1U29A

Triglycine variant of the arno pleckstrin homology domain in complex with ins(1,4,5)p3
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
119
structure length
119
Chain Sequence
PDREGWLLKLGGGRVKTWKRRWFILTDNCLYYFEYTTDKEPRGIIPLENLSIREVDDPRKPNCFELYIPNNKGQLIKACKTEADGRVVEGNHMVYRISAPTQEEKDEWIKSIQAAVSVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Lipid binding protein
molecule keywords Cytohesin 2
publication title Structural determinants of phosphoinositide selectivity in splice variants of Grp1 family PH domains
pubmed doi rcsb
source organism Mus musculus
total genus 21
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2004-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1u29A00
5JHHA 1UNQA 2CAYA 1BTKA 2YT0A 2IFSA 3X23A 4GPTB 4HATB 2RSGA 2FJLA 2MDXA 4HAZB 3ULCA 1LW3A 5HE2A 4HDQA 3SV1A 4C0AA 5L81A 3KRWA 2X18A 3QWMA 3ODOA 2RLOA 1U27A 2KGXB 1AWEA 1U5FA 3ZDTA 4CHJA 1X1GA 2Q13A 5HE1A 4DX8A 2J59M 2GCLA 1DROA 3A98B 1I7AA 1PLSA 3KSYA 3A8QA 1U2BA 1FOEA 2P8VA 1DBHA 4HHVA 3UZTA 1LB1A 1OMWA 1W1GA 1OY2A 4HB0B 3TCAA 4MK0A 1ZSQA 2I1JA 3HQCA 4KVGB 1N3HA 3V5WA 1Y5OA 1SHCA 1Q67A 4KHAA 5CLQB 1XR0B 4Z2NA 1GG3A 2OQBA 4WJ7A 2EMTA 2GJYA 2DKPA 3TO1A 1BWNA 2YS5A 1XCGA 2Z0QA 3GYPA 3TFMA 2LYDA 3PEGA 1MIZB 1K5GB 2DX1A 1FAOA 1WG7A 5KQ1A 1ZC4B 2E2XA 2YVCA 3MDBC 2L1CA 1DDWA 2ROVA 4DX90 4WVFB 1P5TA 1U5GA 2LULA 1XODA 5DHAB 1X11A 2KCJA 3IVFA 1MAIA 1XKEA 2ELBA 2RVBB 2I5CA 5LOPB 4B6HA 2D9VA 1V61A 1U29A 2N23A 4KHOA 4KHBB 1NTVA 2ADZA 3FSSA 2UZRA 4HAYB 4GZUA 2ROZB 5C6RA 4HAVB 2J0JA 4XWXA 2W2XD 3AU5A 3DXDA 3N7CA 2DA0A 4HAUB 4EJNA 1V89A 4K2PA 4ZRJA 1B55A 3KZ1A 1X86A 2W2XC 3BJIA 4A6HA 1X1FA 1W1DA 3T06A 4YONA 1M7RA 2IYBA 2Y7BA 5J3YA 5DI9B 1EF1A 1ZM0A 5D3VA 1V5UA 3PVWA 3P7ZA 4Y94A 3U7DA 1MPHA 4A6KA 5KQ4A 3F0WA 1DDMA 2CODA 3KRXA 3U8ZA 4CYEA 1UPRA 1TQZA 1UNPA 2COCA 1X05A 4DXAB 2LOXA 4NY0A 5DHFB 