1OQNA

Crystal structure of the phosphotyrosine binding domain (ptb) of mouse disabled 1 (dab1)
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
150
structure length
150
Chain Sequence
b'RSEATLIKRFKGEGVRYKAKLIGIDEVSAARGDKLCQDSMMKLKGVVAGARSKGEHKQKIFLTISFGGIKIFDEKTGALQHHHAVHEISYIAKDITDHRAFGYVCGKEGNHRFVAIKTAQAAEPVILDLRDLFQLIYELKQREELEKKAQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Disabled homolog 1
publication title Crystal structures of the Dab homology domains of mouse disabled 1 and 2
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
total genus 47
structure length 150
sequence length 150
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00640 PID Phosphotyrosine interaction domain (PTB/PID)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1oqnA00
1DROA 2W2WA 1FOEA 5DI9B 2EC1A 1MK7B 1DDWA 2LOXA 2P8VA 2KCJA 1FGYA 2P0HA 1PFJA 4C0AA 1QQGA 1QC6A 5FI1A 1U5EA 2H7EA 2DKQA 2K00A 2EJ8A 4WJ7A 2J0KA 1RJ2A 1V89A 3PVLA 5D3XA 4CHMA 1UNPA 3O96A 3AU4A 3PEGA 1BTKA 2MKRA 3G9WA 2CRFA 2MFQA 4HB0B 3OANA 3RCPA 2L1CA 4GMXB 1XODA 2Y7BA 3U7DA 5D3VA 2OTXA 1J19A 1NTYA 4GN1A 2K2UA 2R09A 2QKLA 2G35A 3MDBC 5D3YA 4A6FA 3DXDA 1UEFA 2DLWA 1IRSA 2DYNA 2XQNM 2Z0OA 4KVGB 4XWXA 3KRWA 2OQBA 2JP2A 1ISNA 2Z0PA 5LOPB 3PVUA 2D2QA 1KI1B 4K2PA 2D10A 4A6KA 5JLJB 2P0FA 2J0MA 4WVFB 4DBBA 1I2HA 4IAPA 1WGQA 1U2BA 3KZ1A 2QKMA 1UPRA 3P6AA 2V76A 1EF1A 2Y8FA 4F7GA 2D4QA 1BWNA 4HAXB 3ZVRA 2M14A 3LJUX 2D9VA 3HW2B 2I5FA 1ZC4B 4YL8A 1FHWA 2LKOA 1Y19B 3D8FA 5JP4A 2ELBA 4ZRKA 2DHJA 3CXBB 1W1GA 4TKNA 3ZDTA 2DX1A 1TJ6A 1X86A 3AJ4A 4HAZB 4K17A 2D9WA 1U29A 3ULBA 1Q67A 3TFMA 4KHOA 1I7AA 1V5MA 2VSZA 1UNQA 1FHXA 1WVHA 1MIZB 2DTCA 2AL6A 2YF0A 3ML4A 5DHFB 4HB3B 3TW1A 5CLQB 1WJMA 4HB4B 2W2XC 2MDXA 1FGZA 1K5GB 2J0JA 4WSFA 2PZ1A 4EJNA 4K2OA 2GCLA 2ROVA 5DH9B 4NSWA 1OMWA 2I5CA 3HK0A 5KQ1A 4HB2B 1GC7A 5JHHA 1TXDA 4Z2MB 3ODXA 4GXBA 4KHBB 5C79A 2RNRB 1BTNA 3IVFA 2N0YA 3TCAA 1NI2A 1P3RA 1GG3A 5HE0A 3A98B 2HE7A 1XD4A 2K2JA 2Q13A 4A5KA 2Y8GA 3BJIA 3UZTA 2YSZA 1MKEA 4IOYX 1X11A 3CIKA 4HATB 3BINA 2I1KA 3U8ZA 4HHVA 1J0WA 1E5WA 1MPHA 2DYQA 4MK0A 1DBHA 2H7DA 1MK9B 4HDOA 1FB8A 2CY5A 1X1GA 2YT0A 1U5FA 2ZPYA 3F0WA 2COFA 1NTVA 3QBVB 5C5BB 1M7EA 2MWNB 2GJYA 3N7CA 1K5DB 3SUZA 2FJLA 1XX0A 1V88A 2COAA 1WGUA 3QIJA 3WYFB 3FEHA 2KUPA 5J3QA 5C16A 4GZUA 3DXCA 2DA0A 1XCGA 5LONB 2DFKA 2LOZA 3ODOA 4B6HA 2GS0A 2X18A 2D9XA 1X1FA 3SV1A 4Y94A 2E2XA 4L6EA 4HDQA 1Y5OA 2VKIA 1V5PA 2CAYA 2HTHB 5HE2A 1ZM0A 4DX90 4NY0A 3D8DA 1PMSA 3T06A 2W2XD 3F5RA 1UPQA 4KAXB 1N3HA 1ZC3B 3MPXA 1FHOA 3QWMA 2RGNB 2ADZA 3SYXA 4ZRJA 4HAYB 1H10A 2NZ8B 2LYDA 2D9YA 1OQNA 4IFSA 4F7HA 1EGXA 3KSYA 4P7IA 1BAKA 2NMBA 4K81A 1OY2A 4H8SA 4A6FB 1DDVA 5D3WA 3GYPA 3P7ZA 2CY4A 3A8QA 4PQ0A 3V5WA 1P5TA 2UZRA 2YS1A 3FSSA 3X23A 5DHAB 4HAWB 2YVCA 2N23A 3ULCA 2D9ZA 2RLOA 2YT1A 2DKPA 1LW3A 1V5UA 3PSCA 2LULA 1WI1A 2AEHA 2IFSA 4DX8A 3KRXA 4PNKA 1SHCA 2CODA 1V61A 2DHIA 2P0DA 3A8PA 3PVWA 1KZGA 