGA 3BINA 3VIAA 1U29A 1GC7A 3UZTA 3HK0A 2Z0OA 2D9VA 1W1GA 3D8FA 3P7ZA 3TW1A 4IFSA 1UPQA 1U27A 3M1IB 5C5BB 2PZ1A 2COCA 2IYBA 2YS5A 3AU5A 4ZRIA 4DXAB 1OQNA 1I2HA 2K00A 3SUZA 3TFMA 4GZUA 3QBVB 1FHOA 3P6AA 4A6HA 2YF0A 5HE1A 1UPRA 2AL6A 2R09A 2R0DA 2CODA 2D9XA 3G9WA 5FI1A 5LONB 1WI1A 3ODXA 3O96A 1NU2A 2Y7BA 4CYEA 1K5GB 3F0WA 4A5KA 1H10A 3D8DA 4HDQA 1X86A 2ROVA 4WSFA 5DH9B 3SO6A 5CLQB 5C16A 2DTCA 3KRXA 1W1HA 1WVHA 3AU4A 1BTKA 3PSCA 4F7GA 2I5CA 1LW3A 3HQCA 2MDXA 1SGHA 1X11A 2HTHB 2RSGA 2KCJA 3X23A 4GMVA 4F7HA 5KQ1A 1BAKA 1M7EA 2YSZA 1RJ2A 2COAA 2D9YA 4HHVA 4YL8A 4Y94A 4DBBA 3CXBB 3KZ1A 2P0HA 4NY0A 3WA0A 2J0JA 4IOYX 2KGXB 3PVLA 2D2QA 2Q13A 2GS0A 4KHBB 2W2XC 2D9ZA 1MIZB 2LKOA 3ML4A 1X05A 2QKLA 3NSUA 1BTNA 1MK9B 1U5DA 4XWXA 4MT7A 2LG1A 5DIFB 3KSYA 1Q67A 2MKRA 2UZSA 4GN1A 4CHMA 1XODA 2GCLA 1FHWA 1X1GA 3MPXA 2H7DA 5JHHA 2DKPA 1Y5OA 2I1KA 5JHGA 1I7AA 3WYFB 2YRYA 2X18A 3PVWA 5D27A 3PG7A 2G35A 5GOWB 3U7DA 3KY9A 2K2UA 2P0DA 3DXEA 5KCVA 2W2XD 5D3YA 1FB8A 1U5EA 1ZVRA 2D9WA 3A98B 2N0YA 2ELAA 5DI9B 2RNRB 4ZRJA 2K2JA 2LOXA 2YT0A 5J3QA 3TVVA 1DYNA 2J59M 2DHJA 2H7EA 1DDMA 2CRFA 3IVFA 4A6KA 5HE0A 3OANA 3ODOA 2DN6A 3V5WA 1RRPB 1P5TA 4K17A 2RUKB 3AJ4A 2RVBB 1U5GA 4HAXB 3GYPA 1TXDA 3MDBC 2M14A 2Y8FA 3HW2B 1MKEA 3ULBA 3SV1A 3RCPA 2ELBA 4DX8A 2DHKA 2V76A 3SNHA 1V89A 5C5BA 5D3XA 1DDWA 1MIXA 2OQBA 1ISNA 2UZRA 1SHCA 3BJIA 2VSZA 4GXBA 4PNKA 5C6RA 4EJNA 2YS1A 1W1DA 2Y8GA 1U5FA 4K81A 1PMSA 5JLJB 1N3HA 1V88A 4HB3B 1UNPA 2Z0PA 1XX0A 1V61A 3ZVRA 1TQZA 2DA0A 3N7CA 5KQ4A 4A6FB 3DXDA 1KI1B 5D3WA 2LULA 1FGYA 2DX5A 2VKIA 4BBKA 2YS3A 2D4QA 2DYNA 2DKQA 2OTXA 1B55A 1XCGA 2E2XA 4HAYB 3ODWA 4GPTB 3PVUA 4DX90 3PP2A 2DYQA 3U8ZA 3GYOA 4GMXB 2N23A 2AEHA 1DDVA 1TJ6A 1WG7A 5FI0A 4HAVB 3QWMA 2GJYA 5D3VA 4HDOA 3F5RA 4F7UP 5J3YA 4H8SA 1EVHA 5J3TA 1WGUA 2JP2A 1DBHA 1QQGA 3FSSA 1EF1A 4TYZA 3SYXA 4B6HA 5EFXA 1EGXA 1UNRA 1P3RA 2J0KA 4HB4B 2W2WA 2M38A 2ADZA 1OMWA 2RGNB 2DX1A 1M7RA 5C79A 3ULCA 4EKUA 4P7IA 1FGZA 2P0FA 3DXCA 3PEGA 4KVGB 