1U29A

Triglycine variant of the arno pleckstrin homology domain in complex with ins(1,4,5)p3
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
119
structure length
119
Chain Sequence
PDREGWLLKLGGGRVKTWKRRWFILTDNCLYYFEYTTDKEPRGIIPLENLSIREVDDPRKPNCFELYIPNNKGQLIKACKTEADGRVVEGNHMVYRISAPTQEEKDEWIKSIQAAVSVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural determinants of phosphoinositide selectivity in splice variants of Grp1 family PH domains
pubmed doi rcsb
source organism Mus musculus
molecule tags Lipid binding protein
molecule keywords Cytohesin 2
total genus 21
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2004-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1u29A00
1TXDA 5DH9B 3SUZA 2ADZA 2L2IA 3D8EA 2P0DA 1U2BA 5L81A 2DKPA 1PFJA 4HAWB 2CODA 2RVBB 2MDXA 1U5GA 2W2XD 2Y8FA 3P6AA 4MK0A 4WVFB 3ZVRA 1V5PA 3X23A 5C16A 1WJ1A 2QKLA 4NY0A 1WI1A 1MAIA 2YS1A 2BCJA 4D0NB 4GMVA 4L6EA 2I5FA 4MT7A 1U5DA 4GZUA 2D9WA 2YF0A 3GYOA 1ZSQA 1I2HA 2K00A 1W1GA 2RUKB 4HAUB 4EJNA 4PQ0A 2LULA 3QIJA 3IVFA 2K2UA 1W1DA 1UPRA 3PVUA 3PSCA 1U5FA 2N23A 5DIFB 5JP4A 2UZRA 4ZRKA 1MIXA 1SHCA 2EC1A 1RRPB 4IFSA 2DN6A 2DYNA 1X1FA 2MKRA 1OMWA 3SNHA 1ZC4B 2D9ZA 4DXAB 2JP2A 4A6FB 2MFQA 3BJIA 5HE3A 4TYZA 3VIAA 3P7ZA 4CYEA 4IAPA 1X86A 1V5MA 1DROA 1EAZA 3SV1A 1FHOA 2G35A 1MK9B 2J59M 4DBBA 1ZM0A 1WGQA 2FJLA 1ISNA 1X11A 1Z87A 1X05A 2H7DA 4KHBB 2ROVA 4EMOA 2Z0PA 3CIKA 2D2QA 3FM8C 3F0WA 4Z2MB 4A6FA 3LJUX 4YONA 2GCLA 1K5GB 3D8DA 2YS3A 3HQCA 2LOXA 2YSZA 1UPQA 3T06A 2E2XA 3AU5A 2I1KA 1WVHA 2ELBA 3A8QA 1DDWA 2NZ8B 4EKUA 5GOWB 2COFA 4Y94A 2P0HA 2QKMA 1V5UA 1TJ6A 1NTYA 2W2WA 5J3TA 5JHGA 4GMXB 2DFKA 3ML4A 5CLLB 1FGZA 2CY4A 2D9YA 2DHIA 3PVWA 2YVCA 2DKQA 5D27A 1TQZA 2V76A 2D4QA 4HATB 2D10A 4GPTB 4F7HA 4K81A 5LOPB 1DDMA 1XCGA 3HW2B 2YT0A 5LONB 4CHMA 2Y7BA 1QQGA 2EMTA 1XX0A 1U5EA 2RGNB 2YRYA 1B55A 1MK7B 1FHXA 2W2XC 3PG7A 2EJ8A 4HB2B 4HAYB 2VRWB 2M14A 1K5DB 5J3QA 3KRXA 3ZDTA 1P6SA 3RCPA 3A98B 2J0MA 1X1GA 3F5RA 3ULCA 3FSSA 2HTHB 2RNRB 3U8ZA 3AU4A 2PZ1A 3PP2A 4A5KA 4K2OA 3DXEA 5HE0A 1H10A 4CHJA 1FOEA 3GYPA 1E5WA 1PLSA 1U29A 1WG7A 1BWNA 2OQBA 1AWEA 5D3YA 2Q13A 4HAXB 4HB3B 1NU2A 4BBKA 5D3XA 1ZVRA 1W1HA 3A8PA 1XODA 5C5BB 3ODOA 3ULBA 2DLWA 2D9VA 1GC7A 1MKEA 4P7IA 3KY9A 1MPHA 5HE1A 2GJYA 2D11A 1IRSA 2N0YA 1P3RA 1SGHA 2YT1A 1MIZB 4KAXB 4HB4B 3WYFB 1Y19B 1UNRA 1AQCA 2LG1A 1I7AA 3TVVA 2HE7A 1PMSA 2MWNB 5DI9B 3PEGA 3VOQA 1NI2A 4DX90 4H8SA 4F7UP 3BINA 5C5BA 5DHFB 5HE2A 2OTXA 2K2JA 2COAA 2P8VA 3HK0A 2ROZB 4HDOA 2P0FA 1H4RA 3U7DA 1EGXA 2ELAA 2RLOA 2GCJA 4ZRIA 5FI0A 1EF1A 2I1JA 4KHAA 1V89A 5JHHA 2H7EA 3O96A 2XQNM 2CRFA 1RJ2A 1FHWA 4K17A 2GS0A 4ZRJA 1M7EA 4C0AA 1J19A 1WJMA 3TCAA 4F7GA 3SYXA 2UVMA 3PZDA 1KI1B 5D3WA 3CXBB 2DA0A 2KUPA 1LW3A 2DX5A 2IFSA 4KVGB 4HAVB 1KZGA 1UNQA 2X18A 1NTVA 3PVLA 3SO6A 2DHJA 2AEHA 4WJ7A 5C79A 2DHKA 3NSUA 4WSFA 2VSZA 2J0JA 2DX1A 1M7RA 1QC6A 3M1IB 4HHVA 3KRWA 5C6RA 2AL6A 2VKIA 2YS5A 