3VOQA 4GPTB 5J3TA 1RRPB 4ZRIA 2IYBA 1AQCA 4HAVB 2COCA 2M38A 2RUKB 2J59M 1PLSA 2KGXB 1XR0B 3SO6A 2EMSA 2YRYA 3NSUA 3PZDA 3TO1A 2YS5A 5KCVA 1AWEA 2GCJA 1WG7A 2Z0QA 1KZ7A 2UZSA 1U27A 5L81A 4Z2NA 1B55A 5D27A 1ZVRA 2UVMA 2DHKA 4EMOA 2LG1A 2R0DA 1UNRA 1DDMA 3DXEA 4HAUB 1LB1A 4A6HA 2DN6A 4CYEA 5C6RA 3VIAA 3GYOA 1GC6A 3TVVA 1H4RA 4DXAB 2YS3A 1WJ1A 3M1IB 1M7RA 2ELAA 1W1DA 5GOWB 5CLLB 3PP2A 1SGHA 4TYZA 3PG7A 4MY6A 1FAOA 5HE3A 1DYNA 2RVBB 3AU5A 3D8EA 4EKUA 3SNHA 1TQZA 5HE1A 4F7UP 2L2IA 3ODWA 3HQCA 2ROZB 2EMTA 4GMVA 2BCJA 2I1JA 4CHJA 5DIFB 1U5GA 3KY9A 5KQ4A 1MIXA 5EFXA 4MT7A 3FM8C 4KHAA 1XKEA 1EVHA 5J3YA 2RSGA 3WA0A 1U5DA 1P6SA 1ZSQA 2DX5A 1NU2A 5JHGA 1MAIA 1EAZA 1Z87A 5C5BA 4BBKA 2D11A 5FI0A 1X05A 1W1HA 2VRWB 4YONA 4D0NB
chains in the Genus database with same CATH superfamily
1DROA 2W2WA 1FOEA 5DI9B 2EC1A 1MK7B 1DDWA 2LOXA 2P8VA 2KCJA 1FGYA 2P0HA 1PFJA 2Z14A 4C0AA 1QQGA 1QC6A 5FI1A 1U5EA 4QJ4B 2H7EA 5I2MA 2DKQA 2K00A 2EJ8A 4WJ7A 2J0KA 1RJ2A 1V89A 3PVLA 5D3XA 4CHMA 1UNPA 3O96A 3AU4A 3PEGA 1BTKA 2MKRA 3G9WA 4DIXA 2CRFA 2MFQA 4HB0B 3OANA 3RCPA 2L1CA 4GMXB 1XODA 2Y7BA 3U7DA 5D3VA 2OTXA 1J19A 1NTYA 4GN1A 2K2UA 2R09A 2QKLA 2G35A 3MDBC 5D3YA 4A6FA 3DXDA 1UEFA 2DLWA 3HIEA 4OSNA 1IRSA 2DYNA 2XQNM 2Z0OA 4KVGB 4XWXA 3KRWA 2OQBA 2ZKMX 2JP2A 1ISNA 2Z0PA 5LOPB 3PVUA 2D2QA 1KI1B 4K2PA 2D10A 3U12A 4A6KA 5JLJB 2P0FA 2J0MA 4WVFB 4DBBA 1I2HA 3B77A 4IAPA 1WGQA 1U2BA 3KZ1A 2QKMA 1UPRA 3P6AA 2V76A 1EF1A 2Y8FA 4F7GA 2D4QA 1BWNA 4HAXB 3ZVRA 2M14A 3LJUX 2D9VA 3HW2B 2I5FA 1ZC4B 4QXAB 4YL8A 1FHWA 2LKOA 3NW8A 1Y19B 3D8FA 2Z13A 5JP4A 2ELBA 4ZRKA 2DHJA 3CXBB 1W1GA 4TKNA 3ZDTA 2DX1A 1TJ6A 1X86A 3AJ4A 4HAZB 4K17A 2D9WA 1U29A 4QJ5B 3ULBA 1Q67A 3TFMA 4KHOA 1I7AA 1V5MA 2VSZA 1UNQA 1FHXA 1WVHA 4GOUA 1MIZB 2DTCA 2AL6A 2YF0A 3ML4A 5DHFB 4HB3B 3TW1A 5CLQB 1WJMA 4HB4B 2W2XC 2MDXA 1FGZA 1K5GB 2J0JA 4WSFA 2PZ1A 4EJNA 4K2OA 2GCLA 2ROVA 1ZYIA 5DH9B 4NSWA 1OMWA 2I5CA 3HK0A 5KQ1A 4HB2B 1GC7A 5JHHA 1TXDA 4Z2MB 3ODXA 4GXBA 3NWFA 4KHBB 5C79A 2RNRB 1BTNA 3IVFA 2N0YA 3TCAA 1NI2A 1P3RA 1GG3A 5HE0A 3A98B 2HE7A 1XD4A 2K2JA 2Q13A 2KUQA 4A5KA 2Y8GA 2Z4DA 3BJIA 3UZTA 2YSZA 1MKEA 4IOYX 1X11A 3CIKA 4HATB 3BINA 2K49A 2I1KA 3U8ZA 4HHVA 2YT2A 1J0WA 1E5WA 1MPHA 2DYQA 4MK0A 2FJUB 5IRSA 1DBHA 2H7DA 5LG4B 1MK9B 4HDOA 1FB8A 2CY5A 1X1GA 2YT0A 1U5FA 2ZPYA 3F0WA 2COFA 1NTVA 2R2YA 3QBVB 5C5BB 1M7EA 2MWNB 2GJYA 3N7CA 1K5DB 3SUZA 2FJLA 1XX0A 1V88A 2COAA 1WGUA 3QIJA 3WYFB 3FEHA 2KUPA 5J3QA 5C16A 4D6WA 4GZUA 3DXCA 2DA0A 4KHBA 1XCGA 5LONB 2DFKA 2LOZA 3ODOA 4L1RA 4B6HA 2GS0A 2X18A 2D9XA 1X1FA 3SV1A 4Y94A 2E2XA 4L6EA 4HDQA 1Y5OA 2VKIA 1V5PA 2CAYA 2HTHB 5HE2A 1ZM0A 3OHMB 4DX90 4NY0A 3D8DA 1PMSA 3T06A 2W2XD 3F5RA 1UPQA 4KAXB 1N3HA 3DCXA 1ZC3B 3MPXA 1FHOA 3QWMA 2RGNB 2ADZA 3SYXA 4ZRJA 4HAYB 1H10A 2NZ8B 2LYDA 2D9YA 1OQNA 4IFSA 4F7HA 2NBVA 1EGXA 3KSYA 4P7IA 1BAKA 2NMBA 4K81A 1OY2A 4H8SA 2KIGA 4A6FB 1DDVA 5D3WA 3GYPA 3P7ZA 2CY4A 3A8QA 4PQ0A 3V5WA 1P5TA 2UZRA 