1OQNA

Crystal structure of the phosphotyrosine binding domain (ptb) of mouse disabled 1 (dab1)
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
150
structure length
150
Chain Sequence
RSEATLIKRFKGEGVRYKAKLIGIDEVSAARGDKLCQDSMMKLKGVVAGARSKGEHKQKIFLTISFGGIKIFDEKTGALQHHHAVHEISYIAKDITDHRAFGYVCGKEGNHRFVAIKTAQAAEPVILDLRDLFQLIYELKQREELEKKAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structures of the Dab homology domains of mouse disabled 1 and 2
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
molecule keywords Disabled homolog 1
total genus 47
structure length 150
sequence length 150
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00640 PID Phosphotyrosine interaction domain (PTB/PID)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1oqnA00
5JP4A 1NTVA 3HW2B 1ZVRA 4KVGB 5CLLB 1X86A 2N23A 3X23A 5C5BA 1U29A 1J0WA 1MKEA 2P0FA 3BJIA 4WJ7A 4ZRJA 4F7GA 5HE0A 1GG3A 3ULBA 4GZUA 4CYEA 2JP2A 2P0HA 3ULCA 2YSZA 2M38A 2D9XA 1QC6A 5C5BB 3MDBC 1V5PA 5HE2A 2ROZB 2D4QA 2DX5A 5D3VA 1GC6A 4HB3B 1PLSA 2DKQA 4HHVA 2J0JA 5D27A 2L2IA 5J3TA 3SV1A 1WGQA 1WI1A 5HE1A 5JHGA 2ZPYA 4IAPA 1GC7A 1U5EA 2I1KA 5J3QA 4A6HA 2M14A 2EMSA 1EF1A 1P6SA 2P8VA 4C0AA 4YL8A 4HB4B 3DXDA 5KQ4A 1MAIA 2K2JA 2LYDA 1XR0B 3A8PA 3QBVB 5DH9B 1V5MA 1ZC4B 2NZ8B 2D9VA 2DA0A 4HB2B 2CY5A 2DFKA 2D9YA 2H7EA 5D3YA 1DDMA 3AU5A 1U5FA 3TVVA 2GCJA 1V5UA 2DN6A 1FAOA 3SUZA 2KUPA 2D2QA 3ODOA 2Q13A 1FGYA 2MKRA 4NY0A 1Y5OA 3DXCA 2D9ZA 3SO6A 1M7EA 5KCVA 3N7CA 1FB8A 2COFA 3F5RA 1K5GB 2W2XC 2CRFA 4EJNA 2DKPA 3CIKA 1XX0A 2MFQA 1NU2A 4BBKA 2X18A 1U27A 2Y8FA 4CHMA 2R09A 2LOXA 5DIFB 2PZ1A 1E5WA 1W1HA 4XWXA 3ODWA 1DDWA 4A6FB 4GPTB 1FHXA 1ZM0A 1AQCA 1MK7B 4DX8A 2CODA 3O96A 4DX90 1SGHA 3AU4A 2KGXB 2W2WA 1H4RA 3KRWA 4KHAA 5C6RA 5JHHA 5D3XA 2UVMA 2VKIA 5GOWB 1TQZA 4PQ0A 3D8EA 4IFSA 4ZRIA 3RCPA 2N0YA 4A5KA 4HDQA 1XKEA 3UZTA 3LJUX 1X11A 4KAXB 3ODXA 4L6EA 1EGXA 2QKMA 4F7UP 2D9WA 3SYXA 2P0DA 1FHOA 2DLWA 3TO1A 3PZDA 2DYNA 1TJ6A 2IYBA 2CAYA 2D10A 3PP2A 3WYFB 1QQGA 3A98B 3ML4A 1KZGA 2ADZA 2YS5A 2UZSA 4EMOA 3QWMA 2NMBA 2YT1A 2HTHB 2Y7BA 1WGUA 1J19A 4NSWA 4CHJA 4PNKA 1W1DA 3ZVRA 4WVFB 2H7DA 2IFSA 3PVWA 4WSFA 1BTNA 2COAA 4HAYB 3IVFA 3NSUA 1V88A 4Y94A 1NI2A 2MDXA 5DI9B 2EJ8A 4D0NB 1V61A 1OY2A 4HAXB 1WJ1A 2EMTA 2ELAA 4GXBA 2W2XD 4ZRKA 1KZ7A 1UPRA 1I2HA 4K81A 2K2UA 1XD4A 2AL6A 2GS0A 3T06A 3TCAA 2GJYA 3HK0A 1X1FA 1WVHA 2J59M 3P7ZA 3GYOA 1SHCA 3A8QA 2ELBA 5J3YA 2VRWB 2MWNB 4A6KA 3FM8C 4DBBA 3BINA 4HATB 2G35A 4GN1A 1MIZB 1XODA 2OQBA 2FJLA 4HB0B 1MK9B 2RSGA 5HE3A 3FSSA 2Z0QA 1Y19B 4IOYX 4Z2NA 2J0KA 1UNQA 2DTCA 1EVHA 3P6AA 3G9WA 4MT7A 3VOQA 1H10A 3GYPA 4KHOA 3KY9A 1LB1A 1K5DB 1IRSA 5C16A 1OQNA 2KCJA 4HAWB 1TXDA 3TFMA 1BTKA 4A6FA 1FGZA 5EFXA 1ZC3B 1RJ2A 1X05A 1V89A 1UEFA 2DHIA 2UZRA 4GMVA 5KQ1A 2I1JA 3OANA 1MPHA 4K2PA 1UNRA 2LKOA 1FOEA 3PG7A 2DHKA 3PVUA 3TW1A 4B6HA 2BCJA 4HDOA 2XQNM 2YF0A 3VIAA 2V76A 4TKNA 3D8DA 3D8FA 4K2OA 1EAZA 4YONA 2L1CA 