2YVCA 2MWNB 2CAYA 4HB0B 2L1CA 1UNQA 5DHFB 1XD4A 5HE3A 1P6SA 1XKEA 1H4RA 1U2BA 2CY5A 2NMBA 1NTYA 4KAXB 2J0MA 5JP4A 3QIJA 4MK0A 1MK7B 1V5UA 1OY2A 2HE7A 4HAZB 2NZ8B 1KZ7A 1J0WA 1WJMA 2I1JA 1ZC4B 4HAUB 4KHAA 2IFSA 3TCAA 2EJ8A 4WVFB 1ZSQA 3T06A 1NI2A 4CHJA 2BCJA 1NTVA 1BWNA 1UEFA 2MFQA 2UVMA 1FHXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ROZ B;  2D10 A;  5LOP B;  3FEH A;  3PZD A;  1IRS A;  2Z0Q A;  4HAT B;  2XQN M;  4D0N B;  2RLO A;  4HB2 B;  1J19 A;  2L2I A;  3CIK A;  1WGQ A;  3LJU X;  1Z87 A;  2GCJ A;  4K2P A;  3A8Q A;  3ZDT A;  1GC6 A;  4C0A A;  1MAI A;  2I5F A;  1FOE A;  2KUP A;  4KHO A;  4EMO A;  2FJL A;  3TO1 A;  1MPH A;  4K2O A;  3KRW A;  2DHI A;  2QKM A;  2COF A;  4YON A;  2P8V A;  5CLL B;  5HE2 A;  3D8E A;  1PFJ A;  1QC6 A;  1PLS A;  2ZPY A;  5L81 A;  4MY6 A;  4NSW A;  1DRO A;  2DLW A;  4WJ7 A;  4PQ0 A;  2EMS A;  1AWE A;  1E5W A;  3A8P A;  2CY4 A;  1XR0 B;  2VRW B;  4ZRK A;  1ZC3 B;  4HAW B;  2YT1 A;  1X1F A;  4IAP A;  5DHA B;  1GG3 A;  1V5M A;  1EAZ A;  1AQC A;  2EMT A;  4TKN A;  2D11 A;  2DFK A;  1K5D B;  1LB1 A;  2EC1 A;  1Y19 B;  4Z2N A;  1WJ1 A;  3VOQ A;  2LYD A;  4L6E A;  3FM8 C;  4Z2M B;  1ZM0 A;  1V5P A;  4A6F A;  2LOZ A;  1FAO A;  1KZG A;  3BIN A;  3VIA A;  1U29 A;  1GC7 A;  3UZT A;  3HK0 A;  2Z0O A;  2D9V A;  1W1G A;  3D8F A;  3P7Z A;  3TW1 A;  4IFS A;  1UPQ A;  1U27 A;  3M1I B;  5C5B B;  2PZ1 A;  2COC A;  2IYB A;  2YS5 A;  3AU5 A;  4ZRI A;  4DXA B;  1OQN A;  1I2H A;  2K00 A;  3SUZ A;  3TFM A;  4GZU A;  3QBV B;  1FHO A;  3P6A A;  4A6H A;  2YF0 A;  5HE1 A;  1UPR A;  2AL6 A;  2R09 A;  2R0D A;  2COD A;  2D9X A;  3G9W A;  5FI1 A;  5LON B;  1WI1 A;  3ODX A;  3O96 A;  1NU2 A;  2Y7B A;  4CYE A;  1K5G B;  3F0W A;  4A5K A;  1H10 A;  3D8D A;  4HDQ A;  1X86 A;  2ROV A;  4WSF A;  5DH9 B;  3SO6 A;  5CLQ B;  5C16 A;  2DTC A;  3KRX A;  1W1H A;  1WVH A;  3AU4 A;  1BTK A;  3PSC A;  4F7G A;  2I5C A;  1LW3 A;  3HQC A;  2MDX A;  1SGH A;  1X11 A;  2HTH B;  2RSG A;  2KCJ A;  