2YS1A 3FSSA 3X23A 5DHAB 4HAWB 3NWDA 2YVCA 2N23A 3ULCA 2D9ZA 2RLOA 2YT1A 2DKPA 1LW3A 1V5UA 3PSCA 2LULA 1WI1A 2AEHA 2IFSA 3FVCA 4DX8A 3KRXA 1MI1A 4PNKA 1SHCA 2CODA 3A58A 1V61A 2DHIA 2P0DA 3A8PA 3PVWA 1KZGA 3VOQA 4GPTB 4OT1A 5J3TA 1RRPB 4ZRIA 2Z59A 4QJ3B 2IYBA 1AQCA 4HAVB 2COCA 2M38A 2RUKB 2J59M 1PLSA 2KGXB 1XR0B 3SO6A 2EMSA 2YRYA 3NSUA 3PZDA 3TO1A 2YS5A 5KCVA 1AWEA 2GCJA 1WG7A 2Z0QA 1KZ7A 2UZSA 1U27A 5L81A 1T77A 4Z2NA 1B55A 5D27A 1ZVRA 2UVMA 2DHKA 4EMOA 2LG1A 2R0DA 1UNRA 1DDMA 4HSIA 3DXEA 4HAUB 1LB1A 4A6HA 2DN6A 4CYEA 5C6RA 3VIAA 3GYOA 1GC6A 3TVVA 1H4RA 4GNKB 4DXAB 2YS3A 3NWAA 1WJ1A 3M1IB 1M7RA 2ELAA 1W1DA 5GOWB 5CLLB 3PP2A 1SGHA 3HSAA 4TYZA 3PG7A 2RRFA 4MY6A 1FAOA 5HE3A 1DYNA 2RVBB 3AU5A 3D8EA 4CSQA 4EKUA 5I2SA 5M4YB 3SNHA 1TQZA 5HE1A 4F7UP 2L2IA 3ODWA 3HQCA 2ROZB 2EMTA 2KIEA 4GMVA 2BCJA 2I1JA 4CHJA 5DIFB 1U5GA 3KY9A 5KQ4A 1MIXA 5EFXA 4MT7A 3FM8C 4KHAA 1XKEA 1EVHA 5J3YA 2RSGA 3WA0A 2K8EA 2KR0A 1U5DA 1P6SA 1ZSQA 2DX5A 1NU2A 5JHGA 1MAIA 1EAZA 1Z87A 5C5BA 2GUMA 4BBKA 2D11A 5FI0A 1X05A 1W1HA 2VRWB 4YONA 4D0NB
chains in the Genus database with same CATH topology
1DROA 2W2WA 1FOEA 5DI9B 2EC1A 1MK7B 1DDWA 2LOXA 2P8VA 2KCJA 1FGYA 2P0HA 1PFJA 4C0AA 1QQGA 1QC6A 5FI1A 1U5EA 2H7EA 2DKQA 2K00A 2EJ8A 4WJ7A 2J0KA 1RJ2A 1V89A 3PVLA 5D3XA 4CHMA 1UNPA 3O96A 3AU4A 3PEGA 1BTKA 2MKRA 3G9WA 2CRFA 2MFQA 4HB0B 3OANA 3RCPA 2L1CA 4GMXB 1XODA 2Y7BA 3U7DA 5D3VA 2OTXA 1J19A 1NTYA 4GN1A 2K2UA 2R09A 2QKLA 2G35A 3MDBC 5D3YA 4A6FA 3DXDA 1UEFA 2DLWA 1IRSA 2DYNA 2XQNM 2Z0OA 4KVGB 4XWXA 3KRWA 2OQBA 2JP2A 1ISNA 2Z0PA 5LOPB 3PVUA 2D2QA 1KI1B 4K2PA 2D10A 4A6KA 5JLJB 2P0FA 2J0MA 4WVFB 4DBBA 1I2HA 4IAPA 1WGQA 1U2BA 3KZ1A 2QKMA 1UPRA 3P6AA 2V76A 1EF1A 2Y8FA 4F7GA 2D4QA 1BWNA 4HAXB 3ZVRA 2M14A 3LJUX 2D9VA 3HW2B 2I5FA 1ZC4B 4YL8A 1FHWA 2LKOA 1Y19B 3D8FA 5JP4A 2ELBA 4ZRKA 2DHJA 3CXBB 1W1GA 4TKNA 3ZDTA 2DX1A 1TJ6A 1X86A 3AJ4A 4HAZB 4K17A 2D9WA 1U29A 3ULBA 1Q67A 3TFMA 4KHOA 1I7AA 1V5MA 2VSZA 1UNQA 1FHXA 1WVHA 1MIZB 2DTCA 2AL6A 2YF0A 3ML4A 5DHFB 4HB3B 3TW1A 5CLQB 1WJMA 4HB4B 2W2XC 2MDXA 1FGZA 1K5GB 2J0JA 4WSFA 2PZ1A 4EJNA 4K2OA 2GCLA 2ROVA 5DH9B 4NSWA 1OMWA 2I5CA 3HK0A 5KQ1A 4HB2B 1GC7A 5JHHA 1TXDA 4Z2MB 3ODXA 4GXBA 4KHBB 5C79A 2RNRB 1BTNA 3IVFA 2N0YA 3TCAA 1NI2A 1P3RA 1GG3A 5HE0A 3A98B 2HE7A 1XD4A 2K2JA 2Q13A 4A5KA 2Y8GA 3BJIA 3UZTA 2YSZA 1MKEA 4IOYX 1X11A 3CIKA 4HATB 3BINA 2I1KA 3U8ZA 4HHVA 1J0WA 1E5WA 1MPHA 2DYQA 4MK0A 1DBHA 2H7DA 1MK9B 4HDOA 1FB8A 2CY5A 1X1GA 2YT0A 1U5FA 2ZPYA 3F0WA 2COFA 1NTVA 3QBVB 5C5BB 1M7EA 2MWNB 2GJYA 3N7CA 1K5DB 3SUZA 2FJLA 1XX0A 1V88A 2COAA 1WGUA 3QIJA 3WYFB 3FEHA 2KUPA 5J3QA 5C16A 4GZUA 3DXCA 2DA0A 1XCGA 5LONB 2DFKA 2LOZA 3ODOA 4B6HA 2GS0A 2X18A 2D9XA 1X1FA 3SV1A 4Y94A 2E2XA 4L6EA 4HDQA 1Y5OA 2VKIA 1V5PA 2CAYA 2HTHB 5HE2A 1ZM0A 4DX90 4NY0A 3D8DA 1PMSA 3T06A 2W2XD 3F5RA 1UPQA 4KAXB 1N3HA 1ZC3B 3MPXA 1FHOA 3QWMA 2RGNB 2ADZA 3SYXA 4ZRJA 4HAYB 1H10A 2NZ8B 2LYDA 2D9YA 1OQNA 4IFSA 4F7HA 