1DBHA 2R09A 3ODWA 3QWMA 1OY2A 1BAKA 5EFXA 3DXCA 3D8FA 3KSYA 4TKNA 4HB0B 2Y8GA 3UZTA 5D3VA 5CLQB 1FB8A 2UZSA 3WA0A 2LKOA 4HAZB 2Z0OA 4DX8A 3ODXA 1ZC3B 1XKEA 1U27A 4GN1A 4IOYX 1V88A 1XD4A 2RSGA 2KCJA 4MY6A 2KGXB 2M38A 3QBVB 2NMBA 1KZ7A 2J0KA 1DDVA 5KQ4A 1Y5OA 3TW1A 2ZPYA 4A6KA 2LYDA 3KZ1A 1OQNA 5KQ1A 3TO1A 1BTNA 4HDQA 3TFMA 5KCVA 3MDBC 1J0WA 2COCA 1EVHA 4B6HA 2D9XA 1P5TA 2I5CA 4A6HA 1WGUA 1LB1A 1XR0B 1V61A 2Z0QA 2CY5A 4XWXA 5J3YA 4NSWA 1BTKA 2EMSA 4Z2NA 5FI1A 1FGYA 2DTCA 2LOZA 2CAYA 1N3HA 1DYNA 1FAOA 3DXDA 3OANA 1GG3A 5DHAB 3V5WA 4K2PA 2IYBA 3AJ4A 4YL8A 2L1CA 2DYQA 3N7CA 1UNPA 4KHOA 3G9WA 3FEHA 4PNKA 3MPXA 1Q67A 5JLJB 1UEFA 4GXBA 2R0DA 1GC6A
chains in the Genus database with same CATH superfamily
1TXDA 3B77A 5DH9B 3SUZA 2ADZA 2L2IA 3D8EA 2P0DA 2RRFA 1U2BA 5L81A 2DKPA 1PFJA 3DCXA 4HAWB 2CODA 2RVBB 2MDXA 1U5GA 2W2XD 2Y8FA 3P6AA 4MK0A 4WVFB 3ZVRA 1V5PA 3X23A 5C16A 1WJ1A 2QKLA 4NY0A 1WI1A 1MAIA 2YS1A 2BCJA 4D0NB 2Z4DA 5I2SA 4GMVA 4L6EA 2I5FA 4MT7A 1U5DA 4CSQA 4GZUA 2D9WA 2YF0A 3GYOA 1ZSQA 1I2HA 2K00A 1W1GA 2RUKB 4HAUB 4EJNA 4PQ0A 2LULA 3QIJA 3IVFA 2K2UA 1W1DA 1UPRA 3PVUA 3PSCA 1U5FA 2N23A 5DIFB 5JP4A 2UZRA 4ZRKA 1MIXA 1SHCA 2EC1A 1RRPB 3NWAA 4IFSA 2DN6A 2DYNA 1X1FA 2MKRA 1OMWA 3SNHA 1ZC4B 2D9ZA 4DXAB 2JP2A 2GUMA 4A6FB 2MFQA 3BJIA 5HE3A 4TYZA 3VIAA 4OSNA 3P7ZA 4CYEA 4IAPA 1X86A 1V5MA 1DROA 1EAZA 3SV1A 1FHOA 2G35A 1MK9B 2J59M 4DBBA 1ZM0A 1WGQA 2FJLA 1ISNA 1X11A 1Z87A 3U12A 1X05A 2H7DA 4KHBB 2ROVA 4EMOA 2Z0PA 3CIKA 2D2QA 3FM8C 3F0WA 4Z2MB 4QXAB 3LJUX 4YONA 2GCLA 4A6FA 1K5GB 3D8DA 2YS3A 3HQCA 2LOXA 2FJUB 2YSZA 1UPQA 3T06A 2E2XA 3AU5A 2I1KA 1WVHA 2ELBA 3A8QA 1DDWA 2NZ8B 4EKUA 5GOWB 2COFA 4Y94A 2P0HA 2QKMA 1V5UA 4KHBA 3NWDA 1TJ6A 1NTYA 2W2WA 3FVCA 5J3TA 5JHGA 4GMXB 2DFKA 3ML4A 5CLLB 1FGZA 2CY4A 2D9YA 2DHIA 3PVWA 2YVCA 2DKQA 5D27A 1TQZA 2V76A 2D4QA 4HATB 2D10A 4GPTB 4F7HA 4K81A 5LOPB 1DDMA 1XCGA 3HW2B 2YT0A 5LONB 4CHMA 2Y7BA 1QQGA 2EMTA 1XX0A 1U5EA 2RGNB 2YRYA 1B55A 1MK7B 1FHXA 2W2XC 3PG7A 2EJ8A 4HB2B 2VRWB 4HAYB 2M14A 4GNKB 1K5DB 5J3QA 3KRXA 3ZDTA 1P6SA 3RCPA 5IRSA 3A98B 2J0MA 1X1GA 3F5RA 3ULCA 3FSSA 2HTHB 2RNRB 3U8ZA 3AU4A 2PZ1A 3PP2A 4A5KA 4K2OA 3DXEA 5HE0A 1ZYIA 1H10A 4CHJA 1FOEA 3GYPA 1E5WA 1PLSA 1U29A 1WG7A 1BWNA 2OQBA 1AWEA 5D3YA 2Q13A 4HAXB 4HB3B 1NU2A 4BBKA 5D3XA 1ZVRA 1W1HA 3A8PA 1XODA 5C5BB 3ODOA 3ULBA 2DLWA 2D9VA 1GC7A 1MKEA 4P7IA 3KY9A 1MPHA 5HE1A 1T77A 2GJYA 2D11A 1IRSA 2N0YA 1P3RA 1SGHA 2YT1A 1MIZB 4KAXB 4HB4B 3WYFB 1Y19B 2KIGA 1UNRA 1AQCA 2LG1A 1I7AA 3TVVA 5I2MA 2HE7A 1PMSA 2MWNB 5DI9B 3PEGA 3VOQA 1NI2A 4DX90 4H8SA 4F7UP 3BINA 5C5BA 5DHFB 5HE2A 2OTXA 2K2JA 2COAA 2P8VA 3HK0A 2ROZB 4HDOA 2P0FA 1H4RA 3U7DA 1EGXA 2ELAA 2RLOA 2GCJA 4ZRIA 5FI0A 1EF1A 2I1JA 4KHAA 1V89A 5JHHA 2H7EA 4QJ5B 3O96A 2XQNM 2CRFA 1RJ2A 1FHWA 4K17A 2GS0A 3NWFA 4ZRJA 1MI1A 2Z14A 1M7EA 4C0AA 1J19A 1WJMA 3TCAA 4F7GA 3SYXA 2UVMA 3PZDA 1KI1B 5D3WA 3CXBB 2DA0A 2KUPA 1LW3A 2DX5A 2IFSA 4KVGB 