1OQNA

Crystal structure of the phosphotyrosine binding domain (ptb) of mouse disabled 1 (dab1)
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
150
structure length
150
Chain Sequence
RSEATLIKRFKGEGVRYKAKLIGIDEVSAARGDKLCQDSMMKLKGVVAGARSKGEHKQKIFLTISFGGIKIFDEKTGALQHHHAVHEISYIAKDITDHRAFGYVCGKEGNHRFVAIKTAQAAEPVILDLRDLFQLIYELKQREELEKKAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Disabled homolog 1
publication title Crystal structures of the Dab homology domains of mouse disabled 1 and 2
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
total genus 47
structure length 150
sequence length 150
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00640 PID Phosphotyrosine interaction domain (PTB/PID)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1oqnA00
2HTHB 3DXEA 1W1DA 4TKNA 1U2BA 1OQNA 1FB8A 2RGNB 4HATB 2VRWB 4HAVB 4IOYX 4YL8A 2DFKA 1H4RA 2NMBA 3PVUA 2KGXB 4EJNA 1FHWA 1BTNA 2MFQA 3D8EA 3GYOA 4HB4B 4GPTB 4A6HA 2J0MA 2D9VA 4HAWB 4DXAB 2LKOA 3TCAA 3A98B 4B6HA 3TW1A 4HB3B 3LJUX 1M7RA 1UPRA 4CYEA 2D10A 1KZ7A 2YS1A 2LOZA 2K00A 1XD4A 1GC6A 2RNRB 4XWXA 4KHAA 2VSZA 3NSUA 4MY6A 3BJIA 3HW2B 1NTVA 3WA0A 2DN6A 3PSCA 1EVHA 3AJ4A 4YONA 2LULA 1MAIA 5CLLB 3PG7A 2OQBA 5J3QA 1FGZA 3DXCA 2I1KA 4NSWA 5DI9B 2Q13A 3ML4A 2IYBA 2XQNM 5DH9B 3AU4A 3HQCA 3PEGA 2VKIA 3QWMA 4Z2MB 1V5PA 3VIAA 5HE1A 3SNHA 2MKRA 1ZC4B 4K2PA 1GG3A 3M1IB 1DYNA 3P7ZA 1J19A 3F5RA 2W2XC 5FI1A 1I2HA 2AEHA 3ODWA 4K17A 2Y8FA 2P0HA 4EKUA 1U27A 1UNQA 3TVVA 3FM8C 2DYNA 1NTYA 3QBVB 1QQGA 5C16A 1B55A 4GXBA 5C6RA 1UEFA 2NZ8B 1PLSA 1XODA 1BAKA 4KHBB 1EAZA 1AQCA 2UVMA 4D0NB 4HAUB 1V5MA 1UNPA 2DLWA 2E2XA 2COAA 4Y94A 5D3WA 2DHKA 2D9YA 2ROZB 1AWEA 1ZSQA 2ZPYA 5C5BB 4ZRKA 1I7AA 1XKEA 1Y19B 4WSFA 1U5DA 3OANA 3VOQA 1X1GA 4L6EA 2YT1A 5KQ1A 1P5TA 5LOPB 2YVCA 4HAZB 1NI2A 2DKPA 5DHAB 3G9WA 4HHVA 3AU5A 2D2QA 2X18A 5D3YA 3F0WA 2J0KA 4GZUA 1E5WA 2AL6A 5LONB 1MPHA 2COFA 1PMSA 4A5KA 2M14A 1ZC3B 4ZRIA 1X86A 4CHJA 2DYQA 2UZSA 1X05A 2D4QA 2RUKB 1WGUA 2ELBA 1WJ1A 2N0YA 2P8VA 2BCJA 3ZVRA 2YSZA 2R09A 5C79A 3KRXA 2D11A 4EMOA 1ZM0A 1DBHA 2UZRA 2P0DA 2MDXA 3TFMA 2EC1A 1DDVA 4HAYB 3T06A 1WJMA 5HE0A 3KRWA 1TQZA 1SHCA 3KZ1A 2OTXA 1TXDA 1EGXA 2QKMA 2JP2A 3U8ZA 4P7IA 2W2WA 2Z0OA 1EF1A 1MKEA 4BBKA 1DDWA 1MK9B 1LW3A 4KVGB 2EMTA 2N23A 2Y7BA 1OY2A 2D9XA 4KAXB 4A6FA 4F7HA 3BINA 1WVHA 2Z0PA 5CLQB 4ZRJA 4DX8A 1X11A 4GN1A 3UZTA 1FHOA 5D3VA 1V61A 3GYPA 3MPXA 1U5EA 1QC6A 3ULCA 5DHFB 4CHMA 2HE7A 2DHJA 5HE3A 5DIFB 2H7EA 3CIKA 2ELAA 3MDBC 1P3RA 1J0WA 1K5GB 2GCLA 4GMVA 2MWNB 2GCJA 4DBBA 2CY5A 2I5CA 4PQ0A 1FGYA 2EJ8A 2DX5A 1BTKA 4PNKA 1UPQA 4MK0A 1H10A 5FI0A 3TO1A 2DKQA 2V76A 2CRFA 1XR0B 4NY0A 1Y5OA 3PP2A 5GOWB 2CY4A 4K2OA 2ROVA 2I5FA 2Y8GA 1DDMA 3O96A 1BWNA 2YF0A 3IVFA 1U5GA 1XX0A 4F7UP 1MK7B 2ADZA 2P0FA 1NU2A 4HB0B 4DX90 3PVWA 2KCJA 1Z87A 2DA0A 2YS5A 1FHXA 1LB1A 2YRYA 2W2XD 1GC7A 1W1GA 1OMWA 1V89A 4MT7A 3X23A 1ISNA 1UNRA 4K81A 4TYZA 3ZDTA 2RLOA 5KCVA 