1EGXA 3KSYA 4P7IA 1BAKA 2NMBA 4K81A 1OY2A 4H8SA 4A6FB 1DDVA 5D3WA 3GYPA 3P7ZA 2CY4A 3A8QA 4PQ0A 3V5WA 1P5TA 2UZRA 2YS1A 3FSSA 3X23A 5DHAB 4HAWB 2YVCA 2N23A 3ULCA 2D9ZA 2RLOA 2YT1A 2DKPA 1LW3A 1V5UA 3PSCA 2LULA 1WI1A 2AEHA 2IFSA 4DX8A 3KRXA 4PNKA 1SHCA 2CODA 1V61A 2DHIA 2P0DA 3A8PA 3PVWA 1KZGA 3VOQA 4GPTB 5J3TA 1RRPB 4ZRIA 2IYBA 1AQCA 4HAVB 2COCA 2M38A 2RUKB 2J59M 1PLSA 2KGXB 1XR0B 3SO6A 2EMSA 2YRYA 3NSUA 3PZDA 3TO1A 2YS5A 5KCVA 1AWEA 2GCJA 1WG7A 2Z0QA 1KZ7A 2UZSA 1U27A 5L81A 4Z2NA 1B55A 5D27A 1ZVRA 2UVMA 2DHKA 4EMOA 2LG1A 2R0DA 1UNRA 1DDMA 3DXEA 4HAUB 1LB1A 4A6HA 2DN6A 4CYEA 5C6RA 3VIAA 3GYOA 1GC6A 3TVVA 1H4RA 4DXAB 2YS3A 1WJ1A 3M1IB 1M7RA 2ELAA 1W1DA 5GOWB 5CLLB 3PP2A 1SGHA 4TYZA 3PG7A 4MY6A 1FAOA 5HE3A 1DYNA 2RVBB 3AU5A 3D8EA 4EKUA 3SNHA 1TQZA 5HE1A 4F7UP 2L2IA 3ODWA 3HQCA 2ROZB 2EMTA 4GMVA 2BCJA 2I1JA 4CHJA 5DIFB 1U5GA 3KY9A 5KQ4A 1MIXA 5EFXA 4MT7A 3FM8C 4KHAA 1XKEA 1EVHA 5J3YA 2RSGA 3WA0A 1U5DA 1P6SA 1ZSQA 2DX5A 1NU2A 5JHGA 1MAIA 1EAZA 1Z87A 5C5BA 4BBKA 2D11A 5FI0A 1X05A 1W1HA 2VRWB 4YONA 4D0NB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DRO A;  2W2W A;  1FOE A;  5DI9 B;  2EC1 A;  1MK7 B;  1DDW A;  2LOX A;  2P8V A;  2KCJ A;  1FGY A;  2P0H A;  1PFJ A;  4C0A A;  1QQG A;  1QC6 A;  5FI1 A;  1U5E A;  2H7E A;  2DKQ A;  2K00 A;  2EJ8 A;  4WJ7 A;  2J0K A;  1RJ2 A;  1V89 A;  3PVL A;  5D3X A;  4CHM A;  1UNP A;  3O96 A;  3AU4 A;  3PEG A;  1BTK A;  2MKR A;  3G9W A;  2CRF A;  2MFQ A;  4HB0 B;  3OAN A;  3RCP A;  2L1C A;  4GMX B;  1XOD A;  2Y7B A;  3U7D A;  5D3V A;  2OTX A;  1J19 A;  1NTY A;  4GN1 A;  2K2U A;  2R09 A;  2QKL A;  2G35 A;  3MDB C;  5D3Y A;  4A6F A;  3DXD A;  1UEF A;  2DLW A;  1IRS A;  2DYN A;  2XQN M;  2Z0O A;  4KVG B;  4XWX A;  3KRW A;  2OQB A;  2JP2 A;  1ISN A;  2Z0P A;  5LOP B;  3PVU A;  2D2Q A;  1KI1 B;  4K2P A;  2D10 A;  4A6K A;  5JLJ B;  2P0F A;  2J0M A;  4WVF B;  4DBB A;  1I2H A;  4IAP A;  1WGQ A;  1U2B A;  3KZ1 A;  2QKM A;  1UPR A;  3P6A A;  2V76 A;  1EF1 A;  2Y8F A;  4F7G A;  2D4Q A;  1BWN A;  4HAX B;  3ZVR A;  2M14 A;  3LJU X;  2D9V A;  3HW2 B;  2I5F A;  1ZC4 B;  4YL8 A;  1FHW A;  2LKO A;  1Y19 B;  3D8F A;  5JP4 A;  2ELB A;  4ZRK A;  2DHJ A;  3CXB B;  1W1G A;  4TKN A;  3ZDT A;  2DX1 A;  1TJ6 A;  1X86 A;  3AJ4 A;  4HAZ B;  4K17 A;  2D9W A;  1U29 A;  3ULB A;  1Q67 A;  3TFM A;  4KHO A;  1I7A A;  1V5M A;  2VSZ A;  1UNQ A;  1FHX A;  1WVH A;  1MIZ B;  2DTC A;  2AL6 A;  2YF0 A;  3ML4 A;  5DHF B;  4HB3 B;  3TW1 A;  5CLQ B;  1WJM A;  4HB4 B;  2W2X C;  2MDX A;  1FGZ A;  1K5G B;  2J0J A;  4WSF A;  2PZ1 A;  4EJN A;  4K2O A;  2GCL A;  2ROV A;  5DH9 B;  4NSW A;  1OMW A;  2I5C A;  3HK0 A;  5KQ1 A;  4HB2 B;  1GC7 A;  5JHH A;  1TXD A;  4Z2M B;  3ODX A;  4GXB A;  4KHB B;  5C79 A;  2RNR B;  1BTN A;  3IVF A;  2N0Y A;  3TCA A;  1NI2 A;  1P3R A;  1GG3 A;  5HE0 A;  3A98 B;  2HE7 A;  1XD4 A;  2K2J A;  2Q13 A;  4A5K A;  2Y8G A;  3BJI A;  3UZT A;  2YSZ A;  1MKE A;  4IOY