5L81A 2RVBB 4GMXB 3F0WA 3MPXA 1B55A 1M7RA 2RNRB 1NTYA 1UNPA 3AJ4A 2YRYA 3PEGA 2DYQA 1MIXA 2I5CA 1U5GA 5D3WA 5DHAB 2YT0A 3CXBB 4P7IA 1FHWA 4HAVB 1OMWA 4DXAB 3KZ1A 2Z0PA 1UPQA 1WJMA 3U8ZA 1LW3A 2EC1A 1ZSQA 4HAUB 5LOPB 2Y8GA 2ROVA 3WA0A 1X1GA 3V5WA 1DROA 2RLOA 3PSCA 2HE7A 5FI1A 1U5DA 2DHJA 1W1GA 5CLQB 1Q67A 2E2XA 2LULA 3ZDTA 1BWNA 3KSYA 2YVCA 3PVLA 1DBHA 2GCLA 2RUKB 2LG1A 1I7AA 1DYNA 1PFJA 2CY4A 3KRXA 5JLJB 2QKLA 1PMSA 4MY6A 3M1IB 2YS3A 2AEHA 5DHFB 1Z87A 4MK0A 5LONB 3FEHA 2D11A 1RRPB 2COCA 2J0MA 1WG7A 1P3RA 2VSZA 2K00A 2DX1A 5C79A 4H8SA 5FI0A 1U2BA 1KI1B 1N3HA 2YS1A 2RGNB 4Z2MB 4F7HA 2OTXA 4EKUA 1XCGA 3U7DA 4KHBB 4HAZB 4K17A 1AWEA 2R0DA 1BAKA 2Z0OA 3DXEA 2I5FA 1P5TA 3HQCA 1DDVA 2LOZA 3QIJA 4TYZA 1ISNA 3SNHA
chains in the Genus database with same CATH superfamily
5JP4A 1NTVA 3HW2B 1ZVRA 4KVGB 5CLLB 1X86A 2N23A 3X23A 5C5BA 1U29A 1J0WA 1MKEA 2P0FA 3BJIA 3NWDA 1MI1A 4WJ7A 4ZRJA 4F7GA 5HE0A 1GG3A 3ULBA 4GZUA 2KUQA 4CYEA 2JP2A 2P0HA 3ULCA 2YSZA 2M38A 2D9XA 1QC6A 5C5BB 3MDBC 1V5PA 5HE2A 2ROZB 2D4QA 2DX5A 5D3VA 1GC6A 4HB3B 1PLSA 2DKQA 4HHVA 2J0JA 5D27A 2L2IA 5J3TA 3SV1A 1WGQA 1WI1A 5HE1A 5JHGA 2ZPYA 4IAPA 1GC7A 1U5EA 2I1KA 5J3QA 4A6HA 2M14A 2EMSA 1EF1A 1P6SA 2P8VA 4C0AA 4YL8A 4HB4B 4QJ5B 3DXDA 5KQ4A 1MAIA 2K2JA 2LYDA 1XR0B 3A8PA 3QBVB 5DH9B 1V5MA 1ZC4B 2NZ8B 2D9VA 2DA0A 4HB2B 2CY5A 2DFKA 2D9YA 2H7EA 5D3YA 1DDMA 3AU5A 1U5FA 3TVVA 2GCJA 1V5UA 4QXAB 2DN6A 1FAOA 3SUZA 2KUPA 2D2QA 3ODOA 2Q13A 1FGYA 2MKRA 4NY0A 1Y5OA 3DXCA 2D9ZA 3SO6A 1M7EA 5KCVA 3N7CA 1FB8A 5M4YB 2COFA 3F5RA 1K5GB 2W2XC 2CRFA 4EJNA 2DKPA 2K49A 3CIKA 1XX0A 2MFQA 1NU2A 4BBKA 2X18A 1U27A 2Y8FA 4CHMA 2R09A 2LOXA 5DIFB 2PZ1A 1E5WA 1W1HA 4XWXA 3ODWA 1DDWA 4A6FB 4GPTB 1FHXA 1ZM0A 1AQCA 4HSIA 1MK7B 4DX8A 2CODA 3O96A 4DX90 4QJ3B 1SGHA 3AU4A 2KGXB 2W2WA 1H4RA 3KRWA 4KHAA 5C6RA 5JHHA 5D3XA 2UVMA 2VKIA 5GOWB 1TQZA 4PQ0A 3D8EA 4IFSA 4ZRIA 3RCPA 2N0YA 4A5KA 4HDQA 4OT1A 1XKEA 5I2SA 3UZTA 3LJUX 5LG4B 3NW8A 2KIGA 1X11A 3ODXA 4KAXB 4L6EA 1EGXA 2QKMA 4F7UP 2D9WA 3SYXA 2P0DA 1FHOA 2DLWA 3TO1A 3PZDA 2DYNA 1TJ6A 2IYBA 2CAYA 2D10A 3PP2A 3WYFB 4QJ4B 1QQGA 3A98B 3ML4A 1KZGA 2ADZA 4L1RA 2YS5A 2UZSA 4EMOA 3QWMA 2NMBA 2YT1A 2HTHB 2Y7BA 1WGUA 1J19A 4NSWA 5I2MA 4CHJA 4PNKA 2Z13A 1W1DA 3ZVRA 3NWFA 4WVFB 2KR0A 2H7DA 2IFSA 3PVWA 4WSFA 1BTNA 2COAA 3HIEA 4HAYB 3IVFA 3NSUA 1V88A 4Y94A 1NI2A 3B77A 2MDXA 5DI9B 2EJ8A 4D0NB 1V61A 1OY2A 4HAXB 1WJ1A 2EMTA 2ELAA 4GXBA 2W2XD 4ZRKA 3A58A 1KZ7A 1UPRA 1I2HA 3HSAA 4K81A 2K2UA 1XD4A 2AL6A 2GS0A 3T06A 3TCAA 2GJYA 3HK0A 2Z59A 1X1FA 1WVHA 2J59M 3P7ZA 3GYOA 2Z4DA 1SHCA 5IRSA 3A8QA 2ELBA 5J3YA 2VRWB 2MWNB 3DCXA 2RRFA 2FJUB 4A6KA 3FM8C 4DBBA 3FVCA 3BINA 2G35A 4HATB 4GN1A 1MIZB 1XODA 2OQBA 2K8EA 2FJLA 2R2YA 4HB0B 1MK9B 2RSGA 5HE3A 3FSSA 2Z0QA 4D6WA 1Y19B 4IOYX 4Z2NA 4KHBA 2J0KA 1UNQA 2DTCA 1EVHA 3P6AA 3G9WA 2ZKMX 4DIXA 4MT7A 3VOQA 1H10A 3GYPA 4KHOA 3KY9A 1LB1A 1K5DB 1IRSA 4CSQA 5C16A 1OQNA 2KCJA 4HAWB 1TXDA 3TFMA 1BTKA 