3DXDA 2K2JA 2R0DA 2LOXA 3D8DA 3FSSA 1P6SA 4HB2B 1FOEA 5EFXA 1K5DB 3SO6A 3ODXA 2GS0A 2RSGA 3HK0A 1PFJA 3QIJA 2LYDA 5KQ4A 5JHHA 2I1JA 3FEHA 5J3TA 1MIZB 2H7DA 5L81A 2M38A 1N3HA 3SYXA 1U5FA 4C0AA 2YT0A 1RRPB 2QKLA 1WGQA 2CODA 4H8SA 2L1CA 4HDQA 4Z2NA 4WJ7A 4IFSA 2EMSA 3KSYA 2IFSA 4WVFB 3SV1A 2DTCA 3A8PA 1V5UA 1WI1A 2LG1A 5JHGA 3P6AA 2GJYA 4GMXB 2PZ1A 2K2UA 3V5WA 3PZDA 1U29A 2FJLA 5JP4A 4KHOA 1ZVRA 4IAPA 2DX1A 2Z0QA 5D3XA 1WG7A 1KZGA 1FAOA 3WYFB 2J59M 1TJ6A 4HDOA 3ULBA 2D9ZA 1KI1B 4F7GA 1RJ2A 3RCPA 3D8FA 3U7DA 4A6KA 2J0JA 2YS3A 5JLJB 5HE2A 3N7CA 4A6FB 1M7EA 2KUPA 3A8QA 5C5BA 1DROA 4HAXB 1SGHA 2DHIA 2CAYA 2RVBB 1W1HA 2G35A 5J3YA 2D9WA 3ODOA 2COCA 1X1FA 3KY9A 3SUZA 1IRSA 1XCGA 1Q67A 3CXBB 3PVLA 2L2IA 1MIXA 1V88A 5D27A
chains in the Genus database with same CATH superfamily
2KR0A 2HTHB 3DXEA 1W1DA 4TKNA 1U2BA 1OQNA 1FB8A 2RGNB 4HATB 2VRWB 4HAVB 4OSNA 4IOYX 4YL8A 2DFKA 1H4RA 2NMBA 3PVUA 2KGXB 4EJNA 1FHWA 1BTNA 2MFQA 3D8EA 5I2SA 3GYOA 4HB4B 4GPTB 4A6HA 2J0MA 2D9VA 4HAWB 4DXAB 2LKOA 3TCAA 3A98B 4B6HA 3TW1A 3FVCA 4HB3B 3LJUX 2K8EA 1M7RA 1UPRA 3NWAA 4CYEA 2D10A 1KZ7A 2YS1A 1MI1A 2LOZA 2K00A 1XD4A 1GC6A 2RNRB 4XWXA 4KHAA 4D6WA 2VSZA 4OT1A 3NSUA 4MY6A 3BJIA 3HW2B 1NTVA 3WA0A 2DN6A 3PSCA 1EVHA 3AJ4A 4YONA 2LULA 1MAIA 5CLLB 3PG7A 2OQBA 5J3QA 1FGZA 3DXCA 2I1KA 4NSWA 5DI9B 2Q13A 3ML4A 2IYBA 2XQNM 2KIGA 2KUQA 5DH9B 3AU4A 3HQCA 3PEGA 2VKIA 3QWMA 4Z2MB 1V5PA 3VIAA 5HE1A 3SNHA 2MKRA 2NBVA 1ZC4B 3DCXA 4K2PA 1GG3A 3M1IB 1DYNA 3P7ZA 1J19A 2Z14A 3F5RA 2W2XC 5FI1A 1I2HA 2AEHA 5I2MA 3ODWA 4K17A 2Y8FA 2P0HA 4EKUA 1U27A 1UNQA 3TVVA 3FM8C 2DYNA 1NTYA 3QBVB 1QQGA 5C16A 1B55A 4GXBA 5C6RA 1UEFA 2NZ8B 1PLSA 1XODA 1BAKA 4KHBB 1EAZA 1AQCA 2UVMA 4D0NB 4HAUB 1V5MA 1UNPA 2DLWA 2E2XA 2COAA 4Y94A 3U12A 5D3WA 2DHKA 2D9YA 2ROZB 1AWEA 1ZSQA 2ZPYA 5C5BB 4ZRKA 1I7AA 4QJ4B 1XKEA 1Y19B 4WSFA 1U5DA 2FJUB 3OANA 3VOQA 1X1GA 4L6EA 2YT1A 5KQ1A 1P5TA 5LOPB 2YVCA 4HAZB 1NI2A 2DKPA 5DHAB 3G9WA 4HHVA 3AU5A 2D2QA 2X18A 5D3YA 3F0WA 2J0KA 4GZUA 1E5WA 2AL6A 5LONB 1MPHA 2COFA 1PMSA 4A5KA 2M14A 4QJ5B 1ZC3B 4ZRIA 1X86A 4CHJA 2DYQA 2UZSA 1X05A 2D4QA 2RUKB 1WGUA 2ELBA 1WJ1A 2N0YA 2P8VA 2BCJA 3ZVRA 2YSZA 2R09A 5C79A 3KRXA 2D11A 4DIXA 4EMOA 1ZM0A 1DBHA 2UZRA 2P0DA 2MDXA 3TFMA 2EC1A 1DDVA 2Z13A 4HAYB 3T06A 1WJMA 5HE0A 2R2YA 3KRWA 1TQZA 1SHCA 4GNKB 3KZ1A 2OTXA 1TXDA 1EGXA 2QKMA 2JP2A 3U8ZA 4P7IA 2W2WA 2Z0OA 1EF1A 1MKEA 4BBKA 1DDWA 1MK9B 1LW3A 4KVGB 2EMTA 2N23A 2Y7BA 1OY2A 2D9XA 4KAXB 4A6FA 4CSQA 3BINA 4F7HA 1WVHA 2Z0PA 5CLQB 4ZRJA 4DX8A 1X11A 4GN1A 3UZTA 3NWFA 4L1RA 5D3VA 1FHOA 5IRSA 2Z4DA 1V61A 3GYPA 3MPXA 1U5EA 1QC6A 3ULCA 5DHFB 4CHMA 2HE7A 2DHJA 4KHBA 5HE3A 5DIFB 2H7EA 2YT2A 3CIKA 2ELAA 3HSAA 3MDBC 1P3RA 1J0WA 1K5GB 2GCLA 4GMVA 2MWNB 2GCJA 4DBBA 2CY5A 2I5CA 2K49A 4QXAB 4PQ0A 1FGYA 2EJ8A 2DX5A 1BTKA 4PNKA 1UPQA 4MK0A 1H10A 5FI0A 3TO1A 2DKQA 2V76A 2CRFA 1XR0B 4NY0A 1Y5OA 3PP2A 5GOWB 2CY4A 4K2OA 2ROVA 2I5FA 2Y8GA 1DDMA 3O96A 1BWNA 2YF0A 