3X23 A;  4GMV A;  4F7H A;  5KQ1 A;  1BAK A;  1M7E A;  2YSZ A;  1RJ2 A;  2COA A;  2D9Y A;  4HHV A;  4YL8 A;  4Y94 A;  4DBB A;  3CXB B;  3KZ1 A;  2P0H A;  4NY0 A;  3WA0 A;  2J0J A;  4IOY X;  2KGX B;  3PVL A;  2D2Q A;  2Q13 A;  2GS0 A;  4KHB B;  2W2X C;  2D9Z A;  1MIZ B;  2LKO A;  3ML4 A;  1X05 A;  2QKL A;  3NSU A;  1BTN A;  1MK9 B;  1U5D A;  4XWX A;  4MT7 A;  2LG1 A;  5DIF B;  3KSY A;  1Q67 A;  2MKR A;  2UZS A;  4GN1 A;  4CHM A;  1XOD A;  2GCL A;  1FHW A;  1X1G A;  3MPX A;  2H7D A;  5JHH A;  2DKP A;  1Y5O A;  2I1K A;  5JHG A;  1I7A A;  3WYF B;  2YRY A;  2X18 A;  3PVW A;  5D27 A;  3PG7 A;  2G35 A;  5GOW B;  3U7D A;  3KY9 A;  2K2U A;  2P0D A;  3DXE A;  5KCV A;  2W2X D;  5D3Y A;  1FB8 A;  1U5E A;  1ZVR A;  2D9W A;  3A98 B;  2N0Y A;  2ELA A;  5DI9 B;  2RNR B;  4ZRJ A;  2K2J A;  2LOX A;  2YT0 A;  5J3Q A;  3TVV A;  1DYN A;  2J59 M;  2DHJ A;  2H7E A;  1DDM A;  2CRF A;  3IVF A;  4A6K A;  5HE0 A;  3OAN A;  3ODO A;  2DN6 A;  3V5W A;  1RRP B;  1P5T A;  4K17 A;  2RUK B;  3AJ4 A;  2RVB B;  1U5G A;  4HAX B;  3GYP A;  1TXD A;  3MDB C;  2M14 A;  2Y8F A;  3HW2 B;  1MKE A;  3ULB A;  3SV1 A;  3RCP A;  2ELB A;  4DX8 A;  2DHK A;  2V76 A;  3SNH A;  1V89 A;  5C5B A;  5D3X A;  1DDW A;  1MIX A;  2OQB A;  1ISN A;  2UZR A;  1SHC A;  3BJI A;  2VSZ A;  4GXB A;  4PNK A;  5C6R A;  4EJN A;  2YS1 A;  1W1D A;  2Y8G A;  1U5F A;  4K81 A;  1PMS A;  5JLJ B;  1N3H A;  1V88 A;  4HB3 B;  1UNP A;  2Z0P A;  1XX0 A;  1V61 A;  3ZVR A;  1TQZ A;  2DA0 A;  3N7C A;  5KQ4 A;  4A6F B;  3DXD A;  1KI1 B;  5D3W A;  2LUL A;  1FGY A;  2DX5 A;  2VKI A;  4BBK A;  2YS3 A;  2D4Q A;  2DYN A;  2DKQ A;  2OTX A;  1B55 A;  1XCG A;  2E2X A;  4HAY B;  3ODW A;  4GPT B;  3PVU A;  4DX9 0;  3PP2 A;  2DYQ A;  3U8Z A;  3GYO A;  4GMX B;  2N23 A;  2AEH A;  1DDV A;  1TJ6 A;  1WG7 A;  5FI0 A;  4HAV B;  3QWM A;  2GJY A;  5D3V A;  4HDO A;  3F5R A;  4F7U P;  5J3Y A;  4H8S A;  1EVH A;  5J3T A;  1WGU A;  2JP2 A;  1DBH A;  1QQG A;  3FSS A;  1EF1 A;  4TYZ A;  