X;  1X11 A;  3CIK A;  4HAT B;  3BIN A;  2I1K A;  3U8Z A;  4HHV A;  1J0W A;  1E5W A;  1MPH A;  2DYQ A;  4MK0 A;  1DBH A;  2H7D A;  1MK9 B;  4HDO A;  1FB8 A;  2CY5 A;  1X1G A;  2YT0 A;  1U5F A;  2ZPY A;  3F0W A;  2COF A;  1NTV A;  3QBV B;  5C5B B;  1M7E A;  2MWN B;  2GJY A;  3N7C A;  1K5D B;  3SUZ A;  2FJL A;  1XX0 A;  1V88 A;  2COA A;  1WGU A;  3QIJ A;  3WYF B;  3FEH A;  2KUP A;  5J3Q A;  5C16 A;  4GZU A;  3DXC A;  2DA0 A;  1XCG A;  5LON B;  2DFK A;  2LOZ A;  3ODO A;  4B6H A;  2GS0 A;  2X18 A;  2D9X A;  1X1F A;  3SV1 A;  4Y94 A;  2E2X A;  4L6E A;  4HDQ A;  1Y5O A;  2VKI A;  1V5P A;  2CAY A;  2HTH B;  5HE2 A;  1ZM0 A;  4DX9 0;  4NY0 A;  3D8D A;  1PMS A;  3T06 A;  2W2X D;  3F5R A;  1UPQ A;  4KAX B;  1N3H A;  1ZC3 B;  3MPX A;  1FHO A;  3QWM A;  2RGN B;  2ADZ A;  3SYX A;  4ZRJ A;  4HAY B;  1H10 A;  2NZ8 B;  2LYD A;  2D9Y A;  1OQN A;  4IFS A;  4F7H A;  1EGX A;  3KSY A;  4P7I A;  1BAK A;  2NMB A;  4K81 A;  1OY2 A;  4H8S A;  4A6F B;  1DDV A;  5D3W A;  3GYP A;  3P7Z A;  2CY4 A;  3A8Q A;  4PQ0 A;  3V5W A;  1P5T A;  2UZR A;  2YS1 A;  3FSS A;  3X23 A;  5DHA B;  4HAW B;  2YVC A;  2N23 A;  3ULC A;  2D9Z A;  2RLO A;  2YT1 A;  2DKP A;  1LW3 A;  1V5U A;  3PSC A;  2LUL A;  1WI1 A;  2AEH A;  2IFS A;  4DX8 A;  3KRX A;  4PNK A;  1SHC A;  2COD A;  1V61 A;  2DHI A;  2P0D A;  3A8P A;  3PVW A;  1KZG A;  3VOQ A;  4GPT B;  5J3T A;  1RRP B;  4ZRI A;  2IYB A;  1AQC A;  4HAV B;  2COC A;  2M38 A;  2RUK B;  2J59 M;  1PLS A;  2KGX B;  1XR0 B;  3SO6 A;  2EMS A;  2YRY A;  3NSU A;  3PZD A;  3TO1 A;  2YS5 A;  5KCV A;  1AWE A;  2GCJ A;  1WG7 A;  2Z0Q A;  1KZ7 A;  2UZS A;  1U27 A;  5L81 A;  4Z2N A;  1B55 A;  5D27 A;  1ZVR A;  2UVM A;  2DHK A;  4EMO A;  2LG1 A;  2R0D A;  1UNR A;  1DDM A;  3DXE A;  4HAU B;  1LB1 A;  4A6H A;  2DN6 A;  4CYE A;  5C6R A;  3VIA A;  3GYO A;  1GC6 A;  3TVV A;  1H4R A;  4DXA B;  2YS3 A;  1WJ1 A;  3M1I B;  1M7R A;  2ELA A;  1W1D A;  5GOW B;  5CLL B;  3PP2 A;  1SGH A;  4TYZ A;  3PG7 A;  4MY6 A;  1FAO A;  5HE3 A;  1DYN A;  2RVB B;  3AU5 A;  3D8E A;  4EKU A;  3SNH A;  1TQZ A;  5HE1 A;  4F7U P;  2L2I A;  3ODW A;  3HQC A;  2ROZ B;  2EMT A;  4GMV A;  2BCJ A;  2I1J A;  4CHJ A;  5DIF B;  1U5G A;  3KY9 A;  5KQ4 A;  1MIX A;  5EFX A;  4MT7 A;  3FM8 C;  4KHA A;  1XKE A;  1EVH A;  5J3Y A;  2RSG A;  3WA0 A;  1U5D A;  1P6S A;  1ZSQ A;  2DX5 A;  1NU2 A;  5JHG A;  1MAI A;  1EAZ A;  1Z87 A;  5C5B A;  4BBK A;  2D11 A;  5FI0 A;  1X05 A;  1W1H A;  2VRW B;  4YON A;  4D0N B; 
#chains in the Genus database with same CATH topology