4HAVB 1KZGA 1UNQA 2X18A 1NTVA 4QJ4B 3PVLA 3SO6A 4HSIA 3HSAA 2DHJA 5LG4B 2AEHA 2YT2A 4WJ7A 5C79A 2DHKA 3NSUA 4WSFA 2VSZA 2J0JA 2DX1A 1M7RA 1QC6A 3M1IB 4HHVA 3KRWA 3A58A 5C6RA 2AL6A 5M4YB 2VKIA 2YS5A 1DBHA 2KUQA 2R09A 3ODWA 3QWMA 1OY2A 1BAKA 5EFXA 3DXCA 3D8FA 3KSYA 4TKNA 3NW8A 4HB0B 2Y8GA 2K8EA 3UZTA 4QJ3B 5D3VA 3OHMB 4DIXA 5CLQB 2NBVA 1FB8A 2UZSA 3WA0A 2LKOA 2R2YA 4HAZB 2Z0OA 4DX8A 3ODXA 1ZC3B 1XKEA 1U27A 4GN1A 4GOUA 4IOYX 1V88A 1XD4A 4D6WA 2KIEA 2Z13A 2RSGA 2KCJA 4MY6A 2KGXB 2M38A 3QBVB 2KR0A 2NMBA 2Z59A 1KZ7A 2K49A 2J0KA 1DDVA 5KQ4A 1Y5OA 3TW1A 2ZPYA 4A6KA 2LYDA 3KZ1A 1OQNA 5KQ1A 3TO1A 1BTNA 4HDQA 3HIEA 3TFMA 5KCVA 3MDBC 1J0WA 2COCA 1EVHA 4B6HA 2D9XA 1P5TA 2I5CA 4A6HA 1WGUA 1LB1A 1XR0B 1V61A 2Z0QA 2CY5A 4L1RA 4XWXA 5J3YA 4NSWA 1BTKA 2EMSA 4Z2NA 5FI1A 1FGYA 2DTCA 2LOZA 2CAYA 1N3HA 1DYNA 1FAOA 3DXDA 3OANA 4OT1A 1GG3A 5DHAB 3V5WA 4K2PA 2IYBA 3AJ4A 4YL8A 2L1CA 2DYQA 3N7CA 1UNPA 4KHOA 3G9WA 3FEHA 4PNKA 3MPXA 1Q67A 5JLJB 2ZKMX 1UEFA 4GXBA 2R0DA 1GC6A
chains in the Genus database with same CATH topology
1TXDA 5DH9B 3SUZA 2ADZA 2L2IA 3D8EA 2P0DA 1U2BA 5L81A 2DKPA 1PFJA 4HAWB 2CODA 2RVBB 2MDXA 1U5GA 2W2XD 2Y8FA 3P6AA 4MK0A 4WVFB 3ZVRA 1V5PA 3X23A 5C16A 1WJ1A 2QKLA 4NY0A 1WI1A 1MAIA 2YS1A 2BCJA 4D0NB 4GMVA 4L6EA 2I5FA 4MT7A 1U5DA 4GZUA 2D9WA 2YF0A 3GYOA 1ZSQA 1I2HA 2K00A 1W1GA 2RUKB 4HAUB 4EJNA 4PQ0A 2LULA 3QIJA 3IVFA 2K2UA 1W1DA 1UPRA 3PVUA 3PSCA 1U5FA 2N23A 5DIFB 5JP4A 2UZRA 4ZRKA 1MIXA 1SHCA 2EC1A 1RRPB 4IFSA 2DN6A 2DYNA 1X1FA 2MKRA 1OMWA 3SNHA 1ZC4B 2D9ZA 4DXAB 2JP2A 4A6FB 2MFQA 3BJIA 5HE3A 4TYZA 3VIAA 3P7ZA 4CYEA 4IAPA 1X86A 1V5MA 1DROA 1EAZA 3SV1A 1FHOA 2G35A 1MK9B 2J59M 4DBBA 1ZM0A 1WGQA 2FJLA 1ISNA 1X11A 1Z87A 1X05A 2H7DA 4KHBB 2ROVA 4EMOA 2Z0PA 3CIKA 2D2QA 3FM8C 3F0WA 4Z2MB 4A6FA 3LJUX 4YONA 2GCLA 1K5GB 3D8DA 2YS3A 3HQCA 2LOXA 2YSZA 1UPQA 3T06A 2E2XA 3AU5A 2I1KA 1WVHA 2ELBA 3A8QA 1DDWA 2NZ8B 4EKUA 5GOWB 2COFA 4Y94A 2P0HA 2QKMA 1V5UA 1TJ6A 1NTYA 2W2WA 5J3TA 5JHGA 4GMXB 2DFKA 3ML4A 5CLLB 1FGZA 2CY4A 2D9YA 2DHIA 3PVWA 2YVCA 2DKQA 5D27A 1TQZA 2V76A 2D4QA 4HATB 2D10A 4GPTB 4F7HA 4K81A 5LOPB 1DDMA 1XCGA 3HW2B 2YT0A 5LONB 4CHMA 2Y7BA 1QQGA 2EMTA 1XX0A 1U5EA 2RGNB 2YRYA 1B55A 1MK7B 1FHXA 2W2XC 3PG7A 2EJ8A 4HB2B 4HAYB 2VRWB 2M14A 1K5DB 5J3QA 3KRXA 3ZDTA 1P6SA 3RCPA 3A98B 2J0MA 1X1GA 3F5RA 3ULCA 3FSSA 2HTHB 2RNRB 3U8ZA 3AU4A 2PZ1A 3PP2A 4A5KA 4K2OA 3DXEA 5HE0A 1H10A 4CHJA 1FOEA 3GYPA 1E5WA 1PLSA 1U29A 1WG7A 1BWNA 2OQBA 1AWEA 5D3YA 2Q13A 4HAXB 4HB3B 1NU2A 4BBKA 5D3XA 1ZVRA 1W1HA 3A8PA 1XODA 5C5BB 3ODOA 3ULBA 2DLWA 2D9VA 1GC7A 1MKEA 4P7IA 3KY9A 1MPHA 5HE1A 2GJYA 2D11A 1IRSA 2N0YA 1P3RA 1SGHA 2YT1A 1MIZB 4KAXB 4HB4B 3WYFB 1Y19B 1UNRA 1AQCA 2LG1A 1I7AA 3TVVA 2HE7A 1PMSA 2MWNB 5DI9B 3PEGA 3VOQA 1NI2A 4DX90 4H8SA 4F7UP 3BINA 5C5BA 5DHFB 5HE2A 2OTXA 2K2JA 2COAA 2P8VA 3HK0A 2ROZB 4HDOA 2P0FA 1H4RA 3U7DA 1EGXA 2ELAA 2RLOA 2GCJA 4ZRIA 5FI0A 1EF1A 2I1JA 4KHAA 1V89A 5JHHA 2H7EA 