3SYX A;  4B6H A;  5EFX A;  1EGX A;  1UNR A;  1P3R A;  2J0K A;  4HB4 B;  2W2W A;  2M38 A;  2ADZ A;  1OMW A;  2RGN B;  2DX1 A;  1M7R A;  5C79 A;  3ULC A;  4EKU A;  4P7I A;  1FGZ A;  2P0F A;  3DXC A;  3PEG A;  4KVG B;  2YVC A;  2MWN B;  2CAY A;  4HB0 B;  2L1C A;  1UNQ A;  5DHF B;  1XD4 A;  5HE3 A;  1P6S A;  1XKE A;  1H4R A;  1U2B A;  2CY5 A;  2NMB A;  1NTY A;  4KAX B;  2J0M A;  5JP4 A;  3QIJ A;  4MK0 A;  1MK7 B;  1V5U A;  1OY2 A;  2HE7 A;  4HAZ B;  2NZ8 B;  1KZ7 A;  1J0W A;  1WJM A;  2I1J A;  1ZC4 B;  4HAU B;  4KHA A;  2IFS A;  3TCA A;  2EJ8 A;  4WVF B;  1ZSQ A;  3T06 A;  1NI2 A;  4CHJ A;  2BCJ A;  1NTV A;  1BWN A;  1UEF A;  2MFQ A;  2UVM A;  1FHX A; 
#chains in the Genus database with same CATH topology
 2ROZ B;  2D10 A;  5LOP B;  3FEH A;  3PZD A;  1IRS A;  2Z0Q A;  4HAT B;  2XQN M;  4D0N B;  2RLO A;  4HB2 B;  1J19 A;  2L2I A;  3CIK A;  1WGQ A;  3LJU X;  1Z87 A;  2GCJ A;  4K2P A;  3A8Q A;  3ZDT A;  1GC6 A;  4C0A A;  1MAI A;  2I5F A;  1FOE A;  2KUP A;  4KHO A;  4EMO A;  2FJL A;  3TO1 A;  1MPH A;  4K2O A;  3KRW A;  2DHI A;  2QKM A;  2COF A;  4YON A;  4HSI A;  2P8V A;  5CLL B;  5HE2 A;  3D8E A;  1PFJ A;  1QC6 A;  1PLS A;  2ZPY A;  5L81 A;  4MY6 A;  3FVC A;  4NSW A;  1DRO A;  2DLW A;  4WJ7 A;  4PQ0 A;  2EMS A;  1AWE A;  1E5W A;  3A8P A;  2CY4 A;  1XR0 B;  2VRW B;  4GOU A;  4ZRK A;  1ZC3 B;  4HAW B;  2YT1 A;  1X1F A;  4IAP A;  5DHA B;  1GG3 A;  1V5M A;  2ZKM X;  1EAZ A;  1AQC A;  2EMT A;  4TKN A;  2D11 A;  2DFK A;  1K5D B;  1LB1 A;  2EC1 A;  1Y19 B;  3NWF A;  1WJ1 A;  4Z2N A;  3VOQ A;  2LYD A;  4L6E A;  3FM8 C;  4Z2M B;  1ZM0 A;  1V5P A;  1T77 A;  4A6F A;  2LOZ A;  1FAO A;  2KIG A;  1KZG A;  3BIN A;  4DIX A;  3VIA A;  1U29 A;  1GC7 A;  3UZT A;  3HK0 A;  2Z0O A;  2D9V A;  1W1G A;  3D8F A;  3P7Z A;  3TW1 A;  4IFS A;  1UPQ A;  1U27 A;  3M1I B;  5C5B B;  2PZ1 A;  2COC A;  2IYB A;  2YS5 A;  3AU5 A;  4ZRI A;  4DXA B;  1OQN A;  4OT1 A;  1I2H A;  2K00 A;  3SUZ A;  3TFM A;  4GZU A;  3QBV B;  