2CY5A 1WVHA 4PQ0A 2EMSA 4HAXB 5DH9B 3SUZA 2EC1A 4L6EA 5HE3A 3F5RA 2DKQA 2KUPA 2MKRA 2D9ZA 1H10A 2V76A 4IFSA 1TXDA 4GMXB 1FHOA 2RNRB 2COFA 5D3WA 4NSWA 3AU4A 1ISNA 4KAXB 1MK7B 1MKEA 2MFQA 2L2IA 1FHWA 1V5MA 1ZC3B 5DIFB 4K81A 2GCJA 2LG1A 5FI0A 1UPQA 1W1HA 2JP2A 3AJ4A 1KI1B 1UNRA 2YRYA 1NU2A 5GOWB 4Z2MB 4K2OA 5C16A 2LOZA 3CIKA 1NTYA 3DXCA 3WA0A 1P3RA 2VKIA 1H4RA 4A6FA 1WGUA 2D9XA 4HB3B 2YSZA 1V5PA 1RJ2A 5FI1A 2RGNB 3FEHA 5D3YA 3HW2B 1Z87A 2UZSA 3PZDA 3QBVB 1MIXA 3WYFB 1QQGA 2QKMA 3VOQA 4HAWB 4H8SA 4ZRKA 3ODXA 1J19A 1PMSA 2K2UA 2PZ1A 3DXEA 3TW1A 2MWNB 5KCVA 2DX5A 4IOYX 2H7DA 4PNKA 1WI1A 5LONB 1AQCA 2J0MA 4A6FB 3D8EA 3ODWA 4F7HA 2P0HA 5HE0A 2M14A 2N0YA 4A5KA 2RUKB 4DBBA 2DN6A 1KZ7A 3HK0A 2BCJA 1K5DB 3FM8C 5C5BB 1MK9B 2DFKA 2YF0A 4HB4B 1U5DA 3SYXA 2YS3A 2K2JA 1SGHA 2G35A 2OTXA 1M7EA 1DDVA 3NSUA 3LJUX 3A8PA 4MT7A 2R0DA 1V88A 3MPXA 1Y19B 3GYOA 5C79A 1BTNA 3M1IB 3O96A 2HTHB 4YL8A 5J3QA 2NMBA 1KZGA 2UVMA 4F7GA 2Z0OA 1TJ6A 2AEHA 1BAKA 1FGYA 3PSCA 2VRWB 3D8DA 3PVUA 3P6AA 4HB2B 1FB8A 3TVVA 1ZVRA 1EGXA 1QC6A 2D4QA 2D2QA 2CY4A 3BINA 2DHKA 1U5EA 3RCPA 4TYZA 4BBKA 3G9WA 1UEFA 1GC7A 1EVHA 2H7EA 2D10A 4GMVA 2GS0A 3PVLA 2DYNA 2ZPYA 5JHGA 3OANA 4GXBA 2DHJA 4IAPA 4EKUA 3QIJA 2COAA 4EMOA 2DLWA 1XD4A 2I1KA 3SO6A 2Y8FA 3SNHA 2ELAA 1DYNA 2YS1A 2D11A 3CXBB 1FGZA 3ZVRA 2R09A 1WJMA 1EAZA 1FHXA 2DYQA 2YT1A 4K17A 4ZRIA 4D0NB 3VIAA 3ULBA 1PFJA 2Z0PA 1IRSA 2J0KA 2HE7A 2Y8GA 1NI2A 2P0DA 2AL6A 5C5BA 3PP2A 1GC6A 5D3XA 1RRPB 2EJ8A 2D9WA 1WJ1A 2CRFA 2VSZA 5JP4A 2I5FA 1OQNA 1P6SA 4CHMA 5J3TA 1J0WA 2P0FA 4GN1A 4HDOA 2DTCA 5CLLB 2QKLA 1XX0A 3D8FA 1E5WA 5D27A 2XQNM 4F7UP 2K00A 5EFXA 1I2HA 4MY6A 4TKNA 3PG7A 5JLJB 2DHIA 2M38A 3KY9A 2W2WA 1WGQA 2LKOA 2D9YA 4WSFA 3ML4A 4P7IA 2NZ8B
chains in the Genus database with same CATH superfamily