3O96A 2XQNM 2CRFA 1RJ2A 1FHWA 4K17A 2GS0A 4ZRJA 1M7EA 4C0AA 1J19A 1WJMA 3TCAA 4F7GA 3SYXA 2UVMA 3PZDA 1KI1B 5D3WA 3CXBB 2DA0A 2KUPA 1LW3A 2DX5A 2IFSA 4KVGB 4HAVB 1KZGA 1UNQA 2X18A 1NTVA 3PVLA 3SO6A 2DHJA 2AEHA 4WJ7A 5C79A 2DHKA 3NSUA 4WSFA 2VSZA 2J0JA 2DX1A 1M7RA 1QC6A 3M1IB 4HHVA 3KRWA 5C6RA 2AL6A 2VKIA 2YS5A 1DBHA 2R09A 3ODWA 3QWMA 1OY2A 1BAKA 5EFXA 3DXCA 3D8FA 3KSYA 4TKNA 4HB0B 2Y8GA 3UZTA 5D3VA 5CLQB 1FB8A 2UZSA 3WA0A 2LKOA 4HAZB 2Z0OA 4DX8A 3ODXA 1ZC3B 1XKEA 1U27A 4GN1A 4IOYX 1V88A 1XD4A 2RSGA 2KCJA 4MY6A 2KGXB 2M38A 3QBVB 2NMBA 1KZ7A 2J0KA 1DDVA 5KQ4A 1Y5OA 3TW1A 2ZPYA 4A6KA 2LYDA 3KZ1A 1OQNA 5KQ1A 3TO1A 1BTNA 4HDQA 3TFMA 5KCVA 3MDBC 1J0WA 2COCA 1EVHA 4B6HA 2D9XA 1P5TA 2I5CA 4A6HA 1WGUA 1LB1A 1XR0B 1V61A 2Z0QA 2CY5A 4XWXA 5J3YA 4NSWA 1BTKA 2EMSA 4Z2NA 5FI1A 1FGYA 2DTCA 2LOZA 2CAYA 1N3HA 1DYNA 1FAOA 3DXDA 3OANA 1GG3A 5DHAB 3V5WA 4K2PA 2IYBA 3AJ4A 4YL8A 2L1CA 2DYQA 3N7CA 1UNPA 4KHOA 3G9WA 3FEHA 4PNKA 3MPXA 1Q67A 5JLJB 1UEFA 4GXBA 2R0DA 1GC6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TXD A;  5DH9 B;  3SUZ A;  2ADZ A;  2L2I A;  3D8E A;  2P0D A;  1U2B A;  5L81 A;  2DKP A;  1PFJ A;  4HAW B;  2COD A;  2RVB B;  2MDX A;  1U5G A;  2W2X D;  2Y8F A;  3P6A A;  4MK0 A;  4WVF B;  3ZVR A;  1V5P A;  3X23 A;  5C16 A;  1WJ1 A;  2QKL A;  4NY0 A;  1WI1 A;  1MAI A;  2YS1 A;  2BCJ A;  4D0N B;  4GMV A;  4L6E A;  2I5F A;  4MT7 A;  1U5D A;  4GZU A;  2D9W A;  2YF0 A;  3GYO A;  1ZSQ A;  1I2H A;  2K00 A;  1W1G A;  2RUK B;  4HAU B;  4EJN A;  4PQ0 A;  2LUL A;  3QIJ A;  3IVF A;  2K2U A;  1W1D A;  1UPR A;  3PVU A;  3PSC A;  1U5F A;  2N23 A;  5DIF B;  5JP4 A;  2UZR A;  4ZRK A;  1MIX A;  1SHC A;  2EC1 A;  1RRP B;  4IFS A;  2DN6 A;  2DYN A;  1X1F A;  2MKR A;  1OMW A;  3SNH A;  1ZC4 B;  2D9Z A;  4DXA B;  2JP2 A;  4A6F B;  2MFQ A;  3BJI A;  5HE3 A;  4TYZ A;  3VIA A;  3P7Z A;  4CYE A;  4IAP A;  1X86 A;  1V5M A;  1DRO A;  1EAZ A;  3SV1 A;  1FHO A;  2G35 A;  1MK9 B;  2J59 M;  4DBB A;  1ZM0 A;  1WGQ A;  2FJL A;  1ISN A;  1X11 A;  1Z87 A;  1X05 A;  2H7D A;  4KHB B;  2ROV A;  4EMO A;  2Z0P A;  3CIK A;  2D2Q A;  3FM8 C;  3F0W A;  4Z2M B;  4A6F A;  3LJU X;  4YON A;  2GCL A;  1K5G B;  3D8D A;  2YS3 A;  3HQC A;  2LOX A;  2YSZ A;  1UPQ A;  3T06 A;  2E2X A;  3AU5 A;  2I1K A;  1WVH A;  2ELB A;  3A8Q A;  1DDW A;  2NZ8 B;  4EKU A;  5GOW B;  2COF A;  4Y94 A;  2P0H A;  2QKM A;  1V5U A;  1TJ6 A;  1NTY A;  2W2W A;  5J3T A;  5JHG A;  4GMX B;  2DFK A;  3ML4 A;  5CLL B;  1FGZ A;  2CY4 A;  2D9Y A;  2DHI A;  3PVW A;  2YVC A;  2DKQ A;  5D27 A;  1TQZ A;  2V76 A;  2D4Q A;  4HAT B;  2D10 A;  4GPT B;  4F7H A;  4K81 A;  5LOP B;  1DDM A;  1XCG A;  3HW2 B;  2YT0 A;  5LON B;  4CHM A;  2Y7B A;  1QQG A;  2EMT A;  1XX0 A;  1U5E A;  2RGN B;  2YRY A;  1B55 A;  1MK7 B;  1FHX A;  2W2X C;  3PG7 A;  2EJ8 A;  4HB2 B;  4HAY B;  2VRW B;  2M14 A;  1K5D B;  5J3Q A;  3KRX A;  3ZDT A;  1P6S A;  3RCP A;  3A98 B;  2J0M A;  