1OQNA

Crystal structure of the phosphotyrosine binding domain (ptb) of mouse disabled 1 (dab1)
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
150
structure length
150
Chain Sequence
RSEATLIKRFKGEGVRYKAKLIGIDEVSAARGDKLCQDSMMKLKGVVAGARSKGEHKQKIFLTISFGGIKIFDEKTGALQHHHAVHEISYIAKDITDHRAFGYVCGKEGNHRFVAIKTAQAAEPVILDLRDLFQLIYELKQREELEKKAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Signaling protein
molecule keywords Disabled homolog 1
publication title Crystal structures of the Dab homology domains of mouse disabled 1 and 2
pubmed doi rcsb
source organism Mus musculus
total genus 47
structure length 150
sequence length 150
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00640 PID Phosphotyrosine interaction domain (PTB/PID)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1oqnA00
1GC7A 5LOPB 1V89A 1OQNA 3D8EA 2NZ8B 2M14A 1EAZA 1MKEA 2RNRB 3KRWA 1OY2A 2COCA 1GG3A 1FHXA 3UZTA 2MWNB 3PEGA 4HAUB 3PG7A 2DKPA 2KUPA 4HB3B 5FI0A 3X23A 1U29A 5LONB 4DBBA 3T06A 4MY6A 1UNRA 1UNQA 1QC6A 2ELAA 4Y94A 4GZUA 5D3WA 1WI1A 4XWXA 1X11A 5L81A 4HAZB 2VSZA 4A6KA 1UPQA 3HK0A 1MPHA 3PZDA 4HDQA 1QQGA 2MFQA 2P0HA 2EC1A 1LW3A 3O96A 4TYZA 3SO6A 2W2XD 2CY4A 4A5KA 2DFKA 4DXAB 3CIKA 1X1FA 3TFMA 4GMXB 2LOXA 2W2WA 4MT7A 4A6FB 3N7CA 1XD4A 3F0WA 1XKEA 5C5BA 5DIFB 4CHMA 1AWEA 4A6HA 2IYBA 3KY9A 2CODA 2LULA 1W1HA 1P3RA 1TXDA 2DHKA 4GPTB 1ZC4B 5GOWB 1BTKA 3ULCA 1RJ2A 1DROA 1M7EA 2D10A 2OTXA 2YF0A 4IOYX 1GC6A 1ZVRA 5HE0A 5J3TA 1UPRA 3OANA 2QKMA 1PLSA 3PSCA 2YS5A 2RUKB 1PMSA 3D8DA 1K5GB 3KZ1A 4K17A 3PVWA 2P0DA 1Z87A 2CAYA 3A8QA 4HAVB 4EJNA 5HE1A 2ELBA 3RCPA 2QKLA 3HW2B 1FHOA 1FHWA 4L6EA 1V5UA 5FI1A 4IFSA 3SNHA 2H7EA 5JP4A 2YRYA 5DHFB 2L2IA 5JLJB 5C79A 3AJ4A 4DX90 1ZSQA 1W1GA 1UNPA 2I1JA 3ZDTA 1PFJA 4GMVA 1FB8A 4GXBA 4K2OA 2DX5A 1NTVA 2HE7A 3U8ZA 1U5FA 1LB1A 5JHHA 1ZM0A 5HE2A 1H4RA 4EMOA 1DBHA 1NU2A 4A6FA 1KZ7A 1U2BA 2Y8FA 4WVFB 1N3HA 3BINA 4PNKA 1KI1B 1DYNA 2X18A 3PVUA 2GCLA 1TQZA 2Z0OA 4HB0B 2JP2A 3P6AA 2DYNA 3A8PA 5D3VA 4CHJA 3A98B 2I1KA 2Z0QA 2Y7BA 1EF1A 2UVMA 3DXEA 3KSYA 3QIJA 3DXDA 5KQ4A 2KGXB 4ZRJA 1FOEA 5D27A 1FGZA 1XCGA 5D3YA 2D2QA 2R09A 1WG7A 3LJUX 3ULBA 1MK7B 2COAA 4Z2MB 2K00A 3DXCA 3VOQA 2Z0PA 2Y8GA 4GN1A 1NI2A 1AQCA 5CLLB 2HTHB 1ISNA 2PZ1A 1NTYA 4YONA 2YT0A 4WJ7A 3VIAA 2KCJA 3QWMA 4P7IA 2P0FA 1BWNA 2V76A 3M1IB 2D4QA 4NY0A 1WVHA 4EKUA 4TKNA 1X1GA 3TW1A 1XODA 4B6HA 5J3QA 2YT1A 2MDXA 3SV1A 2COFA 3ODOA 3AU4A 1Y5OA 2EMSA 2GJYA 2J0MA 2LOZA 3ZVRA 1U5DA 2R0DA 2EJ8A 1FAOA 4HB4B 3ML4A 4ZRIA 2D9YA 5HE3A 2ROZB 2YS1A 2DX1A 4CYEA 1WJ1A 2CY5A 1K5DB 1RRPB 4KHBB 1M7RA 2DKQA 3TCAA 2MKRA 2YVCA 1E5WA 4H8SA 1Y19B 5KCVA 2GCJA 3F5RA 4Z2NA 3GYOA 2LYDA 3ODWA 1P6SA 1SHCA 1V88A 5DHAB 2Q13A 3NSUA 1SGHA 5KQ1A 1U27A 2D9ZA 1Q67A 2DHIA 2DYQA 3FSSA 1U5GA 3IVFA 4HAXB 2N0YA 1DDMA 2DA0A 1H10A 4ZRKA 3CXBB 5CLQB 2VKIA 2M38A 1WGUA 3WA0A 4HAWB 3PP2A 2AL6A 1BTNA 2RVBB 1XR0B 1B55A 1X86A 3FEHA 4KHOA 2LKOA 2D9VA 3WYFB 2DTCA 