3IVFA 1U5GA 1T77A 1XX0A 4F7UP 1MK7B 2ADZA 3NW8A 2P0FA 1NU2A 4HB0B 4DX90 3PVWA 2KCJA 1Z87A 2DA0A 2YS5A 1FHXA 1LB1A 2YRYA 2W2XD 3NWDA 1GC7A 1ZYIA 1W1GA 1OMWA 1V89A 4MT7A 3X23A 1ISNA 1UNRA 4K81A 4TYZA 3ZDTA 4GOUA 3OHMB 2RLOA 5KCVA 2ZKMX 3DXDA 2K2JA 2R0DA 2LOXA 3D8DA 3FSSA 1P6SA 4HSIA 4HB2B 1FOEA 5EFXA 1K5DB 3SO6A 3ODXA 2GS0A 2RSGA 3HK0A 1PFJA 3QIJA 2LYDA 5KQ4A 5JHHA 5LG4B 2I1JA 3FEHA 5J3TA 1MIZB 2H7DA 5L81A 2KIEA 2M38A 1N3HA 3SYXA 3HIEA 1U5FA 4C0AA 2YT0A 1RRPB 2QKLA 1WGQA 2CODA 4H8SA 2L1CA 4HDQA 4Z2NA 4WJ7A 4IFSA 2EMSA 5M4YB 3KSYA 2IFSA 4WVFB 3SV1A 2DTCA 3A8PA 1V5UA 1WI1A 2LG1A 3B77A 5JHGA 3P6AA 2GJYA 4GMXB 2PZ1A 2K2UA 3V5WA 3PZDA 1U29A 2FJLA 5JP4A 4KHOA 1ZVRA 4IAPA 2DX1A 2Z0QA 5D3XA 1WG7A 1KZGA 1FAOA 3WYFB 2J59M 1TJ6A 4HDOA 3ULBA 2D9ZA 1KI1B 4F7GA 1RJ2A 3RCPA 3D8FA 3U7DA 4A6KA 2J0JA 2YS3A 5JLJB 5HE2A 3N7CA 4A6FB 1M7EA 2KUPA 3A8QA 5C5BA 1DROA 2Z59A 4HAXB 1SGHA 2DHIA 2CAYA 2RRFA 2RVBB 1W1HA 2G35A 5J3YA 2GUMA 2D9WA 3A58A 3ODOA 2COCA 1X1FA 3KY9A 3SUZA 1IRSA 1XCGA 1Q67A 3CXBB 3PVLA 2L2IA 1MIXA 1V88A 5D27A 4QJ3B
chains in the Genus database with same CATH topology
2HTHB 3DXEA 1W1DA 4TKNA 1U2BA 1OQNA 1FB8A 2RGNB 4HATB 2VRWB 4HAVB 4IOYX 4YL8A 2DFKA 1H4RA 2NMBA 3PVUA 2KGXB 4EJNA 1FHWA 1BTNA 2MFQA 3D8EA 3GYOA 4HB4B 4GPTB 4A6HA 2J0MA 2D9VA 4HAWB 4DXAB 2LKOA 3TCAA 3A98B 4B6HA 3TW1A 4HB3B 3LJUX 1M7RA 1UPRA 4CYEA 2D10A 1KZ7A 2YS1A 2LOZA 2K00A 1XD4A 1GC6A 2RNRB 4XWXA 4KHAA 2VSZA 3NSUA 4MY6A 3BJIA 3HW2B 1NTVA 3WA0A 2DN6A 3PSCA 1EVHA 3AJ4A 4YONA 2LULA 1MAIA 5CLLB 3PG7A 2OQBA 5J3QA 1FGZA 3DXCA 2I1KA 4NSWA 5DI9B 2Q13A 3ML4A 2IYBA 2XQNM 5DH9B 3AU4A 3HQCA 3PEGA 2VKIA 3QWMA 4Z2MB 1V5PA 3VIAA 5HE1A 3SNHA 2MKRA 1ZC4B 4K2PA 1GG3A 3M1IB 1DYNA 3P7ZA 1J19A 3F5RA 2W2XC 5FI1A 1I2HA 2AEHA 3ODWA 4K17A 2Y8FA 2P0HA 4EKUA 1U27A 1UNQA 3TVVA 3FM8C 2DYNA 1NTYA 3QBVB 1QQGA 5C16A 1B55A 4GXBA 5C6RA 1UEFA 2NZ8B 1PLSA 1XODA 1BAKA 4KHBB 1EAZA 1AQCA 2UVMA 4D0NB 4HAUB 1V5MA 1UNPA 2DLWA 2E2XA 2COAA 4Y94A 5D3WA 2DHKA 2D9YA 2ROZB 1AWEA 1ZSQA 2ZPYA 5C5BB 4ZRKA 1I7AA 1XKEA 1Y19B 4WSFA 1U5DA 3OANA 3VOQA 1X1GA 4L6EA 2YT1A 5KQ1A 1P5TA 5LOPB 2YVCA 4HAZB 1NI2A 2DKPA 5DHAB 3G9WA 4HHVA 3AU5A 2D2QA 2X18A 5D3YA 3F0WA 2J0KA 4GZUA 1E5WA 2AL6A 5LONB 1MPHA 2COFA 1PMSA 4A5KA 2M14A 1ZC3B 4ZRIA 1X86A 4CHJA 2DYQA 2UZSA 1X05A 2D4QA 2RUKB 1WGUA 2ELBA 1WJ1A 2N0YA 2P8VA 2BCJA 3ZVRA 2YSZA 2R09A 5C79A 3KRXA 2D11A 4EMOA 1ZM0A 1DBHA 2UZRA 2P0DA 2MDXA 3TFMA 2EC1A 1DDVA 4HAYB 3T06A 1WJMA 5HE0A 3KRWA 1TQZA 1SHCA 3KZ1A 2OTXA 1TXDA 1EGXA 2QKMA 2JP2A 3U8ZA 4P7IA 2W2WA 2Z0OA 1EF1A 1MKEA 4BBKA 1DDWA 1MK9B 1LW3A 4KVGB 2EMTA 2N23A 2Y7BA 1OY2A 2D9XA 4KAXB 4A6FA 4F7HA 3BINA 1WVHA 2Z0PA 5CLQB 4ZRJA 4DX8A 1X11A 4GN1A 3UZTA 1FHOA 5D3VA 1V61A 3GYPA 3MPXA 1U5EA 1QC6A 3ULCA 5DHFB 4CHMA 2HE7A 2DHJA 5HE3A 5DIFB 2H7EA 3CIKA 2ELAA 3MDBC 1P3RA 1J0WA 1K5GB 2GCLA 4GMVA 2MWNB 2GCJA 4DBBA 2CY5A 2I5CA 4PQ0A 1FGYA 2EJ8A 2DX5A 1BTKA 4PNKA 1UPQA 4MK0A 1H10A 5FI0A 3TO1A 