1FHO A;  3P6A A;  4A6H A;  2YF0 A;  5HE1 A;  1UPR A;  2AL6 A;  2R09 A;  2R0D A;  2YT2 A;  2COD A;  2D9X A;  3G9W A;  5FI1 A;  5LON B;  1WI1 A;  3ODX A;  3O96 A;  1NU2 A;  1ZYI A;  2Y7B A;  1K5G B;  3F0W A;  4A5K A;  4CYE A;  1H10 A;  3D8D A;  4HDQ A;  1X86 A;  2ROV A;  5IRS A;  4WSF A;  5DH9 B;  2NBV A;  3SO6 A;  5CLQ B;  5C16 A;  2DTC A;  3KRX A;  1W1H A;  1WVH A;  3AU4 A;  1BTK A;  3PSC A;  4QJ3 B;  4F7G A;  2I5C A;  1LW3 A;  3HQC A;  2MDX A;  1SGH A;  1X11 A;  2HTH B;  2RSG A;  2KCJ A;  3X23 A;  4GMV A;  4D6W A;  4F7H A;  5KQ1 A;  1BAK A;  1M7E A;  2YSZ A;  1RJ2 A;  2COA A;  2D9Y A;  4HHV A;  4YL8 A;  4Y94 A;  4DBB A;  3CXB B;  3KZ1 A;  2P0H A;  4NY0 A;  3WA0 A;  2J0J A;  4QJ5 B;  4IOY X;  2KGX B;  3PVL A;  2D2Q A;  2Q13 A;  2GS0 A;  4KHB B;  2W2X C;  2D9Z A;  3U12 A;  1MIZ B;  2LKO A;  3ML4 A;  1X05 A;  2QKL A;  3NSU A;  1BTN A;  1MK9 B;  3B77 A;  1U5D A;  4XWX A;  4MT7 A;  5LG4 B;  2LG1 A;  5DIF B;  4QXA B;  3KSY A;  1Q67 A;  2MKR A;  4CSQ A;  2UZS A;  4GN1 A;  4CHM A;  1XOD A;  2GCL A;  1FHW A;  2Z13 A;  2GUM A;  2K8E A;  1X1G A;  3MPX A;  4L1R A;  2H7D A;  5JHH A;  2DKP A;  1Y5O A;  2I1K A;  5JHG A;  1I7A A;  3WYF B;  3NW8 A;  2Z14 A;  2YRY A;  2X18 A;  3PVW A;  5D27 A;  3PG7 A;  4GNK B;  2G35 A;  5GOW B;  3U7D A;  3KY9 A;  2K2U A;  2P0D A;  4KHB A;  3DXE A;  5M4Y B;  5KCV A;  2W2X D;  5D3Y A;  1FB8 A;  1U5E A;  1ZVR A;  2D9W A;  3A98 B;  2N0Y A;  2ELA A;  2FJU B;  4QJ4 B;  5DI9 B;  2RNR B;  4ZRJ A;  2K2J A;  2LOX A;  2YT0 A;  5J3Q A;  3TVV A;  1DYN A;  2J59 M;  2DHJ A;  2H7E A;  1DDM A;  2CRF A;  3IVF A;  4A6K A;  5HE0 A;  3OAN A;  3ODO A;  2DN6 A;  3V5W A;  1RRP B;  1P5T A;  4K17 A;  2RUK B;  3AJ4 A;  5I2S A;  2RVB B;  1U5G A;  4HAX B;  3GYP A;  1TXD A;  3MDB C;  2M14 A;  2Y8F A;  3HW2 B;  1MKE A;  3ULB A;  3SV1 A;  3RCP A;  2ELB A;  4DX8 A;  5I2M A;  2DHK A;  2V76 A;  4OSN A;  1V89 A;  3SNH A;  5C5B A;  5D3X A;  1DDW A;  1MIX A;  2OQB A;  1ISN A;  2UZR A;  1SHC A;  