1BAKA 5DH9B 1W1DA 4DX8A 1U5EA 2E2XA 2W2XC 2I5CA 1MIXA 3HQCA 3P7ZA 1V5PA 1WJMA 4NSWA 1X05A 2OQBA 2I5FA 5C16A 2YSZA 4WSFA 2UZRA 2UZSA 3TVVA 2K2JA 4D0NB 4K81A 3TO1A 4KHAA 2K2UA 2D9XA 2FJLA 4F7HA 3ODXA 2P8VA 4HDOA 1MIZB 2G35A 2L1CA 3GYPA 3U7DA 5J3YA 2DN6A 3QBVB 3G9WA 2XQNM 1J19A 1I2HA 2AEHA 2LG1A 4MK0A 1WGQA 1KZGA 1DDVA 2DHJA 2ADZA 3MDBC 2RLOA 2IFSA 3AU5A 1I7AA 4IAPA 2DLWA 2J0KA 1J0WA 1FGYA 2RSGA 2RGNB 2ZPYA 4K2PA 3SUZA 1DDWA 3PVLA 2D11A 2N23A 1ZC3B 1TJ6A 2D9WA 4F7GA 3MPXA 1MAIA 2J59M 3KRXA 3D8FA 2BCJA 4BBKA 3V5WA 1EGXA 4F7UP 4C0AA 2VRWB 5JHGA 1OMWA 5EFXA 2GS0A 4YL8A 5C5BB 2H7DA 1XX0A 1UEFA 1EVHA 4HB2B 3SYXA 2EMTA 2J0JA 1V5MA 5D3XA 4HAYB 4KVGB 2ROVA 2YS3A 4HHVA 2NMBA 1V61A 1IRSA 4HATB 4PQ0A 4KAXB 1P5TA 5C6RA 5DI9B 3BJIA 2CRFA 1MK9B 3FM8C
chains in the Genus database with same CATH superfamily
1GC7A 5LOPB 1V89A 1OQNA 3D8EA 2NZ8B 2M14A 1EAZA 1MKEA 2RNRB 5I2SA 3KRWA 1OY2A 2COCA 1GG3A 1FHXA 3UZTA 2MWNB 3PEGA 4HAUB 3PG7A 2DKPA 2KUPA 4HB3B 5FI0A 3X23A 1U29A 3NWFA 5LONB 4DBBA 3T06A 5IRSA 4MY6A 1UNRA 5LG4B 1UNQA 2Z14A 1QC6A 2ELAA 4Y94A 4GZUA 5D3WA 1WI1A 4XWXA 1X11A 5L81A 4HAZB 2VSZA 4A6KA 1UPQA 3HK0A 1MPHA 3PZDA 2NBVA 4HDQA 1QQGA 2MFQA 2P0HA 2EC1A 1LW3A 3O96A 4TYZA 3SO6A 2W2XD 2CY4A 4A5KA 2DFKA 4DXAB 3CIKA 1X1FA 3TFMA 2GUMA 4GMXB 2LOXA 2W2WA 4MT7A 4A6FB 3N7CA 1XD4A 2KIEA 3F0WA 1XKEA 5C5BA 5DIFB 4CHMA 1AWEA 4A6HA 2IYBA 3KY9A 2CODA 2LULA 1W1HA 1P3RA 1TXDA 2DHKA 4GPTB 3NWDA 1ZC4B 5GOWB 1BTKA 3ULCA 4QJ5B 1RJ2A 1DROA 1M7EA 2D10A 2OTXA 2YF0A 4IOYX 1GC6A 1ZVRA 5HE0A 5J3TA 1UPRA 3OANA 2QKMA 1PLSA 4OSNA 3PSCA 2YS5A 2RUKB 1PMSA 3D8DA 1K5GB 3KZ1A 4K17A 3PVWA 2P0DA 1Z87A 2CAYA 3A8QA 4HAVB 4EJNA 5HE1A 2ELBA 3RCPA 1ZYIA 2QKLA 3HW2B 1FHOA 1FHWA 4L6EA 1V5UA 5FI1A 4IFSA 3SNHA 2H7EA 5JP4A 2YRYA 5DHFB 2L2IA 4CSQA 5JLJB 5C79A 3AJ4A 4DX90 1ZSQA 1W1GA 1UNPA 2I1JA 3B77A 3ZDTA 1PFJA 4GMVA 1FB8A 4GXBA 4K2OA 2DX5A 4D6WA 1NTVA 2HE7A 3U8ZA 1U5FA 1LB1A 5JHHA 1ZM0A 5HE2A 1H4RA 4EMOA 1DBHA 1NU2A 2Z59A 4A6FA 1KZ7A 1U2BA 4GOUA 2Y8FA 4WVFB 3U12A 1N3HA 3BINA 4PNKA 1KI1B 1DYNA 2X18A 2KIGA 3PVUA 2GCLA 1TQZA 2Z0OA 4HB0B 2JP2A 3P6AA 2DYNA 3A8PA 5D3VA 4CHJA 3A98B 2I1KA 2Z0QA 2Y7BA 1EF1A 2UVMA 3DXEA 3KSYA 2K49A 3QIJA 3DXDA 3HSAA 5KQ4A 2KGXB 4ZRJA 1FOEA 5D27A 1FGZA 1XCGA 5D3YA 2ZKMX 2D2QA 2R09A 1WG7A 3LJUX 3ULBA 1MK7B 2COAA 4Z2MB 2K00A 3DCXA 1MI1A 3DXCA 3VOQA 2Z0PA 2Y8GA 4GN1A 1NI2A 1AQCA 5CLLB 2HTHB 1ISNA 2PZ1A 1NTYA 4YONA 2YT0A 4WJ7A 4QJ4B 3VIAA 2KCJA 3QWMA 4P7IA 2P0FA 1BWNA 2V76A 3M1IB 2D4QA 4NY0A 1WVHA 4EKUA 4TKNA 1X1GA 3TW1A 1XODA 4B6HA 5J3QA 2YT1A 2MDXA 3SV1A 2COFA 3ODOA 3AU4A 1Y5OA 3NWAA 2EMSA 2GJYA 2J0MA 2LOZA 3ZVRA 1U5DA 2R0DA 2EJ8A 4DIXA 1FAOA 4HB4B 3ML4A 4ZRIA 2Z13A 2D9YA 4OT1A 2ROZB 2YS1A 2DX1A 5HE3A 4CYEA 3A58A 1WJ1A 2CY5A 1K5DB 1RRPB 4KHBB 1M7RA 2DKQA 3TCAA 2MKRA 2YVCA 1E5WA 4H8SA 1Y19B 5KCVA 2GCJA 3F5RA 2KUQA 4Z2NA 3GYOA 2LYDA 3ODWA 1P6SA 1SHCA 4L1RA 5I2MA 1V88A 5DHAB 2Q13A 3NSUA 1SGHA 5KQ1A 1U27A 2D9ZA 1Q67A 