2DKQA 2V76A 2CRFA 1XR0B 4NY0A 1Y5OA 3PP2A 5GOWB 2CY4A 4K2OA 2ROVA 2I5FA 2Y8GA 1DDMA 3O96A 1BWNA 2YF0A 3IVFA 1U5GA 1XX0A 4F7UP 1MK7B 2ADZA 2P0FA 1NU2A 4HB0B 4DX90 3PVWA 2KCJA 1Z87A 2DA0A 2YS5A 1FHXA 1LB1A 2YRYA 2W2XD 1GC7A 1W1GA 1OMWA 1V89A 4MT7A 3X23A 1ISNA 1UNRA 4K81A 4TYZA 3ZDTA 2RLOA 5KCVA 3DXDA 2K2JA 2R0DA 2LOXA 3D8DA 3FSSA 1P6SA 4HB2B 1FOEA 5EFXA 1K5DB 3SO6A 3ODXA 2GS0A 2RSGA 3HK0A 1PFJA 3QIJA 2LYDA 5KQ4A 5JHHA 2I1JA 3FEHA 5J3TA 1MIZB 2H7DA 5L81A 2M38A 1N3HA 3SYXA 1U5FA 4C0AA 2YT0A 1RRPB 2QKLA 1WGQA 2CODA 4H8SA 2L1CA 4HDQA 4Z2NA 4WJ7A 4IFSA 2EMSA 3KSYA 2IFSA 4WVFB 3SV1A 2DTCA 3A8PA 1V5UA 1WI1A 2LG1A 5JHGA 3P6AA 2GJYA 4GMXB 2PZ1A 2K2UA 3V5WA 3PZDA 1U29A 2FJLA 5JP4A 4KHOA 1ZVRA 4IAPA 2DX1A 2Z0QA 5D3XA 1WG7A 1KZGA 1FAOA 3WYFB 2J59M 1TJ6A 4HDOA 3ULBA 2D9ZA 1KI1B 4F7GA 1RJ2A 3RCPA 3D8FA 3U7DA 4A6KA 2J0JA 2YS3A 5JLJB 5HE2A 3N7CA 4A6FB 1M7EA 2KUPA 3A8QA 5C5BA 1DROA 4HAXB 1SGHA 2DHIA 2CAYA 2RVBB 1W1HA 2G35A 5J3YA 2D9WA 3ODOA 2COCA 1X1FA 3KY9A 3SUZA 1IRSA 1XCGA 1Q67A 3CXBB 3PVLA 2L2IA 1MIXA 1V88A 5D27A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HTH B;  3DXE A;  1W1D A;  4TKN A;  1U2B A;  1OQN A;  1FB8 A;  2RGN B;  4HAT B;  2VRW B;  4HAV B;  4IOY X;  4YL8 A;  2DFK A;  1H4R A;  2NMB A;  3PVU A;  2KGX B;  4EJN A;  1FHW A;  1BTN A;  2MFQ A;  3D8E A;  3GYO A;  4HB4 B;  4GPT B;  4A6H A;  2J0M A;  2D9V A;  4HAW B;  4DXA B;  2LKO A;  3TCA A;  3A98 B;  4B6H A;  3TW1 A;  4HB3 B;  3LJU X;  1M7R A;  1UPR A;  4CYE A;  2D10 A;  1KZ7 A;  2YS1 A;  2LOZ A;  2K00 A;  1XD4 A;  1GC6 A;  2RNR B;  4XWX A;  4KHA A;  2VSZ A;  3NSU A;  4MY6 A;  3BJI A;  3HW2 B;  1NTV A;  3WA0 A;  2DN6 A;  3PSC A;  1EVH A;  3AJ4 A;  4YON A;  2LUL A;  1MAI A;  5CLL B;  3PG7 A;  2OQB A;  5J3Q A;  1FGZ A;  3DXC A;  2I1K A;  4NSW A;  5DI9 B;  2Q13 A;  3ML4 A;  2IYB A;  2XQN M;  5DH9 B;  3AU4 A;  3HQC A;  3PEG A;  2VKI A;  3QWM A;  4Z2M B;  1V5P A;  3VIA A;  5HE1 A;  3SNH A;  2MKR A;  1ZC4 B;  4K2P A;  1GG3 A;  3M1I B;  1DYN A;  3P7Z A;  1J19 A;  3F5R A;  2W2X C;  5FI1 A;  1I2H A;  2AEH A;  3ODW A;  4K17 A;  2Y8F A;  2P0H A;  4EKU A;  1U27 A;  1UNQ A;  3TVV A;  3FM8 C;  2DYN A;  1NTY A;  3QBV B;  1QQG A;  5C16 A;  1B55 A;  4GXB A;  5C6R A;  1UEF A;  2NZ8 B;  1PLS A;  1XOD A;  1BAK A;  4KHB B;  1EAZ A;  1AQC A;  2UVM A;  4D0N B;  4HAU B;  1V5M A;  1UNP A;  2DLW A;  2E2X A;  2COA A;  4Y94 A;  5D3W A;  2DHK A;  2D9Y A;  2ROZ B;  1AWE A;  1ZSQ A;  2ZPY A;  5C5B B;  4ZRK A;  1I7A A;  1XKE A;  1Y19 B;  4WSF A;  1U5D A;  3OAN A;  3VOQ A;  1X1G A;  4L6E A;  2YT1 A;  5KQ1 A;  1P5T A;  5LOP B;  2YVC A;  4HAZ B;  1NI2 A;  2DKP A;  5DHA B;  3G9W A;  4HHV A;  3AU5 A;  2D2Q A;  2X18 A;  5D3Y A;  3F0W A;  2J0K A;  4GZU A;  1E5W A;  2AL6 A;  5LON B;  1MPH A;  2COF A;  1PMS A;  4A5K A;  2M14 A;  1ZC3 B;  4ZRI A;  1X86 A;  4CHJ A;  2DYQ A;  2UZS A;  1X05 A;  2D4Q A;  2RUK B;  1WGU A;  2ELB A;  1WJ1 A;  2N0Y A;  2P8V A;  2BCJ A;  3ZVR A;  2YSZ A;  2R09 A;  5C79 A;  3KRX A;  2D11 A;  4EMO A;  1ZM0 A;  1DBH A;  2UZR A;  2P0D A;  2MDX A;  3TFM A;  2EC1 A;  1DDV A;  4HAY B;  3T06 A;  1WJM A;  5HE0 A;  3KRW A;  1TQZ A;  1SHC A;  3KZ1 A;  2OTX A;  1TXD A;  1EGX A;  2QKM A;  2JP2 A;  3U8Z A;  4P7I A;  2W2W A;  2Z0O A;  1EF1 A;  1MKE A;  4BBK A;  1DDW A;  1MK9 B;  1LW3 A;  4KVG B;  2EMT A;  2N23 A;  2Y7B A;  1OY2 A;  2D9X A;  4KAX B;  4A6F A;  4F7H A;  3BIN A;  1WVH A;  2Z0P A;  5CLQ B;  4ZRJ A;  4DX8 A;  1X11 A;  4GN1 A;  3UZT A;  1FHO A;  5D3V A;  1V61 A;  3GYP A;  3MPX A;  1U5E A;  1QC6 A;  3ULC A;  5DHF B;  4CHM A;  2HE7 A;  2DHJ A;  5HE3 A;  5DIF B;  2H7E A;  3CIK A;  2ELA A;  3MDB C;  1P3R A;  1J0W A;  1K5G B;  2GCL A;  4GMV A;  2MWN B;  2GCJ A;  4DBB A;  2CY5 A;  2I5C A;  4PQ0 A;  1FGY A;  2EJ8 A;  2DX5 A;  1BTK A;  4PNK A;  1UPQ A;  4MK0 A;  1H10 A;  5FI0 A;  3TO1 A;  2DKQ A;  2V76 A;  2CRF A;  1XR0 B;  4NY0 A;  1Y5O A;  3PP2 A;  5GOW B;  2CY4 A;  4K2O A;  2ROV A;  2I5F A;  2Y8G A;  1DDM A;  3O96 A;  1BWN A;  2YF0 A;  3IVF A;  1U5G A;  1XX0 A;  4F7U P;  1MK7 B;  2ADZ A;  2P0F A;  1NU2 A;  4HB0 B;  4DX9 0;  3PVW A;  2KCJ A;  1Z87 A;  2DA0 A;  2YS5 A;  1FHX A;  1LB1 A;  2YRY A;  2W2X D;  1GC7 A;  1W1G A;  1OMW A;  1V89 A;  4MT7 A;  3X23 A;  1ISN A;  1UNR A;  4K81 A;  4TYZ A;  3ZDT A;  2RLO A;  5KCV A;  3DXD A;  2K2J A;  2R0D A;  2LOX A;  3D8D A;  3FSS A;  1P6S A;  4HB2 B;  1FOE A;  5EFX A;  1K5D B;  3SO6 A;  3ODX A;  2GS0 A;  2RSG A;  3HK0 A;  1PFJ A;  3QIJ A;  2LYD A;  5KQ4 A;  5JHH A;  2I1J A;  3FEH A;  5J3T A;  1MIZ B;  2H7D A;  5L81 A;  2M38 A;  1N3H A;  3SYX A;  1U5F A;  4C0A A;  2YT0 A;  1RRP B;  2QKL A;  1WGQ A;  2COD A;  4H8S A;  2L1C A;  4HDQ A;  4Z2N A;  4WJ7 A;  4IFS A;  2EMS A;  3KSY A;  2IFS A;  4WVF B;  3SV1 A;  2DTC A;  3A8P A;  1V5U A;  1WI1 A;  2LG1 A;  5JHG A;  3P6A A;  2GJY A;  4GMX B;  2PZ1 A;  2K2U A;  3V5W A;  3PZD A;  1U29 A;  2FJL A;  5JP4 A;  4KHO A;  1ZVR A;  4IAP A;  2DX1 A;  2Z0Q A;  5D3X A;  1WG7 A;  1KZG A;  1FAO A;  3WYF B;  2J59 M;  1TJ6 A;  4HDO A;  3ULB A;  2D9Z A;  1KI1 B;  4F7G A;  1RJ2 A;  3RCP A;  3D8F A;  3U7D A;  4A6K A;  2J0J A;  2YS3 A;  5JLJ B;  5HE2 A;  3N7C A;  4A6F B;  1M7E A;  2KUP A;  3A8Q A;  5C5B A;  1DRO A;  4HAX B;  1SGH A;  2DHI A;  2CAY A;  2RVB B;  1W1H A;  2G35 A;  5J3Y A;  2D9W A;  3ODO A;  2COC A;  1X1F A;  3KY9 A;  3SUZ A;  1IRS A;  1XCG A;  1Q67 A;  3CXB B;  3PVL A;  2L2I A;  1MIX A;  1V88 A;  5D27 A; 
#chains in the Genus database with same CATH topology