4A6FA 1FGZA 5EFXA 1ZC3B 2YT2A 1RJ2A 1X05A 1V89A 1UEFA 2DHIA 2UZRA 4GMVA 5KQ1A 1ZYIA 2I1JA 3OANA 1MPHA 4K2PA 3U12A 1UNRA 2LKOA 1FOEA 3PG7A 2DHKA 3PVUA 3TW1A 4B6HA 2BCJA 3OHMB 4HDOA 2XQNM 2YF0A 3VIAA 2V76A 4TKNA 3D8DA 3D8FA 4K2OA 1EAZA 4YONA 2L1CA 5L81A 2RVBB 2GUMA 4GOUA 4GMXB 3F0WA 3MPXA 1B55A 1M7RA 2RNRB 1NTYA 1UNPA 3AJ4A 2YRYA 3PEGA 2DYQA 1MIXA 2I5CA 1U5GA 5D3WA 5DHAB 2YT0A 3CXBB 3NWAA 4P7IA 1FHWA 4HAVB 1OMWA 4DXAB 3KZ1A 2Z0PA 1UPQA 1WJMA 3U8ZA 1LW3A 2EC1A 1ZSQA 4HAUB 5LOPB 2Y8GA 2ROVA 3WA0A 1X1GA 3V5WA 1DROA 2RLOA 3PSCA 2HE7A 5FI1A 1U5DA 2DHJA 4OSNA 1W1GA 5CLQB 1Q67A 2E2XA 2KIEA 2LULA 3ZDTA 1BWNA 3KSYA 2YVCA 3PVLA 1DBHA 2GCLA 2RUKB 2LG1A 1I7AA 1DYNA 1PFJA 2CY4A 3KRXA 5JLJB 2QKLA 1T77A 1PMSA 4MY6A 3M1IB 2YS3A 2AEHA 5DHFB 1Z87A 4MK0A 5LONB 3FEHA 2D11A 1RRPB 2COCA 2J0MA 1WG7A 1P3RA 2VSZA 2K00A 2DX1A 5C79A 4H8SA 5FI0A 1U2BA 1KI1B 1N3HA 2YS1A 2RGNB 4Z2MB 4F7HA 2OTXA 4EKUA 1XCGA 3U7DA 4GNKB 4KHBB 4HAZB 4K17A 1AWEA 2R0DA 1BAKA 2Z0OA 3DXEA 2Z14A 2I5FA 1P5TA 3HQCA 1DDVA 2LOZA 3QIJA 4TYZA 1ISNA 2NBVA 3SNHA
chains in the Genus database with same CATH topology
5JP4A 1NTVA 3HW2B 1ZVRA 4KVGB 5CLLB 1X86A 2N23A 3X23A 5C5BA 1U29A 1J0WA 1MKEA 2P0FA 3BJIA 4WJ7A 4ZRJA 4F7GA 5HE0A 1GG3A 3ULBA 4GZUA 4CYEA 2JP2A 2P0HA 3ULCA 2YSZA 2M38A 2D9XA 1QC6A 5C5BB 3MDBC 1V5PA 5HE2A 2ROZB 2D4QA 2DX5A 5D3VA 1GC6A 4HB3B 1PLSA 2DKQA 4HHVA 2J0JA 5D27A 2L2IA 5J3TA 3SV1A 1WGQA 1WI1A 5HE1A 5JHGA 2ZPYA 4IAPA 1GC7A 1U5EA 2I1KA 5J3QA 4A6HA 2M14A 2EMSA 1EF1A 1P6SA 2P8VA 4C0AA 4YL8A 4HB4B 3DXDA 5KQ4A 1MAIA 2K2JA 2LYDA 1XR0B 3A8PA 3QBVB 5DH9B 1V5MA 1ZC4B 2NZ8B 2D9VA 2DA0A 4HB2B 2CY5A 2DFKA 2D9YA 2H7EA 5D3YA 1DDMA 3AU5A 1U5FA 3TVVA 2GCJA 1V5UA 2DN6A 1FAOA 3SUZA 2KUPA 2D2QA 3ODOA 2Q13A 1FGYA 2MKRA 4NY0A 1Y5OA 3DXCA 2D9ZA 3SO6A 1M7EA 5KCVA 3N7CA 1FB8A 2COFA 3F5RA 1K5GB 2W2XC 2CRFA 4EJNA 2DKPA 3CIKA 1XX0A 2MFQA 1NU2A 4BBKA 2X18A 1U27A 2Y8FA 4CHMA 2R09A 2LOXA 5DIFB 2PZ1A 1E5WA 1W1HA 4XWXA 3ODWA 1DDWA 4A6FB 4GPTB 1FHXA 1ZM0A 1AQCA 1MK7B 4DX8A 2CODA 3O96A 4DX90 1SGHA 3AU4A 2KGXB 2W2WA 1H4RA 3KRWA 4KHAA 5C6RA 5JHHA 5D3XA 2UVMA 2VKIA 5GOWB 1TQZA 4PQ0A 3D8EA 4IFSA 4ZRIA 3RCPA 2N0YA 4A5KA 4HDQA 1XKEA 3UZTA 3LJUX 1X11A 4KAXB 3ODXA 4L6EA 1EGXA 2QKMA 4F7UP 2D9WA 3SYXA 2P0DA 1FHOA 2DLWA 3TO1A 3PZDA 2DYNA 1TJ6A 2IYBA 2CAYA 2D10A 3PP2A 3WYFB 1QQGA 3A98B 3ML4A 1KZGA 2ADZA 2YS5A 2UZSA 4EMOA 3QWMA 2NMBA 2YT1A 2HTHB 2Y7BA 1WGUA 1J19A 4NSWA 4CHJA 4PNKA 1W1DA 3ZVRA 4WVFB 2H7DA 2IFSA 3PVWA 4WSFA 1BTNA 2COAA 4HAYB 3IVFA 3NSUA 1V88A 4Y94A 1NI2A 2MDXA 5DI9B 2EJ8A 4D0NB 1V61A 1OY2A 4HAXB 1WJ1A 2EMTA 2ELAA 4GXBA 2W2XD 4ZRKA 1KZ7A 1UPRA 1I2HA 4K81A 2K2UA 1XD4A 2AL6A 2GS0A 3T06A 3TCAA 2GJYA 3HK0A 1X1FA 1WVHA 2J59M 3P7ZA 3GYOA 1SHCA 3A8QA 2ELBA 5J3YA 2VRWB 2MWNB 4A6KA 3FM8C 4DBBA 3BINA 4HATB 2G35A 4GN1A 1MIZB 1XODA 2OQBA 2FJLA 4HB0B 1MK9B 2RSGA 5HE3A 3FSSA 2Z0QA 1Y19B 4IOYX 4Z2NA 2J0KA 1UNQA 2DTCA 1EVHA 3P6AA 3G9WA 4MT7A 3VOQA 1H10A 3GYPA 4KHOA 3KY9A 1LB1A 1K5DB 1IRSA 5C16A 1OQNA 2KCJA 4HAWB 1TXDA 3TFMA 1BTKA 4A6FA 1FGZA 5EFXA 1ZC3B 1RJ2A 1X05A 1V89A 1UEFA 2DHIA 2UZRA 4GMVA 5KQ1A 2I1JA 3OANA 1MPHA 4K2PA 1UNRA 2LKOA 1FOEA 3PG7A 2DHKA 3PVUA 3TW1A 4B6HA 2BCJA 4HDOA 2XQNM 2YF0A 3VIAA 2V76A 4TKNA 3D8DA 3D8FA 4K2OA 1EAZA 4YONA 2L1CA 5L81A 2RVBB 4GMXB 3F0WA 3MPXA 1B55A 1M7RA 2RNRB 1NTYA 1UNPA 3AJ4A 2YRYA 3PEGA 2DYQA 1MIXA 2I5CA 1U5GA 5D3WA 5DHAB 2YT0A 3CXBB 4P7IA 1FHWA 4HAVB 1OMWA 4DXAB 3KZ1A 2Z0PA 1UPQA 1WJMA 3U8ZA 1LW3A 2EC1A 1ZSQA 4HAUB 5LOPB 2Y8GA 2ROVA 3WA0A 1X1GA 3V5WA 1DROA 2RLOA 3PSCA 2HE7A 5FI1A 1U5DA 2DHJA 1W1GA 5CLQB 1Q67A 2E2XA 2LULA 3ZDTA 1BWNA 3KSYA 2YVCA 3PVLA 1DBHA 2GCLA 2RUKB 2LG1A 1I7AA 1DYNA 1PFJA 2CY4A 3KRXA 5JLJB 2QKLA 1PMSA 4MY6A 3M1IB 2YS3A 2AEHA 5DHFB 1Z87A 4MK0A 5LONB 3FEHA 2D11A 1RRPB 2COCA 2J0MA 1WG7A 1P3RA 2VSZA 2K00A 2DX1A 5C79A 4H8SA 5FI0A 1U2BA 1KI1B 1N3HA 2YS1A 2RGNB 4Z2MB 4F7HA 2OTXA 4EKUA 1XCGA 3U7DA 4KHBB 4HAZB 4K17A 1AWEA 2R0DA 1BAKA 2Z0OA 3DXEA 2I5FA 1P5TA 3HQCA 1DDVA 2LOZA 3QIJA 4TYZA 1ISNA 3SNHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JP4 A;  1NTV A;  3HW2 B;  1ZVR A;  4KVG B;  5CLL B;  1X86 A;  2N23 A;  3X23 A;  5C5B A;  1U29 A;  1J0W A;  1MKE A;  2P0F A;  3BJI A;  4WJ7 A;  4ZRJ A;  4F7G A;  5HE0 A;  1GG3 A;  3ULB A;  4GZU A;  4CYE A;  2JP2 A;  2P0H A;  3ULC A;  2YSZ A;  2M38 A;  2D9X A;  1QC6 A;  5C5B B;  3MDB C;  1V5P A;  5HE2 A;  2ROZ B;  2D4Q A;  2DX5 A;  5D3V A;  1GC6 A;  4HB3 B;  1PLS A;  2DKQ A;  4HHV A;  2J0J A;  5D27 A;  2L2I A;  5J3T A;  3SV1 A;  1WGQ A;  1WI1 A;  5HE1 A;  5JHG A;  2ZPY A;  4IAP A;  1GC7 A;  1U5E A;  2I1K A;  5J3Q A;  4A6H A;  2M14 A;  2EMS A;  1EF1 A;  1P6S A;  2P8V A;  4C0A A;  4YL8 A;  4HB4 B;  3DXD A;  5KQ4 A;  1MAI A;  2K2J A;  2LYD A;  1XR0 B;  3A8P A;  3QBV B;  5DH9 B;  1V5M A;  1ZC4 B;  2NZ8 B;  2D9V A;  2DA0 A;  4HB2 B;  2CY5 A;  2DFK A;  2D9Y A;  2H7E A;  5D3Y A;  1DDM A;  3AU5 A;  1U5F A;  3TVV A;  2GCJ A;  1V5U A;  2DN6 A;  1FAO A;  3SUZ A;  2KUP A;  2D2Q A;  3ODO A;  2Q13 A;  1FGY A;  2MKR A;  4NY0 A;  1Y5O A;  3DXC A;  2D9Z A;  3SO6 A;  1M7E A;  5KCV A;  3N7C A;  1FB8 A;  2COF A;  3F5R A;  1K5G B;  2W2X C;  2CRF A;  4EJN A;  2DKP A;  3CIK A;  1XX0 A;  2MFQ A;  1NU2 A;  4BBK A;  2X18 A;  1U27 A;  2Y8F A;  4CHM A;  2R09 A;  2LOX A;  5DIF B;  2PZ1 A;  1E5W A;  1W1H A;  4XWX A;  3ODW A;  1DDW A;  4A6F B;  4GPT B;  1FHX A;  1ZM0 A;  1AQC A;  1MK7 B;  4DX8 A;  2COD A;  3O96 A;  4DX9 0;  1SGH A;  3AU4 A;  2KGX B;  2W2W A;  1H4R A;  3KRW A;  4KHA A;  5C6R A;  5JHH A;  5D3X A;  2UVM A;  2VKI A;  5GOW B;  1TQZ A;  4PQ0 A;  3D8E A;  4IFS A;  4ZRI A;  3RCP A;  2N0Y A;  4A5K A;  4HDQ A;  1XKE A;  3UZT A;  3LJU X;  1X11 A;  4KAX B;  3ODX A;  4L6E A;  1EGX A;  2QKM A;  4F7U P;  2D9W A;  3SYX A;  2P0D A;  1FHO A;  2DLW A;  3TO1 A;  3PZD A;  2DYN A;  1TJ6 A;  2IYB A;  2CAY A;  2D10 A;  3PP2 A;  3WYF B;  1QQG A;  3A98 B;  3ML4 A;  