3BJI A;  2VSZ A;  4GXB A;  4PNK A;  5C6R A;  4EJN A;  2YS1 A;  1W1D A;  2Y8G A;  1U5F A;  3OHM B;  4K81 A;  3NWD A;  1PMS A;  5JLJ B;  1N3H A;  1V88 A;  4HB3 B;  1UNP A;  2Z0P A;  1XX0 A;  1V61 A;  3ZVR A;  1TQZ A;  2DA0 A;  3N7C A;  5KQ4 A;  4A6F B;  3DXD A;  1KI1 B;  5D3W A;  2LUL A;  1FGY A;  2KUQ A;  2DX5 A;  2VKI A;  4BBK A;  2YS3 A;  2D4Q A;  2DYN A;  2DKQ A;  2OTX A;  1B55 A;  1XCG A;  2E2X A;  4HAY B;  3A58 A;  3ODW A;  4GPT B;  3PVU A;  2K49 A;  4DX9 0;  3PP2 A;  2DYQ A;  3U8Z A;  3GYO A;  4GMX B;  2KR0 A;  2N23 A;  2AEH A;  1DDV A;  1TJ6 A;  1WG7 A;  5FI0 A;  4HAV B;  3QWM A;  2GJY A;  5D3V A;  2RRF A;  3HSA A;  4HDO A;  3F5R A;  4F7U P;  5J3Y A;  4H8S A;  1EVH A;  5J3T A;  1WGU A;  2JP2 A;  3NWA A;  1DBH A;  1QQG A;  3FSS A;  1EF1 A;  4TYZ A;  3SYX A;  4B6H A;  5EFX A;  1EGX A;  1UNR A;  1P3R A;  2J0K A;  4HB4 B;  3DCX A;  2W2W A;  2M38 A;  2ADZ A;  1OMW A;  2RGN B;  2DX1 A;  1M7R A;  5C79 A;  3ULC A;  4EKU A;  4P7I A;  1FGZ A;  2P0F A;  3DXC A;  3PEG A;  2KIE A;  4KVG B;  2YVC A;  2MWN B;  2CAY A;  4HB0 B;  2L1C A;  1UNQ A;  5DHF B;  2Z4D A;  1XD4 A;  5HE3 A;  1P6S A;  1XKE A;  1H4R A;  1U2B A;  2CY5 A;  2NMB A;  1NTY A;  4KAX B;  2J0M A;  5JP4 A;  2Z59 A;  3QIJ A;  4MK0 A;  1MK7 B;  1V5U A;  1OY2 A;  2HE7 A;  4HAZ B;  2NZ8 B;  1KZ7 A;  1MI1 A;  1J0W A;  1WJM A;  2I1J A;  1ZC4 B;  4HAU B;  4KHA A;  2IFS A;  3TCA A;  2EJ8 A;  3HIE A;  4WVF B;  1ZSQ A;  3T06 A;  1NI2 A;  4CHJ A;  2BCJ A;  1NTV A;  1BWN A;  1UEF A;  2MFQ A;  2R2Y A;  2UVM A;  1FHX A; 
#chains in the Genus database with same CATH homology
 2ROZ B;  2D10 A;  5LOP B;  3FEH A;  3PZD A;  1IRS A;  2Z0Q A;  4HAT B;  2XQN M;  4D0N B;  2RLO A;  4HB2 B;  1J19 A;  2L2I A;  3CIK A;  1WGQ A;  3LJU X;  1Z87 A;  2GCJ A;  4K2P A;  3A8Q A;  3ZDT A;  1GC6 A;  4C0A A;  1MAI A;  2I5F A;  1FOE A;  2KUP A;  4KHO A;  4EMO A;  2FJL A;  3TO1 A;  1MPH A;  4K2O A;  3KRW A;  2DHI A;  2QKM A;  2COF A;  4YON A;  2P8V A;  5CLL