2DHIA 2DYQA 3FSSA 3FVCA 1U5GA 3IVFA 4HAXB 2N0YA 1DDMA 2DA0A 1H10A 4ZRKA 3CXBB 5CLQB 2VKIA 2M38A 2Z4DA 1WGUA 3WA0A 4HAWB 3PP2A 2AL6A 1BTNA 2RVBB 1XR0B 1B55A 1X86A 3FEHA 4KHOA 2LKOA 2D9VA 3WYFB 1T77A 2DTCA 4GNKB 1BAKA 5DH9B 1W1DA 4DX8A 1U5EA 2E2XA 2W2XC 2I5CA 1MIXA 3HQCA 3P7ZA 1V5PA 1WJMA 4NSWA 1X05A 2OQBA 3NW8A 2I5FA 5C16A 2YSZA 4WSFA 2UZRA 3HIEA 2UZSA 3TVVA 2K2JA 4D0NB 2KR0A 4K81A 3TO1A 2YT2A 4KHAA 2K2UA 2D9XA 2FJLA 4F7HA 3ODXA 2P8VA 4QJ3B 4HDOA 1MIZB 2G35A 2L1CA 4KHBA 3GYPA 3U7DA 4HSIA 5J3YA 2DN6A 3QBVB 3G9WA 2XQNM 1J19A 1I2HA 3OHMB 2AEHA 2LG1A 4MK0A 1WGQA 1KZGA 1DDVA 2DHJA 2ADZA 3MDBC 2RLOA 2IFSA 3AU5A 1I7AA 5M4YB 4IAPA 2DLWA 2J0KA 1J0WA 1FGYA 2RSGA 2RGNB 2ZPYA 4K2PA 3SUZA 1DDWA 3PVLA 2D11A 2N23A 1ZC3B 1TJ6A 2D9WA 4F7GA 3MPXA 2RRFA 1MAIA 2J59M 3KRXA 3D8FA 2BCJA 4BBKA 3V5WA 1EGXA 4F7UP 4C0AA 2VRWB 5JHGA 1OMWA 2K8EA 5EFXA 2GS0A 4YL8A 5C5BB 2H7DA 1XX0A 1UEFA 1EVHA 4HB2B 3SYXA 2EMTA 2J0JA 4QXAB 1V5MA 5D3XA 4HAYB 4KVGB 2ROVA 2YS3A 2R2YA 4HHVA 2NMBA 1V61A 1IRSA 4HATB 4PQ0A 4KAXB 1P5TA 5C6RA 5DI9B 3BJIA 2FJUB 2CRFA 1MK9B 3FM8C
chains in the Genus database with same CATH topology
1GC7A 5LOPB 1V89A 1OQNA 3D8EA 2NZ8B 2M14A 1EAZA 1MKEA 2RNRB 3KRWA 1OY2A 2COCA 1GG3A 1FHXA 3UZTA 2MWNB 3PEGA 4HAUB 3PG7A 2DKPA 2KUPA 4HB3B 5FI0A 3X23A 1U29A 5LONB 4DBBA 3T06A 4MY6A 1UNRA 1UNQA 1QC6A 2ELAA 4Y94A 4GZUA 5D3WA 1WI1A 4XWXA 1X11A 5L81A 4HAZB 2VSZA 4A6KA 1UPQA 3HK0A 1MPHA 3PZDA 4HDQA 1QQGA 2MFQA 2P0HA 2EC1A 1LW3A 3O96A 4TYZA 3SO6A 2W2XD 2CY4A 4A5KA 2DFKA 4DXAB 3CIKA 1X1FA 3TFMA 4GMXB 2LOXA 2W2WA 4MT7A 4A6FB 3N7CA 1XD4A 3F0WA 1XKEA 5C5BA 5DIFB 4CHMA 1AWEA 4A6HA 2IYBA 3KY9A 2CODA 2LULA 1W1HA 1P3RA 1TXDA 2DHKA 4GPTB 1ZC4B 5GOWB 1BTKA 3ULCA 1RJ2A 1DROA 1M7EA 2D10A 2OTXA 2YF0A 4IOYX 1GC6A 1ZVRA 5HE0A 5J3TA 1UPRA 3OANA 2QKMA 1PLSA 3PSCA 2YS5A 2RUKB 1PMSA 3D8DA 1K5GB 3KZ1A 4K17A 3PVWA 2P0DA 1Z87A 2CAYA 3A8QA 4HAVB 4EJNA 5HE1A 2ELBA 3RCPA 2QKLA 3HW2B 1FHOA 1FHWA 4L6EA 1V5UA 5FI1A 4IFSA 3SNHA 2H7EA 5JP4A 2YRYA 5DHFB 2L2IA 5JLJB 5C79A 3AJ4A 4DX90 1ZSQA 1W1GA 1UNPA 2I1JA 3ZDTA 1PFJA 4GMVA 1FB8A 4GXBA 4K2OA 2DX5A 1NTVA 2HE7A 3U8ZA 1U5FA 1LB1A 5JHHA 1ZM0A 5HE2A 1H4RA 4EMOA 1DBHA 1NU2A 4A6FA 1KZ7A 1U2BA 2Y8FA 4WVFB 1N3HA 3BINA 4PNKA 1KI1B 1DYNA 2X18A 3PVUA 2GCLA 1TQZA 2Z0OA 4HB0B 2JP2A 3P6AA 2DYNA 3A8PA 5D3VA 4CHJA 3A98B 2I1KA 2Z0QA 2Y7BA 1EF1A 2UVMA 3DXEA 3KSYA 3QIJA 3DXDA 5KQ4A 2KGXB 4ZRJA 1FOEA 5D27A 1FGZA 1XCGA 5D3YA 2D2QA 2R09A 1WG7A 3LJUX 3ULBA 1MK7B 2COAA 4Z2MB 2K00A 3DXCA 3VOQA 2Z0PA 2Y8GA 4GN1A 1NI2A 1AQCA 5CLLB 2HTHB 1ISNA 2PZ1A 1NTYA 4YONA 2YT0A 4WJ7A 3VIAA 2KCJA 3QWMA 4P7IA 2P0FA 1BWNA 2V76A 3M1IB 2D4QA 4NY0A 1WVHA 4EKUA 4TKNA 1X1GA 3TW1A 1XODA 4B6HA 5J3QA 2YT1A 2MDXA 3SV1A 2COFA 3ODOA 3AU4A 1Y5OA 2EMSA 2GJYA 2J0MA 2LOZA 3ZVRA 1U5DA 2R0DA 2EJ8A 1FAOA 4HB4B 3ML4A 4ZRIA 2D9YA 5HE3A 2ROZB 2YS1A 2DX1A 4CYEA 1WJ1A 2CY5A 1K5DB 1RRPB 4KHBB 1M7RA 2DKQA 3TCAA 2MKRA 2YVCA 1E5WA 4H8SA 1Y19B 5KCVA 2GCJA 