 1DRO A;  2W2W A;  1FOE A;  5DI9 B;  2EC1 A;  1MK7 B;  1DDW A;  2LOX A;  2P8V A;  2KCJ A;  1FGY A;  2P0H A;  1PFJ A;  2Z14 A;  4C0A A;  1QQG A;  1QC6 A;  5FI1 A;  1U5E A;  4QJ4 B;  2H7E A;  5I2M A;  2DKQ A;  2K00 A;  2EJ8 A;  4WJ7 A;  2J0K A;  1RJ2 A;  1V89 A;  3PVL A;  5D3X A;  4CHM A;  1UNP A;  3O96 A;  3AU4 A;  3PEG A;  1BTK A;  2MKR A;  3G9W A;  4DIX A;  2CRF A;  2MFQ A;  4HB0 B;  3OAN A;  3RCP A;  2L1C A;  4GMX B;  1XOD A;  2Y7B A;  3U7D A;  5D3V A;  2OTX A;  1J19 A;  1NTY A;  4GN1 A;  2K2U A;  2R09 A;  2QKL A;  2G35 A;  3MDB C;  5D3Y A;  4A6F A;  3DXD A;  1UEF A;  2DLW A;  3HIE A;  4OSN A;  1IRS A;  2DYN A;  2XQN M;  2Z0O A;  4KVG B;  4XWX A;  3KRW A;  2OQB A;  2ZKM X;  2JP2 A;  1ISN A;  2Z0P A;  5LOP B;  3PVU A;  2D2Q A;  1KI1 B;  4K2P A;  2D10 A;  3U12 A;  4A6K A;  5JLJ B;  2P0F A;  2J0M A;  4WVF B;  4DBB A;  1I2H A;  3B77 A;  4IAP A;  1WGQ A;  1U2B A;  3KZ1 A;  2QKM A;  1UPR A;  3P6A A;  2V76 A;  1EF1 A;  2Y8F A;  4F7G A;  2D4Q A;  1BWN A;  4HAX B;  3ZVR A;  2M14 A;  3LJU X;  2D9V A;  3HW2 B;  2I5F A;  1ZC4 B;  4QXA B;  4YL8 A;  1FHW A;  2LKO A;  3NW8 A;  1Y19 B;  3D8F A;  2Z13 A;  5JP4 A;  2ELB A;  4ZRK A;  2DHJ A;  3CXB B;  1W1G A;  4TKN A;  3ZDT A;  2DX1 A;  1TJ6 A;  1X86 A;  3AJ4 A;  4HAZ B;  4K17 A;  2D9W A;  1U29 A;  4QJ5 B;  3ULB A;  1Q67 A;  3TFM A;  4KHO A;  1I7A A;  1V5M A;  2VSZ A;  1UNQ A;  1FHX A;  1WVH A;  4GOU A;  1MIZ B;  2DTC A;  2AL6 A;  2YF0 A;  3ML4 A;  5DHF B;  4HB3 B;  3TW1 A;  5CLQ B;  1WJM A;  4HB4 B;  2W2X C;  2MDX A;  1FGZ A;  1K5G B;  2J0J A;  4WSF A;  2PZ1 A;  4EJN A;  4K2O A;  2GCL A;  2ROV A;  1ZYI A;  5DH9 B;  4NSW A;  1OMW A;  2I5C A;  3HK0 A;  5KQ1 A;  4HB2 B;  1GC7 A;  5JHH A;  1TXD A;  4Z2M B;  3ODX A;  4GXB A;  3NWF A;  4KHB B;  5C79 A;  2RNR B;  1BTN A;  3IVF A;  2N0Y A;  3TCA A;  1NI2 A;  1P3R A;  1GG3 A;  5HE0 A;  3A98 B;  2HE7 A;  1XD4 A;  2K2J A;  2Q13 A;  2KUQ A;  4A5K A;  2Y8G A;  2Z4D A;  3BJI A;  3UZT A;  2YSZ A;  1MKE A;  4IOY X;  1X11 A;  3CIK A;  4HAT B;  3BIN A;  2K49 A;  2I1K A;  3U8Z A;  4HHV A;  2YT2 A;  1J0W A;  1E5W A;  1MPH A;  2DYQ A;  4MK0 A;  2FJU B;  5IRS A;  1DBH A;  2H7D A;  5LG4 B;  1MK9 B;  4HDO A;  1FB8 A;  2CY5 A;  1X1G A;  2YT0 A;  1U5F A;  2ZPY A;  3F0W A;  2COF A;  1NTV A;  2R2Y A;  3QBV B;  5C5B B;  1M7E A;  2MWN B;  2GJY A;  3N7C A;  1K5D B;  3SUZ A;  2FJL A;  1XX0 A;  1V88 A;  2COA A;  1WGU A;  3QIJ A;  3WYF B;  3FEH A;  2KUP A;  5J3Q A;  5C16 A;  4D6W A;  4GZU A;  3DXC A;  2DA0 A;  4KHB A;  1XCG A;  5LON B;  2DFK A;  2LOZ A;  3ODO A;  4L1R A;  4B6H A;  2GS0 A;  2X18 A;  2D9X A;  1X1F A;  3SV1 A;  4Y94 A;  2E2X A;  4L6E A;  4HDQ A;  1Y5O A;  2VKI A;  1V5P A;  2CAY A;  2HTH B;  5HE2 A;  1ZM0 A;  3OHM B;  4DX9 0;  4NY0 A;  3D8D A;  1PMS A;  3T06 A;  2W2X D;  3F5R A;  1UPQ A;  4KAX B;  1N3H A;  3DCX A;  1ZC3 B;  3MPX A;  1FHO A;  3QWM A;  2RGN B;  2ADZ A;  3SYX A;  4ZRJ A;  4HAY B;  1H10 A;  2NZ8 B;  2LYD A;  2D9Y A;  1OQN A;  4IFS A;  4F7H A;  2NBV A;  1EGX A;  3KSY A;  4P7I A;  1BAK A;  2NMB A;  4K81 A;  1OY2 A;  4H8S A;  2KIG A;  4A6F B;  1DDV A;  5D3W A;  3GYP A;  3P7Z A;  2CY4 A;  3A8Q A;  4PQ0 A;  3V5W A;  1P5T A;  2UZR A;  2YS1 A;  3FSS A;  3X23 A;  5DHA B;  4HAW B;  3NWD A;  2YVC A;  2N23 A;  3ULC A;  2D9Z A;  2RLO A;  2YT1 A;  2DKP A;  1LW3 A;  1V5U A;  