1KZG A;  2ADZ A;  2YS5 A;  2UZS A;  4EMO A;  3QWM A;  2NMB A;  2YT1 A;  2HTH B;  2Y7B A;  1WGU A;  1J19 A;  4NSW A;  4CHJ A;  4PNK A;  1W1D A;  3ZVR A;  4WVF B;  2H7D A;  2IFS A;  3PVW A;  4WSF A;  1BTN A;  2COA A;  4HAY B;  3IVF A;  3NSU A;  1V88 A;  4Y94 A;  1NI2 A;  2MDX A;  5DI9 B;  2EJ8 A;  4D0N B;  1V61 A;  1OY2 A;  4HAX B;  1WJ1 A;  2EMT A;  2ELA A;  4GXB A;  2W2X D;  4ZRK A;  1KZ7 A;  1UPR A;  1I2H A;  4K81 A;  2K2U A;  1XD4 A;  2AL6 A;  2GS0 A;  3T06 A;  3TCA A;  2GJY A;  3HK0 A;  1X1F A;  1WVH A;  2J59 M;  3P7Z A;  3GYO A;  1SHC A;  3A8Q A;  2ELB A;  5J3Y A;  2VRW B;  2MWN B;  4A6K A;  3FM8 C;  4DBB A;  3BIN A;  4HAT B;  2G35 A;  4GN1 A;  1MIZ B;  1XOD A;  2OQB A;  2FJL A;  4HB0 B;  1MK9 B;  2RSG A;  5HE3 A;  3FSS A;  2Z0Q A;  1Y19 B;  4IOY X;  4Z2N A;  2J0K A;  1UNQ A;  2DTC A;  1EVH A;  3P6A A;  3G9W A;  4MT7 A;  3VOQ A;  1H10 A;  3GYP A;  4KHO A;  3KY9 A;  1LB1 A;  1K5D B;  1IRS A;  5C16 A;  1OQN A;  2KCJ A;  4HAW B;  1TXD A;  3TFM A;  1BTK A;  4A6F A;  1FGZ A;  5EFX A;  1ZC3 B;  1RJ2 A;  1X05 A;  1V89 A;  1UEF A;  2DHI A;  2UZR A;  4GMV A;  5KQ1 A;  2I1J A;  3OAN A;  1MPH A;  4K2P A;  1UNR A;  2LKO A;  1FOE A;  3PG7 A;  2DHK A;  3PVU A;  3TW1 A;  4B6H A;  2BCJ A;  4HDO A;  2XQN M;  2YF0 A;  3VIA A;  2V76 A;  4TKN A;  3D8D A;  3D8F A;  4K2O A;  1EAZ A;  4YON A;  2L1C A;  5L81 A;  2RVB B;  4GMX B;  3F0W A;  3MPX A;  1B55 A;  1M7R A;  2RNR B;  1NTY A;  1UNP A;  3AJ4 A;  2YRY A;  3PEG A;  2DYQ A;  1MIX A;  2I5C A;  1U5G A;  5D3W A;  5DHA B;  2YT0 A;  3CXB B;  4P7I A;  1FHW A;  4HAV B;  1OMW A;  4DXA B;  3KZ1 A;  2Z0P A;  1UPQ A;  1WJM A;  3U8Z A;  1LW3 A;  2EC1 A;  1ZSQ A;  4HAU B;  5LOP B;  2Y8G A;  2ROV A;  3WA0 A;  1X1G A;  3V5W A;  1DRO A;  2RLO A;  3PSC A;  2HE7 A;  5FI1 A;  1U5D A;  2DHJ A;  1W1G A;  5CLQ B;  1Q67 A;  2E2X A;  2LUL A;  3ZDT A;  1BWN A;  3KSY A;  2YVC A;  3PVL A;  1DBH A;  2GCL A;  2RUK B;  2LG1 A;  1I7A A;  1DYN A;  1PFJ A;  2CY4 A;  3KRX A;  5JLJ B;  2QKL A;  1PMS A;  4MY6 A;  3M1I B;  2YS3 A;  2AEH A;  5DHF B;  1Z87 A;  4MK0 A;  5LON B;  3FEH A;  2D11 A;  1RRP B;  2COC A;  2J0M A;  1WG7 A;  1P3R A;  2VSZ A;  2K00 A;  2DX1 A;  5C79 A;  4H8S A;  5FI0 A;  1U2B A;  1KI1 B;  1N3H A;  2YS1 A;  2RGN B;  4Z2M B;  4F7H A;  2OTX A;  4EKU A;  1XCG A;  3U7D A;  4KHB B;  4HAZ B;  4K17 A;  1AWE A;  2R0D A;  1BAK A;  2Z0O A;  3DXE A;  2I5F A;  1P5T A;  3HQC A;  1DDV A;  2LOZ A;  3QIJ A;  4TYZ A;  1ISN A;  3SNH A; 
#chains in the Genus database with same CATH topology