3F5RA 4Z2NA 3GYOA 2LYDA 3ODWA 1P6SA 1SHCA 1V88A 5DHAB 2Q13A 3NSUA 1SGHA 5KQ1A 1U27A 2D9ZA 1Q67A 2DHIA 2DYQA 3FSSA 1U5GA 3IVFA 4HAXB 2N0YA 1DDMA 2DA0A 1H10A 4ZRKA 3CXBB 5CLQB 2VKIA 2M38A 1WGUA 3WA0A 4HAWB 3PP2A 2AL6A 1BTNA 2RVBB 1XR0B 1B55A 1X86A 3FEHA 4KHOA 2LKOA 2D9VA 3WYFB 2DTCA 1BAKA 5DH9B 1W1DA 4DX8A 1U5EA 2E2XA 2W2XC 2I5CA 1MIXA 3HQCA 3P7ZA 1V5PA 1WJMA 4NSWA 1X05A 2OQBA 2I5FA 5C16A 2YSZA 4WSFA 2UZRA 2UZSA 3TVVA 2K2JA 4D0NB 4K81A 3TO1A 4KHAA 2K2UA 2D9XA 2FJLA 4F7HA 3ODXA 2P8VA 4HDOA 1MIZB 2G35A 2L1CA 3GYPA 3U7DA 5J3YA 2DN6A 3QBVB 3G9WA 2XQNM 1J19A 1I2HA 2AEHA 2LG1A 4MK0A 1WGQA 1KZGA 1DDVA 2DHJA 2ADZA 3MDBC 2RLOA 2IFSA 3AU5A 1I7AA 4IAPA 2DLWA 2J0KA 1J0WA 1FGYA 2RSGA 2RGNB 2ZPYA 4K2PA 3SUZA 1DDWA 3PVLA 2D11A 2N23A 1ZC3B 1TJ6A 2D9WA 4F7GA 3MPXA 1MAIA 2J59M 3KRXA 3D8FA 2BCJA 4BBKA 3V5WA 1EGXA 4F7UP 4C0AA 2VRWB 5JHGA 1OMWA 5EFXA 2GS0A 4YL8A 5C5BB 2H7DA 1XX0A 1UEFA 1EVHA 4HB2B 3SYXA 2EMTA 2J0JA 1V5MA 5D3XA 4HAYB 4KVGB 2ROVA 2YS3A 4HHVA 2NMBA 1V61A 1IRSA 4HATB 4PQ0A 4KAXB 1P5TA 5C6RA 5DI9B 3BJIA 2CRFA 1MK9B 3FM8C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GC7 A;  5LOP B;  1V89 A;  1OQN A;  3D8E A;  2NZ8 B;  2M14 A;  1EAZ A;  1MKE A;  2RNR B;  3KRW A;  1OY2 A;  2COC A;  1GG3 A;  1FHX A;  3UZT A;  2MWN B;  3PEG A;  4HAU B;  3PG7 A;  2DKP A;  2KUP A;  4HB3 B;  5FI0 A;  3X23 A;  1U29 A;  5LON B;  4DBB A;  3T06 A;  4MY6 A;  1UNR A;  1UNQ A;  1QC6 A;  2ELA A;  4Y94 A;  4GZU A;  5D3W A;  1WI1 A;  4XWX A;  1X11 A;  5L81 A;  4HAZ B;  2VSZ A;  4A6K A;  1UPQ A;  3HK0 A;  1MPH A;  3PZD A;  4HDQ A;  1QQG A;  2MFQ A;  2P0H A;  2EC1 A;  1LW3 A;  3O96 A;  4TYZ A;  3SO6 A;  2W2X D;  2CY4 A;  4A5K A;  2DFK A;  4DXA B;  3CIK A;  1X1F A;  3TFM A;  4GMX B;  2LOX A;  2W2W A;  4MT7 A;  4A6F B;  3N7C A;  1XD4 A;  3F0W A;  1XKE A;  5C5B A;  5DIF B;  4CHM A;  1AWE A;  4A6H A;  2IYB A;  3KY9 A;  2COD A;  2LUL A;  1W1H A;  1P3R A;  1TXD A;  2DHK A;  4GPT B;  1ZC4 B;  5GOW B;  1BTK A;  3ULC A;  1RJ2 A;  1DRO A;  1M7E A;  2D10 A;  2OTX A;  2YF0 A;  4IOY X;  1GC6 A;  1ZVR A;  5HE0 A;  5J3T A;  1UPR A;  3OAN A;  2QKM A;  1PLS A;  3PSC A;  2YS5 A;  2RUK B;  1PMS A;  3D8D A;  1K5G B;  3KZ1 A;  4K17 A;  3PVW A;  2P0D A;  1Z87 A;  2CAY A;  3A8Q A;  4HAV B;  4EJN A;  5HE1 A;  2ELB A;  3RCP A;  2QKL A;  3HW2 B;  1FHO A;  1FHW A;  4L6E A;  1V5U A;  5FI1 A;  4IFS A;  3SNH A;  2H7E A;  5JP4 A;  2YRY A;  5DHF B;  2L2I A;  5JLJ B;  5C79 A;  3AJ4 A;  4DX9 0;  1ZSQ A;  1W1G A;  1UNP A;  2I1J A;  3ZDT A;  1PFJ A;  4GMV A;  1FB8 A;  4GXB A;  4K2O A;  2DX5 A;  1NTV A;  2HE7 A;  3U8Z A;  1U5F A;  1LB1 A;  5JHH A;  1ZM0 A;  5HE2 A;  1H4R A;  4EMO A;  1DBH A;  1NU2 A;  4A6F A;  1KZ7 A;  1U2B A;  2Y8F A;  4WVF B;  1N3H A;  3BIN A;  4PNK A;  1KI1 B;  1DYN A;  2X18 A;  3PVU A;  2GCL A;  1TQZ A;  2Z0O A;  4HB0 B;  2JP2 A;  3P6A A;  2DYN A;  3A8P A;  5D3V A;  4CHJ A;  3A98 B;  2I1K A;  2Z0Q A;  2Y7B A;  1EF1 A;  