1X1G A;  3F5R A;  3ULC A;  3FSS A;  2HTH B;  2RNR B;  3U8Z A;  3AU4 A;  2PZ1 A;  3PP2 A;  4A5K A;  4K2O A;  3DXE A;  5HE0 A;  1H10 A;  4CHJ A;  1FOE A;  3GYP A;  1E5W A;  1PLS A;  1U29 A;  1WG7 A;  1BWN A;  2OQB A;  1AWE A;  5D3Y A;  2Q13 A;  4HAX B;  4HB3 B;  1NU2 A;  4BBK A;  5D3X A;  1ZVR A;  1W1H A;  3A8P A;  1XOD A;  5C5B B;  3ODO A;  3ULB A;  2DLW A;  2D9V A;  1GC7 A;  1MKE A;  4P7I A;  3KY9 A;  1MPH A;  5HE1 A;  2GJY A;  2D11 A;  1IRS A;  2N0Y A;  1P3R A;  1SGH A;  2YT1 A;  1MIZ B;  4KAX B;  4HB4 B;  3WYF B;  1Y19 B;  1UNR A;  1AQC A;  2LG1 A;  1I7A A;  3TVV A;  2HE7 A;  1PMS A;  2MWN B;  5DI9 B;  3PEG A;  3VOQ A;  1NI2 A;  4DX9 0;  4H8S A;  4F7U P;  3BIN A;  5C5B A;  5DHF B;  5HE2 A;  2OTX A;  2K2J A;  2COA A;  2P8V A;  3HK0 A;  2ROZ B;  4HDO A;  2P0F A;  1H4R A;  3U7D A;  1EGX A;  2ELA A;  2RLO A;  2GCJ A;  4ZRI A;  5FI0 A;  1EF1 A;  2I1J A;  4KHA A;  1V89 A;  5JHH A;  2H7E A;  3O96 A;  2XQN M;  2CRF A;  1RJ2 A;  1FHW A;  4K17 A;  2GS0 A;  4ZRJ A;  1M7E A;  4C0A A;  1J19 A;  1WJM A;  3TCA A;  4F7G A;  3SYX A;  2UVM A;  3PZD A;  1KI1 B;  5D3W A;  3CXB B;  2DA0 A;  2KUP A;  1LW3 A;  2DX5 A;  2IFS A;  4KVG B;  4HAV B;  1KZG A;  1UNQ A;  2X18 A;  1NTV A;  3PVL A;  3SO6 A;  2DHJ A;  2AEH A;  4WJ7 A;  5C79 A;  2DHK A;  3NSU A;  4WSF A;  2VSZ A;  2J0J A;  2DX1 A;  1M7R A;  1QC6 A;  3M1I B;  4HHV A;  3KRW A;  5C6R A;  2AL6 A;  2VKI A;  2YS5 A;  1DBH A;  2R09 A;  3ODW A;  3QWM A;  1OY2 A;  1BAK A;  5EFX A;  3DXC A;  3D8F A;  3KSY A;  4TKN A;  4HB0 B;  2Y8G A;  3UZT A;  5D3V A;  5CLQ B;  1FB8 A;  2UZS A;  3WA0 A;  2LKO A;  4HAZ B;  2Z0O A;  4DX8 A;  3ODX A;  1ZC3 B;  1XKE A;  1U27 A;  4GN1 A;  4IOY X;  1V88 A;  1XD4 A;  2RSG A;  2KCJ A;  4MY6 A;  2KGX B;  2M38 A;  3QBV B;  2NMB A;  1KZ7 A;  2J0K A;  1DDV A;  5KQ4 A;  1Y5O A;  3TW1 A;  2ZPY A;  4A6K A;  2LYD A;  3KZ1 A;  1OQN A;  5KQ1 A;  3TO1 A;  1BTN A;  4HDQ A;  3TFM A;  5KCV A;  3MDB C;  1J0W A;  2COC A;  1EVH A;  4B6H A;  2D9X A;  1P5T A;  2I5C A;  4A6H A;  1WGU A;  1LB1 A;  1XR0 B;  1V61 A;  2Z0Q A;  2CY5 A;  4XWX A;  5J3Y A;  4NSW A;  1BTK A;  2EMS A;  4Z2N A;  5FI1 A;  1FGY A;  2DTC A;  2LOZ A;  2CAY A;  1N3H A;  1DYN A;  1FAO A;  3DXD A;  3OAN A;  1GG3 A;  5DHA B;  3V5W A;  4K2P A;  2IYB A;  3AJ4 A;  4YL8 A;  2L1C A;  2DYQ A;  3N7C A;  1UNP A;  4KHO A;  3G9W A;  3FEH A;  4PNK A;  3MPX A;  1Q67 A;  5JLJ B;  1UEF A;  4GXB A;  2R0D A;  1GC6 A; 
#chains in the Genus database with same CATH topology