3PSC A;  2LUL A;  1WI1 A;  2AEH A;  2IFS A;  3FVC A;  4DX8 A;  3KRX A;  1MI1 A;  4PNK A;  1SHC A;  2COD A;  3A58 A;  1V61 A;  2DHI A;  2P0D A;  3A8P A;  3PVW A;  1KZG A;  3VOQ A;  4GPT B;  4OT1 A;  5J3T A;  1RRP B;  4ZRI A;  2Z59 A;  4QJ3 B;  2IYB A;  1AQC A;  4HAV B;  2COC A;  2M38 A;  2RUK B;  2J59 M;  1PLS A;  2KGX B;  1XR0 B;  3SO6 A;  2EMS A;  2YRY A;  3NSU A;  3PZD A;  3TO1 A;  2YS5 A;  5KCV A;  1AWE A;  2GCJ A;  1WG7 A;  2Z0Q A;  1KZ7 A;  2UZS A;  1U27 A;  5L81 A;  1T77 A;  4Z2N A;  1B55 A;  5D27 A;  1ZVR A;  2UVM A;  2DHK A;  4EMO A;  2LG1 A;  2R0D A;  1UNR A;  1DDM A;  4HSI A;  3DXE A;  4HAU B;  1LB1 A;  4A6H A;  2DN6 A;  4CYE A;  5C6R A;  3VIA A;  3GYO A;  1GC6 A;  3TVV A;  1H4R A;  4GNK B;  4DXA B;  2YS3 A;  3NWA A;  1WJ1 A;  3M1I B;  1M7R A;  2ELA A;  1W1D A;  5GOW B;  5CLL B;  3PP2 A;  1SGH A;  3HSA A;  4TYZ A;  3PG7 A;  2RRF A;  4MY6 A;  1FAO A;  5HE3 A;  1DYN A;  2RVB B;  3AU5 A;  3D8E A;  4CSQ A;  4EKU A;  5I2S A;  5M4Y B;  3SNH A;  1TQZ A;  5HE1 A;  4F7U P;  2L2I A;  3ODW A;  3HQC A;  2ROZ B;  2EMT A;  2KIE A;  4GMV A;  2BCJ A;  2I1J A;  4CHJ A;  5DIF B;  1U5G A;  3KY9 A;  5KQ4 A;  1MIX A;  5EFX A;  4MT7 A;  3FM8 C;  4KHA A;  1XKE A;  1EVH A;  5J3Y A;  2RSG A;  3WA0 A;  2K8E A;  2KR0 A;  1U5D A;  1P6S A;  1ZSQ A;  2DX5 A;  1NU2 A;  5JHG A;  1MAI A;  1EAZ A;  1Z87 A;  5C5B A;  2GUM A;  4BBK A;  2D11 A;  5FI0 A;  1X05 A;  1W1H A;  2VRW B;  4YON A;  4D0N B; 
#chains in the Genus database with same CATH homology
 1DRO A;  2W2W A;  1FOE A;  5DI9 B;  2EC1 A;  1MK7 B;  1DDW A;  2LOX A;  2P8V A;  2KCJ A;  1FGY A;  2P0H A;  1PFJ A;  4C0A A;  1QQG A;  1QC6 A;  5FI1 A;  1U5E A;  2H7E A;  2DKQ A;  2K00 A;  2EJ8 A;  4WJ7 A;  2J0K A;  1RJ2 A;  1V89 A;  3PVL A;  5D3X A;  4CHM A;  1UNP A;  3O96 A;  3AU4 A;  3PEG A;  1BTK A;  2MKR A;  3G9W A;  2CRF A;  2MFQ A;  4HB0 B;  3OAN A;  3RCP A;  2L1C A;  4GMX B;  1XOD A;  2Y7B A;  3U7D A;  5D3V A;  2OTX A;  1J19 A;  1NTY A;  4GN1 A;  2K2U A;  2R09 A;  2QKL A;  2G35 A;  3MDB C;  5D3Y A;  4A6F A;  3DXD A;  1UEF A;  2DLW A;  1IRS A;  2DYN A;  2XQN M;  2Z0O A;  4KVG B;  4XWX A;  3KRW A;  2OQB A;  2JP2 A;  1ISN A;  2Z0P A;  5LOP B;  3PVU A;  2D2Q A;  1KI1 B;  4K2P A;  2D10 A;  4A6K A;  5JLJ B;  2P0F A;  2J0M A;  4WVF B;  4DBB A;  1I2H A;  4IAP A;  1WGQ A;  1U2B A;  3KZ1 A;  2QKM A;  1UPR A;  3P6A A;  2V76 A;  1EF1 A;  2Y8F A;  4F7G A;  2D4Q A;  1BWN A;  4HAX B;  3ZVR A;  2M14 A;  3LJU X;  2D9V A;  3HW2 B;  2I5F A;  1ZC4 B;  4YL8 A;  1FHW A;  2LKO A;  1Y19 B;  3D8F A;  5JP4 A;  2ELB A;  4ZRK A;  2DHJ A;  3CXB B;  1W1G A;  4TKN A;  3ZDT A;  2DX1 A;  1TJ6 A;  1X86 A;  3AJ4 A;  4HAZ B;  4K17 A;  2D9W A;  1U29 A;  3ULB A;  1Q67 A;  3TFM A;  4KHO A;  1I7A A;  1V5M A;  2VSZ A;  1UNQ A;  1FHX A;  1WVH A;  1MIZ B;  2DTC A;  2AL6 A;  2YF0 A;  3ML4 A;  5DHF B;  4HB3 B;  3TW1 A;  5CLQ B;  1WJM A;  4HB4 B;  2W2X C;  2MDX A;  1FGZ A;  1K5G B;  