2UVM A;  3DXE A;  3KSY A;  3QIJ A;  3DXD A;  5KQ4 A;  2KGX B;  4ZRJ A;  1FOE A;  5D27 A;  1FGZ A;  1XCG A;  5D3Y A;  2D2Q A;  2R09 A;  1WG7 A;  3LJU X;  3ULB A;  1MK7 B;  2COA A;  4Z2M B;  2K00 A;  3DXC A;  3VOQ A;  2Z0P A;  2Y8G A;  4GN1 A;  1NI2 A;  1AQC A;  5CLL B;  2HTH B;  1ISN A;  2PZ1 A;  1NTY A;  4YON A;  2YT0 A;  4WJ7 A;  3VIA A;  2KCJ A;  3QWM A;  4P7I A;  2P0F A;  1BWN A;  2V76 A;  3M1I B;  2D4Q A;  4NY0 A;  1WVH A;  4EKU A;  4TKN A;  1X1G A;  3TW1 A;  1XOD A;  4B6H A;  5J3Q A;  2YT1 A;  2MDX A;  3SV1 A;  2COF A;  3ODO A;  3AU4 A;  1Y5O A;  2EMS A;  2GJY A;  2J0M A;  2LOZ A;  3ZVR A;  1U5D A;  2R0D A;  2EJ8 A;  1FAO A;  4HB4 B;  3ML4 A;  4ZRI A;  2D9Y A;  5HE3 A;  2ROZ B;  2YS1 A;  2DX1 A;  4CYE A;  1WJ1 A;  2CY5 A;  1K5D B;  1RRP B;  4KHB B;  1M7R A;  2DKQ A;  3TCA A;  2MKR A;  2YVC A;  1E5W A;  4H8S A;  1Y19 B;  5KCV A;  2GCJ A;  3F5R A;  4Z2N A;  3GYO A;  2LYD A;  3ODW A;  1P6S A;  1SHC A;  1V88 A;  5DHA B;  2Q13 A;  3NSU A;  1SGH A;  5KQ1 A;  1U27 A;  2D9Z A;  1Q67 A;  2DHI A;  2DYQ A;  3FSS A;  1U5G A;  3IVF A;  4HAX B;  2N0Y A;  1DDM A;  2DA0 A;  1H10 A;  4ZRK A;  3CXB B;  5CLQ B;  2VKI A;  2M38 A;  1WGU A;  3WA0 A;  4HAW B;  3PP2 A;  2AL6 A;  1BTN A;  2RVB B;  1XR0 B;  1B55 A;  1X86 A;  3FEH A;  4KHO A;  2LKO A;  2D9V A;  3WYF B;  2DTC A;  1BAK A;  5DH9 B;  1W1D A;  4DX8 A;  1U5E A;  2E2X A;  2W2X C;  2I5C A;  1MIX A;  3HQC A;  3P7Z A;  1V5P A;  1WJM A;  4NSW A;  1X05 A;  2OQB A;  2I5F A;  5C16 A;  2YSZ A;  4WSF A;  2UZR A;  2UZS A;  3TVV A;  2K2J A;  4D0N B;  4K81 A;  3TO1 A;  4KHA A;  2K2U A;  2D9X A;  2FJL A;  4F7H A;  3ODX A;  2P8V A;  4HDO A;  1MIZ B;  2G35 A;  2L1C A;  3GYP A;  3U7D A;  5J3Y A;  2DN6 A;  3QBV B;  3G9W A;  2XQN M;  1J19 A;  1I2H A;  2AEH A;  2LG1 A;  4MK0 A;  1WGQ A;  1KZG A;  1DDV A;  2DHJ A;  2ADZ A;  3MDB C;  2RLO A;  2IFS A;  3AU5 A;  1I7A A;  4IAP A;  2DLW A;  2J0K A;  1J0W A;  1FGY A;  2RSG A;  2RGN B;  2ZPY A;  4K2P A;  3SUZ A;  1DDW A;  3PVL A;  2D11 A;  2N23 A;  1ZC3 B;  1TJ6 A;  2D9W A;  4F7G A;  3MPX A;  1MAI A;  2J59 M;  3KRX A;  3D8F A;  2BCJ A;  4BBK A;  3V5W A;  1EGX A;  4F7U P;  4C0A A;  2VRW B;  5JHG A;  1OMW A;  5EFX A;  2GS0 A;  4YL8 A;  5C5B B;  2H7D A;  1XX0 A;  1UEF A;  1EVH A;  4HB2 B;  3SYX A;  2EMT A;  2J0J A;  1V5M A;  5D3X A;  4HAY B;  4KVG B;  2ROV A;  2YS3 A;  4HHV A;  2NMB A;  1V61 A;  1IRS A;  4HAT B;  4PQ0 A;  4KAX B;  1P5T A;  5C6R A;  5DI9 B;  3BJI A;  2CRF A;  1MK9 B;  3FM8 C; 
#chains in the Genus database with same CATH topology