 1TXD A;  3B77 A;  5DH9 B;  3SUZ A;  2ADZ A;  2L2I A;  3D8E A;  2P0D A;  2RRF A;  1U2B A;  5L81 A;  2DKP A;  1PFJ A;  3DCX A;  4HAW B;  2COD A;  2RVB B;  2MDX A;  1U5G A;  2W2X D;  2Y8F A;  3P6A A;  4MK0 A;  4WVF B;  3ZVR A;  1V5P A;  3X23 A;  5C16 A;  1WJ1 A;  2QKL A;  4NY0 A;  1WI1 A;  1MAI A;  2YS1 A;  2BCJ A;  4D0N B;  2Z4D A;  5I2S A;  4GMV A;  4L6E A;  2I5F A;  4MT7 A;  1U5D A;  4CSQ A;  4GZU A;  2D9W A;  2YF0 A;  3GYO A;  1ZSQ A;  1I2H A;  2K00 A;  1W1G A;  2RUK B;  4HAU B;  4EJN A;  4PQ0 A;  2LUL A;  3QIJ A;  3IVF A;  2K2U A;  1W1D A;  1UPR A;  3PVU A;  3PSC A;  1U5F A;  2N23 A;  5DIF B;  5JP4 A;  2UZR A;  4ZRK A;  1MIX A;  1SHC A;  2EC1 A;  1RRP B;  3NWA A;  4IFS A;  2DN6 A;  2DYN A;  1X1F A;  2MKR A;  1OMW A;  3SNH A;  1ZC4 B;  2D9Z A;  4DXA B;  2JP2 A;  2GUM A;  4A6F B;  2MFQ A;  3BJI A;  5HE3 A;  4TYZ A;  3VIA A;  4OSN A;  3P7Z A;  4CYE A;  4IAP A;  1X86 A;  1V5M A;  1DRO A;  1EAZ A;  3SV1 A;  1FHO A;  2G35 A;  1MK9 B;  2J59 M;  4DBB A;  1ZM0 A;  1WGQ A;  2FJL A;  1ISN A;  1X11 A;  1Z87 A;  3U12 A;  1X05 A;  2H7D A;  4KHB B;  2ROV A;  4EMO A;  2Z0P A;  3CIK A;  2D2Q A;  3FM8 C;  3F0W A;  4Z2M B;  4QXA B;  3LJU X;  4YON A;  2GCL A;  4A6F A;  1K5G B;  3D8D A;  2YS3 A;  3HQC A;  2LOX A;  2FJU B;  2YSZ A;  1UPQ A;  3T06 A;  2E2X A;  3AU5 A;  2I1K A;  1WVH A;  2ELB A;  3A8Q A;  1DDW A;  2NZ8 B;  4EKU A;  5GOW B;  2COF A;  4Y94 A;  2P0H A;  2QKM A;  1V5U A;  4KHB A;  3NWD A;  1TJ6 A;  1NTY A;  2W2W A;  3FVC A;  5J3T A;  5JHG A;  4GMX B;  2DFK A;  3ML4 A;  5CLL B;  1FGZ A;  2CY4 A;  2D9Y A;  2DHI A;  3PVW A;  2YVC A;  2DKQ A;  5D27 A;  1TQZ A;  2V76 A;  2D4Q A;  4HAT B;  2D10 A;  4GPT B;  4F7H A;  4K81 A;  5LOP B;  1DDM A;  1XCG A;  3HW2 B;  2YT0 A;  5LON B;  4CHM A;  2Y7B A;  1QQG A;  2EMT A;  1XX0 A;  1U5E A;  2RGN B;  2YRY A;  1B55 A;  1MK7 B;  1FHX A;  2W2X C;  3PG7 A;  2EJ8 A;  4HB2 B;  2VRW B;  4HAY B;  2M14 A;  4GNK B;  1K5D B;  5J3Q A;  3KRX A;  3ZDT A;  1P6S A;  3RCP A;  5IRS A;  3A98 B;  2J0M A;  1X1G A;  3F5R A;  3ULC A;  3FSS A;  2HTH B;  2RNR B;  3U8Z A;  3AU4 A;  2PZ1 A;  3PP2 A;  4A5K A;  4K2O A;  3DXE A;  5HE0 A;  1ZYI A;  1H10 A;  4CHJ A;  1FOE A;  3GYP A;  1E5W A;  1PLS A;  1U29 A;  1WG7 A;  1BWN A;  2OQB A;  1AWE A;  5D3Y A;  2Q13 A;  4HAX B;  4HB3 B;  1NU2 A;  4BBK A;  5D3X A;  1ZVR A;  1W1H A;  3A8P A;  1XOD A;  5C5B B;  3ODO A;  3ULB A;  2DLW A;  2D9V A;  1GC7 A;  1MKE A;  4P7I A;  3KY9 A;  1MPH A;  5HE1 A;  1T77 A;  2GJY A;  2D11 A;  1IRS A;  2N0Y A;  1P3R A;  1SGH A;  2YT1 A;  1MIZ B;  4KAX B;  4HB4 B;  3WYF B;  1Y19 B;  2KIG A;  1UNR A;  1AQC A;  2LG1 A;  1I7A A;  3TVV A;  5I2M A;  2HE7 A;  1PMS A;  2MWN B;  5DI9 B;  3PEG A;  3VOQ A;  1NI2 A;  4DX9 0;  4H8S A;  4F7U P;  3BIN A;  5C5B A;  5DHF B;  5HE2 A;  2OTX A;  2K2J A;  2COA A;  2P8V A;  3HK0 A;  2ROZ B;  4HDO A;  2P0F A;  1H4R A;  3U7D A;  1EGX A;  2ELA A;  2RLO A;  2GCJ A;  4ZRI A;  5FI0 A;  1EF1 A;  2I1J A;  4KHA A;  1V89 A;  5JHH A;  2H7E A;  4QJ5 B;  3O96 A;  2XQN M;  2CRF A;  1RJ2 A;  1FHW A;  4K17 A;  2GS0 A;  3NWF A;  4ZRJ A;  1MI1 A;  2Z14 A;  1M7E A;  4C0A A;  1J19 A;  1WJM A;  3TCA A;  4F7G A;  3SYX A;  2UVM A;  3PZD A;  1KI1 B;  5D3W A;  3CXB B;  2DA0 A;  2KUP A;  1LW3 A;  2DX5 A;  2IFS A;  4KVG B;  4HAV B;  1KZG A;  1UNQ A;  2X18 A;  1NTV A;  4QJ4 B;  3PVL A;  3SO6 