 2KR0 A;  2HTH B;  3DXE A;  1W1D A;  4TKN A;  1U2B A;  1OQN A;  1FB8 A;  2RGN B;  4HAT B;  2VRW B;  4HAV B;  4OSN A;  4IOY X;  4YL8 A;  2DFK A;  1H4R A;  2NMB A;  3PVU A;  2KGX B;  4EJN A;  1FHW A;  1BTN A;  2MFQ A;  3D8E A;  5I2S A;  3GYO A;  4HB4 B;  4GPT B;  4A6H A;  2J0M A;  2D9V A;  4HAW B;  4DXA B;  2LKO A;  3TCA A;  3A98 B;  4B6H A;  3TW1 A;  3FVC A;  4HB3 B;  3LJU X;  2K8E A;  1M7R A;  1UPR A;  3NWA A;  4CYE A;  2D10 A;  1KZ7 A;  2YS1 A;  1MI1 A;  2LOZ A;  2K00 A;  1XD4 A;  1GC6 A;  2RNR B;  4XWX A;  4KHA A;  4D6W A;  2VSZ A;  4OT1 A;  3NSU A;  4MY6 A;  3BJI A;  3HW2 B;  1NTV A;  3WA0 A;  2DN6 A;  3PSC A;  1EVH A;  3AJ4 A;  4YON A;  2LUL A;  1MAI A;  5CLL B;  3PG7 A;  2OQB A;  5J3Q A;  1FGZ A;  3DXC A;  2I1K A;  4NSW A;  5DI9 B;  2Q13 A;  3ML4 A;  2IYB A;  2XQN M;  2KIG A;  2KUQ A;  5DH9 B;  3AU4 A;  3HQC A;  3PEG A;  2VKI A;  3QWM A;  4Z2M B;  1V5P A;  3VIA A;  5HE1 A;  3SNH A;  2MKR A;  2NBV A;  1ZC4 B;  3DCX A;  4K2P A;  1GG3 A;  3M1I B;  1DYN A;  3P7Z A;  1J19 A;  2Z14 A;  3F5R A;  2W2X C;  5FI1 A;  1I2H A;  2AEH A;  5I2M A;  3ODW A;  4K17 A;  2Y8F A;  2P0H A;  4EKU A;  1U27 A;  1UNQ A;  3TVV A;  3FM8 C;  2DYN A;  1NTY A;  3QBV B;  1QQG A;  5C16 A;  1B55 A;  4GXB A;  5C6R A;  1UEF A;  2NZ8 B;  1PLS A;  1XOD A;  1BAK A;  4KHB B;  1EAZ A;  1AQC A;  2UVM A;  4D0N B;  4HAU B;  1V5M A;  1UNP A;  2DLW A;  2E2X A;  2COA A;  4Y94 A;  3U12 A;  5D3W A;  2DHK A;  2D9Y A;  2ROZ B;  1AWE A;  1ZSQ A;  2ZPY A;  5C5B B;  4ZRK A;  1I7A A;  4QJ4 B;  1XKE A;  1Y19 B;  4WSF A;  1U5D A;  2FJU B;  3OAN A;  3VOQ A;  1X1G A;  4L6E A;  2YT1 A;  5KQ1 A;  1P5T A;  5LOP B;  2YVC A;  4HAZ B;  1NI2 A;  2DKP A;  5DHA B;  3G9W A;  4HHV A;  3AU5 A;  2D2Q A;  2X18 A;  5D3Y A;  3F0W A;  2J0K A;  4GZU A;  1E5W A;  2AL6 A;  5LON B;  1MPH A;  2COF A;  1PMS A;  4A5K A;  2M14 A;  4QJ5 B;  1ZC3 B;  4ZRI A;  1X86 A;  4CHJ A;  2DYQ A;  2UZS A;  1X05 A;  2D4Q A;  2RUK B;  1WGU A;  2ELB A;  1WJ1 A;  2N0Y A;  2P8V A;  2BCJ A;  3ZVR A;  2YSZ A;  2R09 A;  5C79 A;  3KRX A;  2D11 A;  4DIX A;  4EMO A;  1ZM0 A;  1DBH A;  2UZR A;  2P0D A;  2MDX A;  3TFM A;  2EC1 A;  1DDV A;  2Z13 A;  4HAY B;  3T06 A;  1WJM A;  5HE0 A;  2R2Y A;  3KRW A;  1TQZ A;  1SHC A;  4GNK B;  3KZ1 A;  2OTX A;  1TXD A;  1EGX A;  2QKM A;  2JP2 A;  3U8Z A;  4P7I A;  2W2W A;  2Z0O A;  1EF1 A;  1MKE A;  4BBK A;  1DDW A;  1MK9 B;  1LW3 A;  4KVG B;  2EMT A;  2N23 A;  2Y7B A;  1OY2 A;  2D9X A;  4KAX B;  4A6F A;  4CSQ A;  3BIN A;  4F7H A;  1WVH A;  2Z0P A;  5CLQ B;  4ZRJ A;  4DX8 A;  1X11 A;  4GN1 A;  3UZT A;  3NWF A;  4L1R A;  5D3V A;  1FHO A;  5IRS A;  2Z4D A;  1V61 A;  3GYP A;  3MPX A;  1U5E A;  1QC6 A;  3ULC A;  5DHF B;  4CHM A;  2HE7 A;  2DHJ A;  4KHB A;  5HE3 A;  5DIF B;  2H7E A;  2YT2 A;  3CIK A;  2ELA A;  3HSA A;  3MDB C;  1P3R A;  1J0W A;  1K5G B;  2GCL A;  4GMV A;  2MWN B;  2GCJ A;  4DBB A;  2CY5 A;  2I5C A;  2K49 A;  4QXA B;  4PQ0 A;  1FGY A;  2EJ8 A;  2DX5 A;  1BTK A;  4PNK A;  1UPQ A;  4MK0 A;  1H10 A;  5FI0 A;  3TO1 A;  2DKQ A;  2V76 A;  2CRF A;  1XR0 B;  4NY0 A;  1Y5O A;  3PP2 A;  5GOW B;  2CY4 A;  4K2O A;  2ROV A;  2I5F A;  2Y8G A;  1DDM A;  3O96 A;  1BWN A;  2YF0 A;  3IVF A;  1U5G A;  1T77 A;  1XX0 A;  4F7U P;  1MK7 B;  2ADZ A;  3NW8 A;  2P0F A;  1NU2 A;  4HB0 B;  4DX9 0;  3PVW A;  2KCJ A;  1Z87 A;  