 1GC7 A;  5LOP B;  1V89 A;  1OQN A;  3D8E A;  2NZ8 B;  2M14 A;  1EAZ A;  1MKE A;  2RNR B;  5I2S A;  3KRW A;  1OY2 A;  2COC A;  1GG3 A;  1FHX A;  3UZT A;  2MWN B;  3PEG A;  4HAU B;  3PG7 A;  2DKP A;  2KUP A;  4HB3 B;  5FI0 A;  3X23 A;  1U29 A;  3NWF A;  5LON B;  4DBB A;  3T06 A;  5IRS A;  4MY6 A;  1UNR A;  5LG4 B;  1UNQ A;  2Z14 A;  1QC6 A;  2ELA A;  4Y94 A;  4GZU A;  5D3W A;  1WI1 A;  4XWX A;  1X11 A;  5L81 A;  4HAZ B;  2VSZ A;  4A6K A;  1UPQ A;  3HK0 A;  1MPH A;  3PZD A;  2NBV A;  4HDQ A;  1QQG A;  2MFQ A;  2P0H A;  2EC1 A;  1LW3 A;  3O96 A;  4TYZ A;  3SO6 A;  2W2X D;  2CY4 A;  4A5K A;  2DFK A;  4DXA B;  3CIK A;  1X1F A;  3TFM A;  2GUM A;  4GMX B;  2LOX A;  2W2W A;  4MT7 A;  4A6F B;  3N7C A;  1XD4 A;  2KIE A;  3F0W A;  1XKE A;  5C5B A;  5DIF B;  4CHM A;  1AWE A;  4A6H A;  2IYB A;  3KY9 A;  2COD A;  2LUL A;  1W1H A;  1P3R A;  1TXD A;  2DHK A;  4GPT B;  3NWD A;  1ZC4 B;  5GOW B;  1BTK A;  3ULC A;  4QJ5 B;  1RJ2 A;  1DRO A;  1M7E A;  2D10 A;  2OTX A;  2YF0 A;  4IOY X;  1GC6 A;  1ZVR A;  5HE0 A;  5J3T A;  1UPR A;  3OAN A;  2QKM A;  1PLS A;  4OSN A;  3PSC A;  2YS5 A;  2RUK B;  1PMS A;  3D8D A;  1K5G B;  3KZ1 A;  4K17 A;  3PVW A;  2P0D A;  1Z87 A;  2CAY A;  3A8Q A;  4HAV B;  4EJN A;  5HE1 A;  2ELB A;  3RCP A;  1ZYI A;  2QKL A;  3HW2 B;  1FHO A;  1FHW A;  4L6E A;  1V5U A;  5FI1 A;  4IFS A;  3SNH A;  2H7E A;  5JP4 A;  2YRY A;  5DHF B;  2L2I A;  4CSQ A;  5JLJ B;  5C79 A;  3AJ4 A;  4DX9 0;  1ZSQ A;  1W1G A;  1UNP A;  2I1J A;  3B77 A;  3ZDT A;  1PFJ A;  4GMV A;  1FB8 A;  4GXB A;  4K2O A;  2DX5 A;  4D6W A;  1NTV A;  2HE7 A;  3U8Z A;  1U5F A;  1LB1 A;  5JHH A;  1ZM0 A;  5HE2 A;  1H4R A;  4EMO A;  1DBH A;  1NU2 A;  2Z59 A;  4A6F A;  1KZ7 A;  1U2B A;  4GOU A;  2Y8F A;  4WVF B;  3U12 A;  1N3H A;  3BIN A;  4PNK A;  1KI1 B;  1DYN A;  2X18 A;  2KIG A;  3PVU A;  2GCL A;  1TQZ A;  2Z0O A;  4HB0 B;  2JP2 A;  3P6A A;  2DYN A;  3A8P A;  5D3V A;  4CHJ A;  3A98 B;  2I1K A;  2Z0Q A;  2Y7B A;  1EF1 A;  2UVM A;  3DXE A;  3KSY A;  2K49 A;  3QIJ A;  3DXD A;  3HSA A;  5KQ4 A;  2KGX B;  4ZRJ A;  1FOE A;  5D27 A;  1FGZ A;  1XCG A;  5D3Y A;  2ZKM X;  2D2Q A;  2R09 A;  1WG7 A;  3LJU X;  3ULB A;  1MK7 B;  2COA A;  4Z2M B;  2K00 A;  3DCX A;  1MI1 A;  3DXC A;  3VOQ A;  2Z0P A;  2Y8G A;  4GN1 A;  1NI2 A;  1AQC A;  5CLL B;  2HTH B;  1ISN A;  2PZ1 A;  1NTY A;  4YON A;  2YT0 A;  4WJ7 A;  4QJ4 B;  3VIA A;  2KCJ A;  3QWM A;  4P7I A;  2P0F A;  1BWN A;  2V76 A;  3M1I B;  2D4Q A;  4NY0 A;  1WVH A;  4EKU A;  4TKN A;  1X1G A;  3TW1 A;  1XOD A;  4B6H A;  5J3Q A;  2YT1 A;  2MDX A;  3SV1 A;  2COF A;  3ODO A;  3AU4 A;  1Y5O A;  3NWA A;  2EMS A;  2GJY A;  2J0M A;  2LOZ A;  3ZVR A;  1U5D A;  2R0D A;  2EJ8 A;  4DIX A;  1FAO A;  4HB4 B;  3ML4 A;  4ZRI A;  2Z13 A;  2D9Y A;  4OT1 A;  2ROZ B;  2YS1 A;  2DX1 A;  5HE3 A;  4CYE A;  3A58 A;  1WJ1 A;  2CY5 A;  1K5D B;  1RRP B;  4KHB B;  1M7R A;  2DKQ A;  3TCA A;  2MKR A;  2YVC A;  1E5W A;  4H8S A;  1Y19 B;  5KCV A;  2GCJ A;  3F5R A;  2KUQ A;  4Z2N A;  3GYO A;  2LYD A;  3ODW A;  1P6S A;  1SHC A;  4L1R A;  5I2M A;  1V88 A;  5DHA B;  2Q13 A;  3NSU A;  1SGH A;  5KQ1 A;  1U27 A;  2D9Z A;  1Q67 A;  2DHI A;  2DYQ A;  3FSS A;  3FVC A;  1U5G A;  3IVF A;  4HAX B;  2N0Y A;  1DDM A;  2DA0 A;  1H10 A;  4ZRK A;  3CXB B;  5CLQ B;  2VKI A;  2M38 A;  2Z4D A;  1WGU