A;  4HSI A;  3HSA A;  2DHJ A;  5LG4 B;  2AEH A;  2YT2 A;  4WJ7 A;  5C79 A;  2DHK A;  3NSU A;  4WSF A;  2VSZ A;  2J0J A;  2DX1 A;  1M7R A;  1QC6 A;  3M1I B;  4HHV A;  3KRW A;  3A58 A;  5C6R A;  2AL6 A;  5M4Y B;  2VKI A;  2YS5 A;  1DBH A;  2KUQ A;  2R09 A;  3ODW A;  3QWM A;  1OY2 A;  1BAK A;  5EFX A;  3DXC A;  3D8F A;  3KSY A;  4TKN A;  3NW8 A;  4HB0 B;  2Y8G A;  2K8E A;  3UZT A;  4QJ3 B;  5D3V A;  3OHM B;  4DIX A;  5CLQ B;  2NBV A;  1FB8 A;  2UZS A;  3WA0 A;  2LKO A;  2R2Y A;  4HAZ B;  2Z0O A;  4DX8 A;  3ODX A;  1ZC3 B;  1XKE A;  1U27 A;  4GN1 A;  4GOU A;  4IOY X;  1V88 A;  1XD4 A;  4D6W A;  2KIE A;  2Z13 A;  2RSG A;  2KCJ A;  4MY6 A;  2KGX B;  2M38 A;  3QBV B;  2KR0 A;  2NMB A;  2Z59 A;  1KZ7 A;  2K49 A;  2J0K A;  1DDV A;  5KQ4 A;  1Y5O A;  3TW1 A;  2ZPY A;  4A6K A;  2LYD A;  3KZ1 A;  1OQN A;  5KQ1 A;  3TO1 A;  1BTN A;  4HDQ A;  3HIE A;  3TFM A;  5KCV A;  3MDB C;  1J0W A;  2COC A;  1EVH A;  4B6H A;  2D9X A;  1P5T A;  2I5C A;  4A6H A;  1WGU A;  1LB1 A;  1XR0 B;  1V61 A;  2Z0Q A;  2CY5 A;  4L1R A;  4XWX A;  5J3Y A;  4NSW A;  1BTK A;  2EMS A;  4Z2N A;  5FI1 A;  1FGY A;  2DTC A;  2LOZ A;  2CAY A;  1N3H A;  1DYN A;  1FAO A;  3DXD A;  3OAN A;  4OT1 A;  1GG3 A;  5DHA B;  3V5W A;  4K2P A;  2IYB A;  3AJ4 A;  4YL8 A;  2L1C A;  2DYQ A;  3N7C A;  1UNP A;  4KHO A;  3G9W A;  3FEH A;  4PNK A;  3MPX A;  1Q67 A;  5JLJ B;  2ZKM X;  1UEF A;  4GXB A;  2R0D A;  1GC6 A; 
#chains in the Genus database with same CATH homology
 1TXD A;  5DH9 B;  3SUZ A;  2ADZ A;  2L2I A;  3D8E A;  2P0D A;  1U2B A;  5L81 A;  2DKP A;  1PFJ A;  4HAW B;  2COD A;  2RVB B;  2MDX A;  1U5G A;  2W2X D;  2Y8F A;  3P6A A;  4MK0 A;  4WVF B;  3ZVR A;  1V5P A;  3X23 A;  5C16 A;  1WJ1 A;  2QKL A;  4NY0 A;  1WI1 A;  1MAI A;  2YS1 A;  2BCJ A;  4D0N B;  4GMV A;  4L6E A;  2I5F A;  4MT7 A;  1U5D A;  4GZU A;  2D9W A;  2YF0 A;  3GYO A;  1ZSQ A;  1I2H A;  2K00 A;  1W1G A;  2RUK B;  4HAU B;  4EJN A;  4PQ0 A;  2LUL A;  3QIJ A;  3IVF A;  2K2U A;  1W1D A;  1UPR A;  3PVU A;  3PSC A;  1U5F A;  2N23 A;  5DIF B;  5JP4 A;  2UZR A;  4ZRK A;  1MIX A;  1SHC A;  2EC1 A;  1RRP B;  4IFS A;  2DN6 A;  2DYN A;  1X1F A;  2MKR A;  1OMW A;  3SNH A;  1ZC4 B;  2D9Z A;  4DXA B;  2JP2 A;  4A6F B;  2MFQ A;  3BJI A;  5HE3 A;  4TYZ A;  3VIA A;  3P7Z A;  4CYE A;  4IAP A;  1X86 A;  1V5M A;  1DRO A;  1EAZ A;  3SV1 A;  1FHO A;  2G35 A;  1MK9 B;  2J59 M;  4DBB A;  1ZM0 A;  1WGQ A;  2FJL A;  1ISN A;  1X11 A;  1Z87 A;  1X05 A;  2H7D A;  4KHB B;  2ROV A;  4EMO A;  2Z0P A;  3CIK A;  2D2Q A;  3FM8 C;  3F0W A;  4Z2M B;  4A6F A;  3LJU X;  4YON A;  2GCL A;  1K5G B;  3D8D A;  2YS3 A;  3HQC A;  2LOX A;  2YSZ A;  1UPQ A;  3T06 A;  2E2X A;  3AU5 A;  2I1K A;  1WVH A;  2ELB A;  3A8Q A;  1DDW A;  2NZ8 B;  4EKU A;  5GOW B;  2COF A;  4Y94 A;  2P0H A;  2QKM A;  1V5U A;  1TJ6 A;  1NTY A;  2W2W A;  5J3T A;  5JHG A;  4GMX B;  2DFK A;  3ML4 A;  5CLL B;  1FGZ A;  2CY4 A;  