 5JP4 A;  1NTV A;  3HW2 B;  1ZVR A;  4KVG B;  5CLL B;  1X86 A;  2N23 A;  3X23 A;  5C5B A;  1U29 A;  1J0W A;  1MKE A;  2P0F A;  3BJI A;  3NWD A;  1MI1 A;  4WJ7 A;  4ZRJ A;  4F7G A;  5HE0 A;  1GG3 A;  3ULB A;  4GZU A;  2KUQ A;  4CYE A;  2JP2 A;  2P0H A;  3ULC A;  2YSZ A;  2M38 A;  2D9X A;  1QC6 A;  5C5B B;  3MDB C;  1V5P A;  5HE2 A;  2ROZ B;  2D4Q A;  2DX5 A;  5D3V A;  1GC6 A;  4HB3 B;  1PLS A;  2DKQ A;  4HHV A;  2J0J A;  5D27 A;  2L2I A;  5J3T A;  3SV1 A;  1WGQ A;  1WI1 A;  5HE1 A;  5JHG A;  2ZPY A;  4IAP A;  1GC7 A;  1U5E A;  2I1K A;  5J3Q A;  4A6H A;  2M14 A;  2EMS A;  1EF1 A;  1P6S A;  2P8V A;  4C0A A;  4YL8 A;  4HB4 B;  4QJ5 B;  3DXD A;  5KQ4 A;  1MAI A;  2K2J A;  2LYD A;  1XR0 B;  3A8P A;  3QBV B;  5DH9 B;  1V5M A;  1ZC4 B;  2NZ8 B;  2D9V A;  2DA0 A;  4HB2 B;  2CY5 A;  2DFK A;  2D9Y A;  2H7E A;  5D3Y A;  1DDM A;  3AU5 A;  1U5F A;  3TVV A;  2GCJ A;  1V5U A;  4QXA B;  2DN6 A;  1FAO A;  3SUZ A;  2KUP A;  2D2Q A;  3ODO A;  2Q13 A;  1FGY A;  2MKR A;  4NY0 A;  1Y5O A;  3DXC A;  2D9Z A;  3SO6 A;  1M7E A;  5KCV A;  3N7C A;  1FB8 A;  5M4Y B;  2COF A;  3F5R A;  1K5G B;  2W2X C;  2CRF A;  4EJN A;  2DKP A;  2K49 A;  3CIK A;  1XX0 A;  2MFQ A;  1NU2 A;  4BBK A;  2X18 A;  1U27 A;  2Y8F A;  4CHM A;  2R09 A;  2LOX A;  5DIF B;  2PZ1 A;  1E5W A;  1W1H A;  4XWX A;  3ODW A;  1DDW A;  4A6F B;  4GPT B;  1FHX A;  1ZM0 A;  1AQC A;  4HSI A;  1MK7 B;  4DX8 A;  2COD A;  3O96 A;  4DX9 0;  4QJ3 B;  1SGH A;  3AU4 A;  2KGX B;  2W2W A;  1H4R A;  3KRW A;  4KHA A;  5C6R A;  5JHH A;  5D3X A;  2UVM A;  2VKI A;  5GOW B;  1TQZ A;  4PQ0 A;  3D8E A;  4IFS A;  4ZRI A;  3RCP A;  2N0Y A;  4A5K A;  4HDQ A;  4OT1 A;  1XKE A;  5I2S A;  3UZT A;  3LJU X;  5LG4 B;  3NW8 A;  2KIG A;  1X11 A;  3ODX A;  4KAX B;  4L6E A;  1EGX A;  2QKM A;  4F7U P;  2D9W A;  3SYX A;  2P0D A;  1FHO A;  2DLW A;  3TO1 A;  3PZD A;  2DYN A;  1TJ6 A;  2IYB A;  2CAY A;  2D10 A;  3PP2 A;  3WYF B;  4QJ4 B;  1QQG A;  3A98 B;  3ML4 A;  1KZG A;  2ADZ A;  4L1R A;  2YS5 A;  2UZS A;  4EMO A;  3QWM A;  2NMB A;  2YT1 A;  2HTH B;  2Y7B A;  1WGU A;  1J19 A;  4NSW A;  5I2M A;  4CHJ A;  4PNK A;  2Z13 A;  1W1D A;  3ZVR A;  3NWF A;  4WVF B;  2KR0 A;  2H7D A;  2IFS A;  3PVW A;  4WSF A;  1BTN A;  2COA A;  3HIE A;  4HAY B;  3IVF A;  3NSU A;  1V88 A;  4Y94 A;  1NI2 A;  3B77 A;  2MDX A;  5DI9 B;  2EJ8 A;  4D0N B;  1V61 A;  1OY2 A;  4HAX B;  1WJ1 A;  2EMT A;  2ELA A;  4GXB A;  2W2X D;  4ZRK A;  3A58 A;  1KZ7 A;  1UPR A;  1I2H A;  3HSA A;  4K81 A;  2K2U A;  1XD4 A;  2AL6 A;  2GS0 A;  3T06 A;  3TCA A;  2GJY A;  3HK0 A;  2Z59 A;  1X1F A;  1WVH A;  2J59 M;  3P7Z A;  3GYO A;  2Z4D A;  1SHC A;  5IRS A;  3A8Q A;  2ELB A;  5J3Y A;  2VRW B;  2MWN B;  3DCX A;  2RRF A;  2FJU B;  4A6K A;  3FM8 C;  4DBB A;  3FVC A;  3BIN A;  2G35 A;  4HAT B;  4GN1 A;  1MIZ B;  1XOD A;  2OQB A;  2K8E A;  2FJL A;  2R2Y A;  4HB0 B;  1MK9 B;  2RSG A;  5HE3 A;  3FSS A;  2Z0Q A;  4D6W A;  1Y19 B;  4IOY X;  4Z2N A;  4KHB A;  2J0K A;  1UNQ A;  2DTC A;  1EVH A;  3P6A A;  3G9W A;  2ZKM X;  4DIX A;  4MT7 A;  3VOQ A;  1H10 A;  3GYP A;  4KHO A;  3KY9 A;  1LB1 A;  1K5D B;  1IRS A;  4CSQ A;  5C16 A;  1OQN A;  2KCJ A;  4HAW B;  1TXD A;  3TFM A;  1BTK A;  4A6F A;  1FGZ A;  5EFX A;  1ZC3 B;  2YT2 A;  1RJ2 A;  1X05 A;  1V89 A;  1UEF A;  2DHI A;  2UZR A;  4GMV A;  5KQ1 A;  1ZYI A;  2I1J