B;  5HE2 A;  3D8E A;  1PFJ A;  1QC6 A;  1PLS A;  2ZPY A;  5L81 A;  4MY6 A;  4NSW A;  1DRO A;  2DLW A;  4WJ7 A;  4PQ0 A;  2EMS A;  1AWE A;  1E5W A;  3A8P A;  2CY4 A;  1XR0 B;  2VRW B;  4ZRK A;  1ZC3 B;  4HAW B;  2YT1 A;  1X1F A;  4IAP A;  5DHA B;  1GG3 A;  1V5M A;  1EAZ A;  1AQC A;  2EMT A;  4TKN A;  2D11 A;  2DFK A;  1K5D B;  1LB1 A;  2EC1 A;  1Y19 B;  4Z2N A;  1WJ1 A;  3VOQ A;  2LYD A;  4L6E A;  3FM8 C;  4Z2M B;  1ZM0 A;  1V5P A;  4A6F A;  2LOZ A;  1FAO A;  1KZG A;  3BIN A;  3VIA A;  1U29 A;  1GC7 A;  3UZT A;  3HK0 A;  2Z0O A;  2D9V A;  1W1G A;  3D8F A;  3P7Z A;  3TW1 A;  4IFS A;  1UPQ A;  1U27 A;  3M1I B;  5C5B B;  2PZ1 A;  2COC A;  2IYB A;  2YS5 A;  3AU5 A;  4ZRI A;  4DXA B;  1OQN A;  1I2H A;  2K00 A;  3SUZ A;  3TFM A;  4GZU A;  3QBV B;  1FHO A;  3P6A A;  4A6H A;  2YF0 A;  5HE1 A;  1UPR A;  2AL6 A;  2R09 A;  2R0D A;  2COD A;  2D9X A;  3G9W A;  5FI1 A;  5LON B;  1WI1 A;  3ODX A;  3O96 A;  1NU2 A;  2Y7B A;  4CYE A;  1K5G B;  3F0W A;  4A5K A;  1H10 A;  3D8D A;  4HDQ A;  1X86 A;  2ROV A;  4WSF A;  5DH9 B;  3SO6 A;  5CLQ B;  5C16 A;  2DTC A;  3KRX A;  1W1H A;  1WVH A;  3AU4 A;  1BTK A;  3PSC A;  4F7G A;  2I5C A;  1LW3 A;  3HQC A;  2MDX A;  1SGH A;  1X11 A;  2HTH B;  2RSG A;  2KCJ A;  3X23 A;  4GMV A;  4F7H A;  5KQ1 A;  1BAK A;  1M7E A;  2YSZ A;  1RJ2 A;  2COA A;  2D9Y A;  4HHV A;  4YL8 A;  4Y94 A;  4DBB A;  3CXB B;  3KZ1 A;  2P0H A;  4NY0 A;  3WA0 A;  2J0J A;  4IOY X;  2KGX B;  3PVL A;  2D2Q A;  2Q13 A;  2GS0 A;  4KHB B;  2W2X C;  2D9Z A;  1MIZ B;  2LKO A;  3ML4 A;  1X05 A;  2QKL A;  3NSU A;  1BTN A;  1MK9 B;  1U5D A;  4XWX A;  4MT7 A;  2LG1 A;  5DIF B;  3KSY A;  1Q67 A;  2MKR A;  2UZS A;  4GN1 A;  4CHM A;  1XOD A;  2GCL A;  1FHW A;  1X1G A;  3MPX A;  2H7D A;  5JHH A;  2DKP A;  1Y5O A;  2I1K A;  5JHG A;  1I7A A;  3WYF B;  2YRY A;  2X18 A;  3PVW A;  5D27 A;  3PG7 A;  2G35 A;  5GOW B;  3U7D A;  3KY9 A;  2K2U A;  2P0D A;  3DXE A;  5KCV A;  2W2X D;  5D3Y A;  1FB8 A;  1U5E A;  1ZVR