2D9Y A;  2DHI A;  3PVW A;  2YVC A;  2DKQ A;  5D27 A;  1TQZ A;  2V76 A;  2D4Q A;  4HAT B;  2D10 A;  4GPT B;  4F7H A;  4K81 A;  5LOP B;  1DDM A;  1XCG A;  3HW2 B;  2YT0 A;  5LON B;  4CHM A;  2Y7B A;  1QQG A;  2EMT A;  1XX0 A;  1U5E A;  2RGN B;  2YRY A;  1B55 A;  1MK7 B;  1FHX A;  2W2X C;  3PG7 A;  2EJ8 A;  4HB2 B;  4HAY B;  2VRW B;  2M14 A;  1K5D B;  5J3Q A;  3KRX A;  3ZDT A;  1P6S A;  3RCP A;  3A98 B;  2J0M A;  1X1G A;  3F5R A;  3ULC A;  3FSS A;  2HTH B;  2RNR B;  3U8Z A;  3AU4 A;  2PZ1 A;  3PP2 A;  4A5K A;  4K2O A;  3DXE A;  5HE0 A;  1H10 A;  4CHJ A;  1FOE A;  3GYP A;  1E5W A;  1PLS A;  1U29 A;  1WG7 A;  1BWN A;  2OQB A;  1AWE A;  5D3Y A;  2Q13 A;  4HAX B;  4HB3 B;  1NU2 A;  4BBK A;  5D3X A;  1ZVR A;  1W1H A;  3A8P A;  1XOD A;  5C5B B;  3ODO A;  3ULB A;  2DLW A;  2D9V A;  1GC7 A;  1MKE A;  4P7I A;  3KY9 A;  1MPH A;  5HE1 A;  2GJY A;  2D11 A;  1IRS A;  2N0Y A;  1P3R A;  1SGH A;  2YT1 A;  1MIZ B;  4KAX B;  4HB4 B;  3WYF B;  1Y19 B;  1UNR A;  1AQC A;  2LG1 A;  1I7A A;  3TVV A;  2HE7 A;  1PMS A;  2MWN B;  5DI9 B;  3PEG A;  3VOQ A;  1NI2 A;  4DX9 0;  4H8S A;  4F7U P;  3BIN A;  5C5B A;  5DHF B;  5HE2 A;  2OTX A;  2K2J A;  2COA A;  2P8V A;  3HK0 A;  2ROZ B;  4HDO A;  2P0F A;  1H4R A;  3U7D A;  1EGX A;  2ELA A;  2RLO A;  2GCJ A;  4ZRI A;  5FI0 A;  1EF1 A;  2I1J A;  4KHA A;  1V89 A;  5JHH A;  2H7E A;  3O96 A;  2XQN M;  2CRF A;  1RJ2 A;  1FHW A;  4K17 A;  2GS0 A;  4ZRJ A;  1M7E A;  4C0A A;  1J19 A;  1WJM A;  3TCA A;  4F7G A;  3SYX A;  2UVM A;  3PZD A;  1KI1 B;  5D3W A;  3CXB B;  2DA0 A;  2KUP A;  1LW3 A;  2DX5 A;  2IFS A;  4KVG B;  4HAV B;  1KZG A;  1UNQ A;  2X18 A;  1NTV A;  3PVL A;  3SO6 A;  2DHJ A;  2AEH A;  4WJ7 A;  5C79 A;  2DHK A;  3NSU A;  4WSF A;  2VSZ A;  2J0J A;  2DX1 A;  1M7R A;  1QC6 A;  3M1I B;  4HHV A;  3KRW A;  5C6R A;  2AL6 A;  2VKI A;  2YS5 A;  1DBH A;  2R09 A;  3ODW A;  3QWM A;  1OY2 A;  1BAK A;  5EFX A;  3DXC A;  3D8F A;  3KSY A;  4TKN A;  4HB0 B;  2Y8G A;  3UZT A;  5D3V A;  5CLQ B;  1FB8 A;  2UZS A;  3WA0 A;  2LKO A;  4HAZ B;  2Z0O A;  4DX8 A;  3ODX A;  1ZC3 B;  1XKE A;  1U27 A;  4GN1 A;  4IOY X;  1V88 A;  1XD4 A;  2RSG A;  2KCJ A;  4MY6 A;  2KGX B;  2M38 A;  3QBV B;  2NMB A;  1KZ7 A;  2J0K A;  1DDV A;  5KQ4 A;  1Y5O A;  3TW1 A;  2ZPY A;  4A6K A;  2LYD A;  3KZ1 A;  1OQN A;  5KQ1 A;  3TO1 A;  1BTN A;  4HDQ A;  3TFM A;  5KCV A;  3MDB C;  1J0W A;  2COC A;  1EVH A;  4B6H A;  2D9X A;  1P5T A;  2I5C A;  4A6H A;  1WGU A;  1LB1 A;  1XR0 B;  1V61 A;  2Z0Q A;  2CY5 A;  4XWX A;  5J3Y A;  4NSW A;  1BTK A;  2EMS A;  4Z2N A;  5FI1 A;  1FGY A;  2DTC A;  2LOZ A;  2CAY A;  1N3H A;  1DYN A;  1FAO A;  3DXD A;  3OAN A;  1GG3 A;  5DHA B;  3V5W A;  4K2P A;  2IYB A;  3AJ4 A;  4YL8 A;  2L1C A;  2DYQ A;  3N7C A;  1UNP A;  4KHO A;  3G9W A;  3FEH A;  4PNK A;  3MPX A;  1Q67 A;  5JLJ B;  1UEF A;  4GXB A;  2R0D A;  1GC6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...