2DA0 A;  2YS5 A;  1FHX A;  1LB1 A;  2YRY A;  2W2X D;  3NWD A;  1GC7 A;  1ZYI A;  1W1G A;  1OMW A;  1V89 A;  4MT7 A;  3X23 A;  1ISN A;  1UNR A;  4K81 A;  4TYZ A;  3ZDT A;  4GOU A;  3OHM B;  2RLO A;  5KCV A;  2ZKM X;  3DXD A;  2K2J A;  2R0D A;  2LOX A;  3D8D A;  3FSS A;  1P6S A;  4HSI A;  4HB2 B;  1FOE A;  5EFX A;  1K5D B;  3SO6 A;  3ODX A;  2GS0 A;  2RSG A;  3HK0 A;  1PFJ A;  3QIJ A;  2LYD A;  5KQ4 A;  5JHH A;  5LG4 B;  2I1J A;  3FEH A;  5J3T A;  1MIZ B;  2H7D A;  5L81 A;  2KIE A;  2M38 A;  1N3H A;  3SYX A;  3HIE A;  1U5F A;  4C0A A;  2YT0 A;  1RRP B;  2QKL A;  1WGQ A;  2COD A;  4H8S A;  2L1C A;  4HDQ A;  4Z2N A;  4WJ7 A;  4IFS A;  2EMS A;  5M4Y B;  3KSY A;  2IFS A;  4WVF B;  3SV1 A;  2DTC A;  3A8P A;  1V5U A;  1WI1 A;  2LG1 A;  3B77 A;  5JHG A;  3P6A A;  2GJY A;  4GMX B;  2PZ1 A;  2K2U A;  3V5W A;  3PZD A;  1U29 A;  2FJL A;  5JP4 A;  4KHO A;  1ZVR A;  4IAP A;  2DX1 A;  2Z0Q A;  5D3X A;  1WG7 A;  1KZG A;  1FAO A;  3WYF B;  2J59 M;  1TJ6 A;  4HDO A;  3ULB A;  2D9Z A;  1KI1 B;  4F7G A;  1RJ2 A;  3RCP A;  3D8F A;  3U7D A;  4A6K A;  2J0J A;  2YS3 A;  5JLJ B;  5HE2 A;  3N7C A;  4A6F B;  1M7E A;  2KUP A;  3A8Q A;  5C5B A;  1DRO A;  2Z59 A;  4HAX B;  1SGH A;  2DHI A;  2CAY A;  2RRF A;  2RVB B;  1W1H A;  2G35 A;  5J3Y A;  2GUM A;  2D9W A;  3A58 A;  3ODO A;  2COC A;  1X1F A;  3KY9 A;  3SUZ A;  1IRS A;  1XCG A;  1Q67 A;  3CXB B;  3PVL A;  2L2I A;  1MIX A;  1V88 A;  5D27 A;  4QJ3 B; 
#chains in the Genus database with same CATH homology
 2HTH B;  3DXE A;  1W1D A;  4TKN A;  1U2B A;  1OQN A;  1FB8 A;  2RGN B;  4HAT B;  2VRW B;  4HAV B;  4IOY X;  4YL8 A;  2DFK A;  1H4R A;  2NMB A;  3PVU A;  2KGX B;  4EJN A;  1FHW A;  1BTN A;  2MFQ A;  3D8E A;  3GYO A;  4HB4 B;  4GPT B;  4A6H A;  2J0M A;  2D9V A;  4HAW B;  4DXA B;  2LKO A;  3TCA A;  3A98 B;  4B6H A;  3TW1 A;  4HB3 B;  3LJU X;  1M7R A;  1UPR A;  4CYE A;  2D10 A;  1KZ7 A;  2YS1 A;  2LOZ A;  2K00 A;  1XD4 A;  1GC6 A;  2RNR B;  4XWX A;  4KHA A;  2VSZ A;  3NSU A;  4MY6 A;  3BJI A;  3HW2 B;  1NTV A;  3WA0 A;  2DN6 A;  3PSC A;  1EVH A;  3AJ4 A;  4YON A;  2LUL A;  1MAI A;  5CLL B;  3PG7 A;  2OQB A;  5J3Q A;  1FGZ A;  3DXC A;  2I1K A;  4NSW A;  5DI9 B;  2Q13 A;  3ML4 A;  2IYB A;  2XQN M;  5DH9 B;  3AU4 A;  3HQC A;  3PEG A;  2VKI A;  3QWM A;  4Z2M B;  1V5P A;  3VIA A;  5HE1 A;  3SNH A;  2MKR A;  1ZC4 B;  4K2P A;  1GG3 A;  3M1I B;  1DYN A;  3P7Z A;  1J19 A;  3F5R A;  2W2X C;  5FI1 A;  1I2H A;  2AEH A;  3ODW A;  4K17 A;  2Y8F A;  2P0H A;  4EKU A;  1U27 A;  1UNQ A;  3TVV A;  3FM8 C;  2DYN A;  1NTY A;  3QBV B;  1QQG A;  5C16 A;  1B55 A;  4GXB A;  5C6R A;  1UEF A;  2NZ8 B;  1PLS A;  1XOD A;  1BAK A;  4KHB B;  1EAZ A;  1AQC A;  2UVM A;  4D0N B;  4HAU B;  1V5M A;  1UNP A;  2DLW A;  2E2X A;  2COA A;  4Y94 A;  5D3W A;  2DHK A;  2D9Y A;  2ROZ B;  1AWE A;  1ZSQ A;  2ZPY A;  5C5B B;  4ZRK A;  1I7A A;  1XKE A;  1Y19 B;  4WSF A;  1U5D A;  3OAN A;  3VOQ A;  