A;  3OAN A;  1MPH A;  4K2P A;  3U12 A;  1UNR A;  2LKO A;  1FOE A;  3PG7 A;  2DHK A;  3PVU A;  3TW1 A;  4B6H A;  2BCJ A;  3OHM B;  4HDO A;  2XQN M;  2YF0 A;  3VIA A;  2V76 A;  4TKN A;  3D8D A;  3D8F A;  4K2O A;  1EAZ A;  4YON A;  2L1C A;  5L81 A;  2RVB B;  2GUM A;  4GOU A;  4GMX B;  3F0W A;  3MPX A;  1B55 A;  1M7R A;  2RNR B;  1NTY A;  1UNP A;  3AJ4 A;  2YRY A;  3PEG A;  2DYQ A;  1MIX A;  2I5C A;  1U5G A;  5D3W A;  5DHA B;  2YT0 A;  3CXB B;  3NWA A;  4P7I A;  1FHW A;  4HAV B;  1OMW A;  4DXA B;  3KZ1 A;  2Z0P A;  1UPQ A;  1WJM A;  3U8Z A;  1LW3 A;  2EC1 A;  1ZSQ A;  4HAU B;  5LOP B;  2Y8G A;  2ROV A;  3WA0 A;  1X1G A;  3V5W A;  1DRO A;  2RLO A;  3PSC A;  2HE7 A;  5FI1 A;  1U5D A;  2DHJ A;  4OSN A;  1W1G A;  5CLQ B;  1Q67 A;  2E2X A;  2KIE A;  2LUL A;  3ZDT A;  1BWN A;  3KSY A;  2YVC A;  3PVL A;  1DBH A;  2GCL A;  2RUK B;  2LG1 A;  1I7A A;  1DYN A;  1PFJ A;  2CY4 A;  3KRX A;  5JLJ B;  2QKL A;  1T77 A;  1PMS A;  4MY6 A;  3M1I B;  2YS3 A;  2AEH A;  5DHF B;  1Z87 A;  4MK0 A;  5LON B;  3FEH A;  2D11 A;  1RRP B;  2COC A;  2J0M A;  1WG7 A;  1P3R A;  2VSZ A;  2K00 A;  2DX1 A;  5C79 A;  4H8S A;  5FI0 A;  1U2B A;  1KI1 B;  1N3H A;  2YS1 A;  2RGN B;  4Z2M B;  4F7H A;  2OTX A;  4EKU A;  1XCG A;  3U7D A;  4GNK B;  4KHB B;  4HAZ B;  4K17 A;  1AWE A;  2R0D A;  1BAK A;  2Z0O A;  3DXE A;  2Z14 A;  2I5F A;  1P5T A;  3HQC A;  1DDV A;  2LOZ A;  3QIJ A;  4TYZ A;  1ISN A;  2NBV A;  3SNH A; 
#chains in the Genus database with same CATH homology
 5JP4 A;  1NTV A;  3HW2 B;  1ZVR A;  4KVG B;  5CLL B;  1X86 A;  2N23 A;  3X23 A;  5C5B A;  1U29 A;  1J0W A;  1MKE A;  2P0F A;  3BJI A;  4WJ7 A;  4ZRJ A;  4F7G A;  5HE0 A;  1GG3 A;  3ULB A;  4GZU A;  4CYE A;  2JP2 A;  2P0H A;  3ULC A;  2YSZ A;  2M38 A;  2D9X A;  1QC6 A;  5C5B B;  3MDB C;  1V5P A;  5HE2 A;  2ROZ B;  2D4Q A;  2DX5 A;  5D3V A;  1GC6 A;  4HB3 B;  1PLS A;  2DKQ A;  4HHV A;  2J0J A;  5D27 A;  2L2I A;  5J3T A;  3SV1 A;  1WGQ A;  1WI1 A;  5HE1 A;  5JHG A;  2ZPY A;  4IAP A;  1GC7 A;  1U5E A;  2I1K A;  5J3Q A;  4A6H A;  2M14 A;  2EMS A;  1EF1 A;  1P6S A;  2P8V A;  4C0A A;  4YL8 A;  4HB4 B;  3DXD A;  5KQ4 A;  1MAI A;  2K2J A;  2LYD A;  1XR0 B;  3A8P A;  3QBV B;  5DH9 B;  1V5M A;  1ZC4 B;  2NZ8 B;  2D9V A;  2DA0 A;  4HB2 B;  2CY5 A;  2DFK A;  2D9Y A;  2H7E A;  5D3Y A;  1DDM A;  3AU5 A;  1U5F A;  3TVV A;  2GCJ A;  1V5U A;  2DN6 A;  1FAO A;  3SUZ A;  2KUP A;  2D2Q A;  3ODO A;  2Q13 A;  1FGY A;  2MKR A;  4NY0 A;  1Y5O A;  3DXC A;  2D9Z A;  3SO6 A;  1M7E A;  5KCV A;  3N7C A;  1FB8 A;  2COF A;  3F5R A;  1K5G B;  2W2X C;  2CRF A;  4EJN A;  2DKP A;  3CIK A;  1XX0 A;  2MFQ A;  1NU2 A;  4BBK A;  2X18 A;  1U27 A;  2Y8F A;  4CHM A;  2R09 A;  2LOX A;  5DIF B;  2PZ1 A;  1E5W A;  1W1H A;  4XWX A;  3ODW A;  1DDW A;  4A6F B;  4GPT B;  1FHX A;  1ZM0 A;  1AQC A;  1MK7 B;  4DX8 A;  2COD A;  3O96 A;  4DX9 0;  1SGH A;  3AU4 A;  2KGX B;  2W2W A;  1H4R A;  3KRW A;  