A;  2D9W A;  3A98 B;  2N0Y A;  2ELA A;  5DI9 B;  2RNR B;  4ZRJ A;  2K2J A;  2LOX A;  2YT0 A;  5J3Q A;  3TVV A;  1DYN A;  2J59 M;  2DHJ A;  2H7E A;  1DDM A;  2CRF A;  3IVF A;  4A6K A;  5HE0 A;  3OAN A;  3ODO A;  2DN6 A;  3V5W A;  1RRP B;  1P5T A;  4K17 A;  2RUK B;  3AJ4 A;  2RVB B;  1U5G A;  4HAX B;  3GYP A;  1TXD A;  3MDB C;  2M14 A;  2Y8F A;  3HW2 B;  1MKE A;  3ULB A;  3SV1 A;  3RCP A;  2ELB A;  4DX8 A;  2DHK A;  2V76 A;  3SNH A;  1V89 A;  5C5B A;  5D3X A;  1DDW A;  1MIX A;  2OQB A;  1ISN A;  2UZR A;  1SHC A;  3BJI A;  2VSZ A;  4GXB A;  4PNK A;  5C6R A;  4EJN A;  2YS1 A;  1W1D A;  2Y8G A;  1U5F A;  4K81 A;  1PMS A;  5JLJ B;  1N3H A;  1V88 A;  4HB3 B;  1UNP A;  2Z0P A;  1XX0 A;  1V61 A;  3ZVR A;  1TQZ A;  2DA0 A;  3N7C A;  5KQ4 A;  4A6F B;  3DXD A;  1KI1 B;  5D3W A;  2LUL A;  1FGY A;  2DX5 A;  2VKI A;  4BBK A;  2YS3 A;  2D4Q A;  2DYN A;  2DKQ A;  2OTX A;  1B55 A;  1XCG A;  2E2X A;  4HAY B;  3ODW A;  4GPT B;  3PVU A;  4DX9 0;  3PP2 A;  2DYQ A;  3U8Z A;  3GYO A;  4GMX B;  2N23 A;  2AEH A;  1DDV A;  1TJ6 A;  1WG7 A;  5FI0 A;  4HAV B;  3QWM A;  2GJY A;  5D3V A;  4HDO A;  3F5R A;  4F7U P;  5J3Y A;  4H8S A;  1EVH A;  5J3T A;  1WGU A;  2JP2 A;  1DBH A;  1QQG A;  3FSS A;  1EF1 A;  4TYZ A;  3SYX A;  4B6H A;  5EFX A;  1EGX A;  1UNR A;  1P3R A;  2J0K A;  4HB4 B;  2W2W A;  2M38 A;  2ADZ A;  1OMW A;  2RGN B;  2DX1 A;  1M7R A;  5C79 A;  3ULC A;  4EKU A;  4P7I A;  1FGZ A;  2P0F A;  3DXC A;  3PEG A;  4KVG B;  2YVC A;  2MWN B;  2CAY A;  4HB0 B;  2L1C A;  1UNQ A;  5DHF B;  1XD4 A;  5HE3 A;  1P6S A;  1XKE A;  1H4R A;  1U2B A;  2CY5 A;  2NMB A;  1NTY A;  4KAX B;  2J0M A;  5JP4 A;  3QIJ A;  4MK0 A;  1MK7 B;  1V5U A;  1OY2 A;  2HE7 A;  4HAZ B;  2NZ8 B;  1KZ7 A;  1J0W A;  1WJM A;  2I1J A;  1ZC4 B;  4HAU B;  4KHA A;  2IFS A;  3TCA A;  2EJ8 A;  4WVF B;  1ZSQ A;  3T06 A;  1NI2 A;  4CHJ A;  2BCJ A;  1NTV A;  1BWN A;  1UEF A;  2MFQ A;  2UVM A;  1FHX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...