1X1G A;  4L6E A;  2YT1 A;  5KQ1 A;  1P5T A;  5LOP B;  2YVC A;  4HAZ B;  1NI2 A;  2DKP A;  5DHA B;  3G9W A;  4HHV A;  3AU5 A;  2D2Q A;  2X18 A;  5D3Y A;  3F0W A;  2J0K A;  4GZU A;  1E5W A;  2AL6 A;  5LON B;  1MPH A;  2COF A;  1PMS A;  4A5K A;  2M14 A;  1ZC3 B;  4ZRI A;  1X86 A;  4CHJ A;  2DYQ A;  2UZS A;  1X05 A;  2D4Q A;  2RUK B;  1WGU A;  2ELB A;  1WJ1 A;  2N0Y A;  2P8V A;  2BCJ A;  3ZVR A;  2YSZ A;  2R09 A;  5C79 A;  3KRX A;  2D11 A;  4EMO A;  1ZM0 A;  1DBH A;  2UZR A;  2P0D A;  2MDX A;  3TFM A;  2EC1 A;  1DDV A;  4HAY B;  3T06 A;  1WJM A;  5HE0 A;  3KRW A;  1TQZ A;  1SHC A;  3KZ1 A;  2OTX A;  1TXD A;  1EGX A;  2QKM A;  2JP2 A;  3U8Z A;  4P7I A;  2W2W A;  2Z0O A;  1EF1 A;  1MKE A;  4BBK A;  1DDW A;  1MK9 B;  1LW3 A;  4KVG B;  2EMT A;  2N23 A;  2Y7B A;  1OY2 A;  2D9X A;  4KAX B;  4A6F A;  4F7H A;  3BIN A;  1WVH A;  2Z0P A;  5CLQ B;  4ZRJ A;  4DX8 A;  1X11 A;  4GN1 A;  3UZT A;  1FHO A;  5D3V A;  1V61 A;  3GYP A;  3MPX A;  1U5E A;  1QC6 A;  3ULC A;  5DHF B;  4CHM A;  2HE7 A;  2DHJ A;  5HE3 A;  5DIF B;  2H7E A;  3CIK A;  2ELA A;  3MDB C;  1P3R A;  1J0W A;  1K5G B;  2GCL A;  4GMV A;  2MWN B;  2GCJ A;  4DBB A;  2CY5 A;  2I5C A;  4PQ0 A;  1FGY A;  2EJ8 A;  2DX5 A;  1BTK A;  4PNK A;  1UPQ A;  4MK0 A;  1H10 A;  5FI0 A;  3TO1 A;  2DKQ A;  2V76 A;  2CRF A;  1XR0 B;  4NY0 A;  1Y5O A;  3PP2 A;  5GOW B;  2CY4 A;  4K2O A;  2ROV A;  2I5F A;  2Y8G A;  1DDM A;  3O96 A;  1BWN A;  2YF0 A;  3IVF A;  1U5G A;  1XX0 A;  4F7U P;  1MK7 B;  2ADZ A;  2P0F A;  1NU2 A;  4HB0 B;  4DX9 0;  3PVW A;  2KCJ A;  1Z87 A;  2DA0 A;  2YS5 A;  1FHX A;  1LB1 A;  2YRY A;  2W2X D;  1GC7 A;  1W1G A;  1OMW A;  1V89 A;  4MT7 A;  3X23 A;  1ISN A;  1UNR A;  4K81 A;  4TYZ A;  3ZDT A;  2RLO A;  5KCV A;  3DXD A;  2K2J A;  2R0D A;  2LOX A;  3D8D A;  3FSS A;  1P6S A;  4HB2 B;  1FOE A;  5EFX A;  1K5D B;  3SO6 A;  3ODX A;  2GS0 A;  2RSG A;  3HK0 A;  1PFJ A;  3QIJ A;  2LYD A;  5KQ4 A;  5JHH A;  2I1J A;  3FEH A;  5J3T A;  1MIZ B;  2H7D A;  5L81 A;  2M38 A;  1N3H A;  3SYX A;  1U5F A;  4C0A A;  2YT0 A;  1RRP B;  2QKL A;  1WGQ A;  2COD A;  4H8S A;  2L1C A;  4HDQ A;  4Z2N A;  4WJ7 A;  4IFS A;  2EMS A;  3KSY A;  2IFS A;  4WVF B;  3SV1 A;  2DTC A;  3A8P A;  1V5U A;  1WI1 A;  2LG1 A;  5JHG A;  3P6A A;  2GJY A;  4GMX B;  2PZ1 A;  2K2U A;  3V5W A;  3PZD A;  1U29 A;  2FJL A;  5JP4 A;  4KHO A;  1ZVR A;  4IAP A;  2DX1 A;  2Z0Q A;  5D3X A;  1WG7 A;  1KZG A;  1FAO A;  3WYF B;  2J59 M;  1TJ6 A;  4HDO A;  3ULB A;  2D9Z A;  1KI1 B;  4F7G A;  1RJ2 A;  3RCP A;  3D8F A;  3U7D A;  4A6K A;  2J0J A;  2YS3 A;  5JLJ B;  5HE2 A;  3N7C A;  4A6F B;  1M7E A;  2KUP A;  3A8Q A;  5C5B A;  1DRO A;  4HAX B;  1SGH A;  2DHI A;  2CAY A;  2RVB B;  1W1H A;  2G35 A;  5J3Y A;  2D9W A;  3ODO A;  2COC A;  1X1F A;  3KY9 A;  3SUZ A;  1IRS A;  1XCG A;  1Q67 A;  3CXB B;  3PVL A;  2L2I A;  1MIX A;  1V88 A;  5D27 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...