4KHA A;  5C6R A;  5JHH A;  5D3X A;  2UVM A;  2VKI A;  5GOW B;  1TQZ A;  4PQ0 A;  3D8E A;  4IFS A;  4ZRI A;  3RCP A;  2N0Y A;  4A5K A;  4HDQ A;  1XKE A;  3UZT A;  3LJU X;  1X11 A;  4KAX B;  3ODX A;  4L6E A;  1EGX A;  2QKM A;  4F7U P;  2D9W A;  3SYX A;  2P0D A;  1FHO A;  2DLW A;  3TO1 A;  3PZD A;  2DYN A;  1TJ6 A;  2IYB A;  2CAY A;  2D10 A;  3PP2 A;  3WYF B;  1QQG A;  3A98 B;  3ML4 A;  1KZG A;  2ADZ A;  2YS5 A;  2UZS A;  4EMO A;  3QWM A;  2NMB A;  2YT1 A;  2HTH B;  2Y7B A;  1WGU A;  1J19 A;  4NSW A;  4CHJ A;  4PNK A;  1W1D A;  3ZVR A;  4WVF B;  2H7D A;  2IFS A;  3PVW A;  4WSF A;  1BTN A;  2COA A;  4HAY B;  3IVF A;  3NSU A;  1V88 A;  4Y94 A;  1NI2 A;  2MDX A;  5DI9 B;  2EJ8 A;  4D0N B;  1V61 A;  1OY2 A;  4HAX B;  1WJ1 A;  2EMT A;  2ELA A;  4GXB A;  2W2X D;  4ZRK A;  1KZ7 A;  1UPR A;  1I2H A;  4K81 A;  2K2U A;  1XD4 A;  2AL6 A;  2GS0 A;  3T06 A;  3TCA A;  2GJY A;  3HK0 A;  1X1F A;  1WVH A;  2J59 M;  3P7Z A;  3GYO A;  1SHC A;  3A8Q A;  2ELB A;  5J3Y A;  2VRW B;  2MWN B;  4A6K A;  3FM8 C;  4DBB A;  3BIN A;  4HAT B;  2G35 A;  4GN1 A;  1MIZ B;  1XOD A;  2OQB A;  2FJL A;  4HB0 B;  1MK9 B;  2RSG A;  5HE3 A;  3FSS A;  2Z0Q A;  1Y19 B;  4IOY X;  4Z2N A;  2J0K A;  1UNQ A;  2DTC A;  1EVH A;  3P6A A;  3G9W A;  4MT7 A;  3VOQ A;  1H10 A;  3GYP A;  4KHO A;  3KY9 A;  1LB1 A;  1K5D B;  1IRS A;  5C16 A;  1OQN A;  2KCJ A;  4HAW B;  1TXD A;  3TFM A;  1BTK A;  4A6F A;  1FGZ A;  5EFX A;  1ZC3 B;  1RJ2 A;  1X05 A;  1V89 A;  1UEF A;  2DHI A;  2UZR A;  4GMV A;  5KQ1 A;  2I1J A;  3OAN A;  1MPH A;  4K2P A;  1UNR A;  2LKO A;  1FOE A;  3PG7 A;  2DHK A;  3PVU A;  3TW1 A;  4B6H A;  2BCJ A;  4HDO A;  2XQN M;  2YF0 A;  3VIA A;  2V76 A;  4TKN A;  3D8D A;  3D8F A;  4K2O A;  1EAZ A;  4YON A;  2L1C A;  5L81 A;  2RVB B;  4GMX B;  3F0W A;  3MPX A;  1B55 A;  1M7R A;  2RNR B;  1NTY A;  1UNP A;  3AJ4 A;  2YRY A;  3PEG A;  2DYQ A;  1MIX A;  2I5C A;  1U5G A;  5D3W A;  5DHA B;  2YT0 A;  3CXB B;  4P7I A;  1FHW A;  4HAV B;  1OMW A;  4DXA B;  3KZ1 A;  2Z0P A;  1UPQ A;  1WJM A;  3U8Z A;  1LW3 A;  2EC1 A;  1ZSQ A;  4HAU B;  5LOP B;  2Y8G A;  2ROV A;  3WA0 A;  1X1G A;  3V5W A;  1DRO A;  2RLO A;  3PSC A;  2HE7 A;  5FI1 A;  1U5D A;  2DHJ A;  1W1G A;  5CLQ B;  1Q67 A;  2E2X A;  2LUL A;  3ZDT A;  1BWN A;  3KSY A;  2YVC A;  3PVL A;  1DBH A;  2GCL A;  2RUK B;  2LG1 A;  1I7A A;  1DYN A;  1PFJ A;  2CY4 A;  3KRX A;  5JLJ B;  2QKL A;  1PMS A;  4MY6 A;  3M1I B;  2YS3 A;  2AEH A;  5DHF B;  1Z87 A;  4MK0 A;  5LON B;  3FEH A;  2D11 A;  1RRP B;  2COC A;  2J0M A;  1WG7 A;  1P3R A;  2VSZ A;  2K00 A;  2DX1 A;  5C79 A;  4H8S A;  5FI0 A;  1U2B A;  1KI1 B;  1N3H A;  2YS1 A;  2RGN B;  4Z2M B;  4F7H A;  2OTX A;  4EKU A;  1XCG A;  3U7D A;  4KHB B;  4HAZ B;  4K17 A;  1AWE A;  2R0D A;  1BAK A;  2Z0O A;  3DXE A;  2I5F A;  1P5T A;  3HQC A;  1DDV A;  2LOZ A;  3QIJ A;  4TYZ A;  1ISN A;  3SNH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...