2J0J A;  4WSF A;  2PZ1 A;  4EJN A;  4K2O A;  2GCL A;  2ROV A;  5DH9 B;  4NSW A;  1OMW A;  2I5C A;  3HK0 A;  5KQ1 A;  4HB2 B;  1GC7 A;  5JHH A;  1TXD A;  4Z2M B;  3ODX A;  4GXB A;  4KHB B;  5C79 A;  2RNR B;  1BTN A;  3IVF A;  2N0Y A;  3TCA A;  1NI2 A;  1P3R A;  1GG3 A;  5HE0 A;  3A98 B;  2HE7 A;  1XD4 A;  2K2J A;  2Q13 A;  4A5K A;  2Y8G A;  3BJI A;  3UZT A;  2YSZ A;  1MKE A;  4IOY X;  1X11 A;  3CIK A;  4HAT B;  3BIN A;  2I1K A;  3U8Z A;  4HHV A;  1J0W A;  1E5W A;  1MPH A;  2DYQ A;  4MK0 A;  1DBH A;  2H7D A;  1MK9 B;  4HDO A;  1FB8 A;  2CY5 A;  1X1G A;  2YT0 A;  1U5F A;  2ZPY A;  3F0W A;  2COF A;  1NTV A;  3QBV B;  5C5B B;  1M7E A;  2MWN B;  2GJY A;  3N7C A;  1K5D B;  3SUZ A;  2FJL A;  1XX0 A;  1V88 A;  2COA A;  1WGU A;  3QIJ A;  3WYF B;  3FEH A;  2KUP A;  5J3Q A;  5C16 A;  4GZU A;  3DXC A;  2DA0 A;  1XCG A;  5LON B;  2DFK A;  2LOZ A;  3ODO A;  4B6H A;  2GS0 A;  2X18 A;  2D9X A;  1X1F A;  3SV1 A;  4Y94 A;  2E2X A;  4L6E A;  4HDQ A;  1Y5O A;  2VKI A;  1V5P A;  2CAY A;  2HTH B;  5HE2 A;  1ZM0 A;  4DX9 0;  4NY0 A;  3D8D A;  1PMS A;  3T06 A;  2W2X D;  3F5R A;  1UPQ A;  4KAX B;  1N3H A;  1ZC3 B;  3MPX A;  1FHO A;  3QWM A;  2RGN B;  2ADZ A;  3SYX A;  4ZRJ A;  4HAY B;  1H10 A;  2NZ8 B;  2LYD A;  2D9Y A;  1OQN A;  4IFS A;  4F7H A;  1EGX A;  3KSY A;  4P7I A;  1BAK A;  2NMB A;  4K81 A;  1OY2 A;  4H8S A;  4A6F B;  1DDV A;  5D3W A;  3GYP A;  3P7Z A;  2CY4 A;  3A8Q A;  4PQ0 A;  3V5W A;  1P5T A;  2UZR A;  2YS1 A;  3FSS A;  3X23 A;  5DHA B;  4HAW B;  2YVC A;  2N23 A;  3ULC A;  2D9Z A;  2RLO A;  2YT1 A;  2DKP A;  1LW3 A;  1V5U A;  3PSC A;  2LUL A;  1WI1 A;  2AEH A;  2IFS A;  4DX8 A;  3KRX A;  4PNK A;  1SHC A;  2COD A;  1V61 A;  2DHI A;  2P0D A;  3A8P A;  3PVW A;  1KZG A;  3VOQ A;  4GPT B;  5J3T A;  1RRP B;  4ZRI A;  2IYB A;  1AQC A;  4HAV B;  2COC A;  2M38 A;  2RUK B;  2J59 M;  1PLS A;  2KGX B;  1XR0 B;  3SO6 A;  2EMS A;  2YRY A;  3NSU A;  3PZD A;  3TO1 A;  2YS5 A;  5KCV A;  1AWE A;  2GCJ A;  1WG7 A;  2Z0Q A;  1KZ7 A;  2UZS A;  1U27 A;  5L81 A;  4Z2N A;  1B55 A;  5D27 A;  1ZVR A;  2UVM A;  2DHK A;  4EMO A;  2LG1 A;  2R0D A;  1UNR A;  1DDM A;  3DXE A;  4HAU B;  1LB1 A;  4A6H A;  2DN6 A;  4CYE A;  5C6R A;  3VIA A;  3GYO A;  1GC6 A;  3TVV A;  1H4R A;  4DXA B;  2YS3 A;  1WJ1 A;  3M1I B;  1M7R A;  2ELA A;  1W1D A;  5GOW B;  5CLL B;  3PP2 A;  1SGH A;  4TYZ A;  3PG7 A;  4MY6 A;  1FAO A;  5HE3 A;  1DYN A;  2RVB B;  3AU5 A;  3D8E A;  4EKU A;  3SNH A;  1TQZ A;  5HE1 A;  4F7U P;  2L2I A;  3ODW A;  3HQC A;  2ROZ B;  2EMT A;  4GMV A;  2BCJ A;  2I1J A;  4CHJ A;  5DIF B;  1U5G A;  3KY9 A;  5KQ4 A;  1MIX A;  5EFX A;  4MT7 A;  3FM8 C;  4KHA A;  1XKE A;  1EVH A;  5J3Y A;  2RSG A;  3WA0 A;  1U5D A;  1P6S A;  1ZSQ A;  2DX5 A;  1NU2 A;  5JHG A;  1MAI A;  1EAZ A;  1Z87 A;  5C5B A;  4BBK A;  2D11 A;  5FI0 A;  1X05 A;  1W1H A;  2VRW B;  4YON A;  4D0N B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...