A;  3WA0 A;  4HAW B;  3PP2 A;  2AL6 A;  1BTN A;  2RVB B;  1XR0 B;  1B55 A;  1X86 A;  3FEH A;  4KHO A;  2LKO A;  2D9V A;  3WYF B;  1T77 A;  2DTC A;  4GNK B;  1BAK A;  5DH9 B;  1W1D A;  4DX8 A;  1U5E A;  2E2X A;  2W2X C;  2I5C A;  1MIX A;  3HQC A;  3P7Z A;  1V5P A;  1WJM A;  4NSW A;  1X05 A;  2OQB A;  3NW8 A;  2I5F A;  5C16 A;  2YSZ A;  4WSF A;  2UZR A;  3HIE A;  2UZS A;  3TVV A;  2K2J A;  4D0N B;  2KR0 A;  4K81 A;  3TO1 A;  2YT2 A;  4KHA A;  2K2U A;  2D9X A;  2FJL A;  4F7H A;  3ODX A;  2P8V A;  4QJ3 B;  4HDO A;  1MIZ B;  2G35 A;  2L1C A;  4KHB A;  3GYP A;  3U7D A;  4HSI A;  5J3Y A;  2DN6 A;  3QBV B;  3G9W A;  2XQN M;  1J19 A;  1I2H A;  3OHM B;  2AEH A;  2LG1 A;  4MK0 A;  1WGQ A;  1KZG A;  1DDV A;  2DHJ A;  2ADZ A;  3MDB C;  2RLO A;  2IFS A;  3AU5 A;  1I7A A;  5M4Y B;  4IAP A;  2DLW A;  2J0K A;  1J0W A;  1FGY A;  2RSG A;  2RGN B;  2ZPY A;  4K2P A;  3SUZ A;  1DDW A;  3PVL A;  2D11 A;  2N23 A;  1ZC3 B;  1TJ6 A;  2D9W A;  4F7G A;  3MPX A;  2RRF A;  1MAI A;  2J59 M;  3KRX A;  3D8F A;  2BCJ A;  4BBK A;  3V5W A;  1EGX A;  4F7U P;  4C0A A;  2VRW B;  5JHG A;  1OMW A;  2K8E A;  5EFX A;  2GS0 A;  4YL8 A;  5C5B B;  2H7D A;  1XX0 A;  1UEF A;  1EVH A;  4HB2 B;  3SYX A;  2EMT A;  2J0J A;  4QXA B;  1V5M A;  5D3X A;  4HAY B;  4KVG B;  2ROV A;  2YS3 A;  2R2Y A;  4HHV A;  2NMB A;  1V61 A;  1IRS A;  4HAT B;  4PQ0 A;  4KAX B;  1P5T A;  5C6R A;  5DI9 B;  3BJI A;  2FJU B;  2CRF A;  1MK9 B;  3FM8 C; 
#chains in the Genus database with same CATH homology
 1GC7 A;  5LOP B;  1V89 A;  1OQN A;  3D8E A;  2NZ8 B;  2M14 A;  1EAZ A;  1MKE A;  2RNR B;  3KRW A;  1OY2 A;  2COC A;  1GG3 A;  1FHX A;  3UZT A;  2MWN B;  3PEG A;  4HAU B;  3PG7 A;  2DKP A;  2KUP A;  4HB3 B;  5FI0 A;  3X23 A;  1U29 A;  5LON B;  4DBB A;  3T06 A;  4MY6 A;  1UNR A;  1UNQ A;  1QC6 A;  2ELA A;  4Y94 A;  4GZU A;  5D3W A;  1WI1 A;  4XWX A;  1X11 A;  5L81 A;  4HAZ B;  2VSZ A;  4A6K A;  1UPQ A;  3HK0 A;  1MPH A;  3PZD A;  4HDQ A;  1QQG A;  2MFQ A;  2P0H A;  2EC1 A;  1LW3 A;  3O96 A;  4TYZ A;  3SO6 A;  2W2X D;  2CY4 A;  4A5K A;  2DFK A;  4DXA B;  3CIK A;  1X1F A;  3TFM A;  4GMX B;  2LOX A;  2W2W A;  4MT7 A;  4A6F B;  3N7C A;  1XD4 A;  3F0W A;  1XKE A;  5C5B A;  5DIF B;  4CHM A;  1AWE A;  4A6H A;  2IYB A;  3KY9 A;  2COD A;  2LUL A;  1W1H A;  1P3R A;  1TXD A;  2DHK A;  4GPT B;  1ZC4 B;  5GOW B;  1BTK A;  3ULC A;  1RJ2 A;  1DRO A;  1M7E A;  2D10 A;  2OTX A;  2YF0 A;  4IOY X;  1GC6 A;  1ZVR A;  5HE0 A;  5J3T A;  1UPR A;  3OAN A;  2QKM A;  1PLS A;  3PSC A;  2YS5 A;  2RUK B;  1PMS A;  3D8D A;  1K5G B;  3KZ1 A;  4K17 A;  3PVW A;  2P0D A;  1Z87 A;  2CAY A;  3A8Q A;  4HAV B;  4EJN A;  5HE1 A;  2ELB A;  3RCP A;  2QKL A;  3HW2 B;  1FHO A;  1FHW A;  4L6E A;  1V5U A;  5FI1 A;  4IFS A;  3SNH A;  2H7E A;  5JP4 A;  2YRY A;  5DHF B;  2L2I A;  5JLJ B;  5C79 A;  3AJ4 A;  4DX9 0;  1ZSQ A;  1W1G A;  1UNP A;  2I1J A;  3ZDT A;  1PFJ A;  4GMV A;  1FB8 A;  4GXB A;  4K2O A;  2DX5 A;  1NTV A;  2HE7 A;  3U8Z A;  1U5F A;  1LB1 A;  5JHH A;  1ZM0 A;  5HE2 A;  1H4R A;  4EMO A;  1DBH A;  1NU2 A;  4A6F A;  1KZ7 A;  1U2B A;  2Y8F A;  4WVF B;  1N3H A;  3BIN A;  4PNK A;  1KI1 B;  1DYN A;  2X18 A;  3PVU A;  2GCL A;  1TQZ A;  2Z0O A;  4HB0 B;  2JP2 A;  3P6A A;  2DYN A;  3A8P A;  5D3V A;  4CHJ A;  3A98 B;  2I1K A;  2Z0Q A;  2Y7B A;  1EF1 A;  2UVM A;  3DXE A;  3KSY A;  3QIJ A;  3DXD A;  5KQ4 A;  2KGX B;  4ZRJ A;  1FOE A;  5D27 A;  1FGZ A;  1XCG A;  5D3Y A;  2D2Q A;  2R09 A;  1WG7 A;  3LJU X;  3ULB A;  1MK7 B;  2COA A;  4Z2M B;  2K00 A;  3DXC A;  3VOQ A;  2Z0P A;  2Y8G A;  4GN1 A;  1NI2 A;  1AQC A;  5CLL B;  2HTH B;  1ISN A;  2PZ1 A;  1NTY A;  4YON A;  2YT0 A;  4WJ7 A;  3VIA A;  2KCJ A;  3QWM A;  4P7I A;  2P0F A;  1BWN A;  2V76 A;  3M1I B;  2D4Q A;  4NY0 A;  1WVH A;  4EKU A;  4TKN A;  1X1G A;  3TW1 A;  1XOD A;  4B6H A;  5J3Q A;  2YT1 A;  2MDX A;  3SV1 A;  2COF A;  3ODO A;  3AU4 A;  1Y5O A;  2EMS A;  2GJY A;  2J0M A;  2LOZ A;  3ZVR A;  1U5D A;  2R0D A;  2EJ8 A;  1FAO A;  4HB4 B;  3ML4 A;  4ZRI A;  2D9Y A;  5HE3 A;  2ROZ B;  2YS1 A;  2DX1 A;  4CYE A;  1WJ1 A;  2CY5 A;  1K5D B;  1RRP B;  4KHB B;  1M7R A;  2DKQ A;  3TCA A;  2MKR A;  2YVC A;  1E5W A;  4H8S A;  1Y19 B;  5KCV A;  2GCJ A;  3F5R A;  4Z2N A;  3GYO A;  2LYD A;  3ODW A;  1P6S A;  1SHC A;  1V88 A;  5DHA B;  2Q13 A;  3NSU A;  1SGH A;  5KQ1 A;  1U27 A;  2D9Z A;  1Q67 A;  2DHI A;  2DYQ A;  3FSS A;  1U5G A;  3IVF A;  4HAX B;  2N0Y A;  1DDM A;  2DA0 A;  1H10 A;  4ZRK A;  3CXB B;  5CLQ B;  2VKI A;  2M38 A;  1WGU A;  3WA0 A;  4HAW B;  3PP2 A;  2AL6 A;  1BTN A;  2RVB B;  1XR0 B;  1B55 A;  1X86 A;  3FEH A;  4KHO A;  2LKO A;  2D9V A;  3WYF B;  2DTC A;  1BAK A;  5DH9 B;  1W1D A;  4DX8 A;  1U5E A;  2E2X A;  2W2X C;  2I5C A;  1MIX A;  3HQC A;  3P7Z A;  1V5P A;  1WJM A;  4NSW A;  1X05 A;  2OQB A;  2I5F A;  5C16 A;  2YSZ A;  4WSF A;  2UZR A;  2UZS A;  3TVV A;  2K2J A;  4D0N B;  4K81 A;  3TO1 A;  4KHA A;  2K2U A;  2D9X A;  2FJL A;  4F7H A;  3ODX A;  2P8V A;  4HDO A;  1MIZ B;  2G35 A;  2L1C A;  3GYP A;  3U7D A;  5J3Y A;  2DN6 A;  3QBV B;  3G9W A;  2XQN M;  1J19 A;  1I2H A;  2AEH A;  2LG1 A;  4MK0 A;  1WGQ A;  1KZG A;  1DDV A;  2DHJ A;  2ADZ A;  3MDB C;  2RLO A;  2IFS A;  3AU5 A;  1I7A A;  4IAP A;  2DLW A;  2J0K A;  1J0W A;  1FGY A;  2RSG A;  2RGN B;  2ZPY A;  4K2P A;  3SUZ A;  1DDW A;  3PVL A;  2D11 A;  2N23 A;  1ZC3 B;  1TJ6 A;  2D9W A;  4F7G A;  3MPX A;  1MAI A;  2J59 M;  3KRX A;  3D8F A;  2BCJ A;  4BBK A;  3V5W A;  1EGX A;  4F7U P;  4C0A A;  2VRW B;  5JHG A;  1OMW A;  5EFX A;  2GS0 A;  4YL8 A;  5C5B B;  2H7D A;  1XX0 A;  1UEF A;  1EVH A;  4HB2 B;  3SYX A;  2EMT A;  2J0J A;  1V5M A;  5D3X A;  4HAY B;  4KVG B;  2ROV A;  2YS3 A;  4HHV A;  2NMB A;  1V61 A;  1IRS A;  4HAT B;  4PQ0 A;  4KAX B;  1P5T A;  5C6R A;  5DI9 B;  3BJI A;  2CRF A;  1MK9 B;  3FM8 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...