5JHHA 1UNQA 2CAYA 1BTKA 4L1RA 2YT0A 2IFSA 3X23A 2KIEA 4GPTB 4HATB 2GUMA 2RSGA 2FJLA 2MDXA 4HAZB 3ULCA 1LW3A 5HE2A 5I2MA 4HDQA 3SV1A 4C0AA 5L81A 3KRWA 2X18A 3QWMA 3NWFA 3ODOA 2RLOA 1U27A 2KGXB 4HSIA 1AWEA 1U5FA 3ZDTA 4CHJA 1X1GA 2Q13A 5HE1A 4DX8A 2J59M 2GCLA 1DROA 3A98B 1I7AA 1PLSA 3KSYA 3A8QA 1U2BA 1FOEA 2P8VA 1DBHA 4HHVA 3UZTA 1LB1A 1OMWA 1W1GA 1OY2A 4HB0B 3TCAA 4MK0A 1ZSQA 2I1JA 3HQCA 4KVGB 1N3HA 3V5WA 1Y5OA 1SHCA 1Q67A 4KHAA 5CLQB 1XR0B 4Z2NA 1GG3A 2OQBA 4WJ7A 2EMTA 2GJYA 4KHBA 2DKPA 2YT2A 3TO1A 1BWNA 2YS5A 1XCGA 2Z0QA 3GYPA 3TFMA 2LYDA 3PEGA 1MIZB 1K5GB 2DX1A 1FAOA 1WG7A 2Z4DA 5KQ1A 1ZC4B 1ZYIA 2E2XA 2YVCA 3MDBC 2L1CA 1DDWA 2ROVA 4DX90 4WVFB 1P5TA 1U5GA 2LULA 1XODA 5DHAB 1X11A 2KCJA 3IVFA 1MAIA 1XKEA 2ELBA 2RVBB 2I5CA 5LOPB 4B6HA 2D9VA 1V61A 1U29A 2N23A 4KHOA 4KHBB 1NTVA 2ADZA 3FSSA 2UZRA 4HAYB 4GZUA 2ROZB 5C6RA 4HAVB 2J0JA 4XWXA 2W2XD 3AU5A 3DXDA 3N7CA 2DA0A 4HAUB 4EJNA 1V89A 4K2PA 2FJUB 3B77A 4ZRJA 1B55A 3KZ1A 1X86A 2W2XC 3BJIA 4A6HA 1X1FA 1W1DA 3T06A 4YONA 4QJ5B 1M7RA 2IYBA 2Y7BA 5J3YA 5DI9B 1EF1A 1ZM0A 5D3VA 1V5UA 3PVWA 3P7ZA 5LG4B 4Y94A 3U7DA 1MPHA 4A6KA 5KQ4A 3F0WA 3OHMB 1DDMA 2CODA 3KRXA 4QJ3B 3U8ZA 4CYEA 4GNKB 1UPRA 1TQZA 1UNPA 2COCA 1X05A 4DXAB 2LOXA 4NY0A 5DHFB 2CY5A 1WVHA 4PQ0A 3A58A 2EMSA 4HAXB 5DH9B 3SUZA 5IRSA 2EC1A 4L6EA 5HE3A 3F5RA 2DKQA 2KUPA 4QXAB 2MKRA 2D9ZA 1H10A 2V76A 4IFSA 1TXDA 4GMXB 1FHOA 3U12A 2RNRB 2COFA 5D3WA 4NSWA 3AU4A 1ISNA 4KAXB 1MK7B 1MKEA 2MFQA 2L2IA 1FHWA 1V5MA 1ZC3B 5DIFB 4K81A 2GCJA 2LG1A 5FI0A 1UPQA 1W1HA 2JP2A 3AJ4A 1KI1B 1UNRA 2YRYA 3FVCA 2RRFA 1NU2A 5GOWB 4Z2MB 4K2OA 2Z14A 5C16A 2LOZA 3CIKA 1NTYA 1MI1A 3DXCA 3WA0A 1P3RA 2VKIA 1H4RA 4A6FA 1WGUA 2D9XA 4HB3B 2YSZA 1V5PA 1RJ2A 5FI1A 2RGNB 3FEHA 5D3YA 3HW2B 1Z87A 2UZSA 3PZDA 3QBVB 1MIXA 3WYFB 1QQGA 2QKMA 3VOQA 4HAWB 4H8SA 4ZRKA 3ODXA 1J19A 1PMSA 2K2UA 2PZ1A 3DXEA 3TW1A 2MWNB 5KCVA 2DX5A 4IOYX 2H7DA 2KUQA 4PNKA 1WI1A 5LONB 1AQCA 2J0MA 4A6FB 3D8EA 4QJ4B 3ODWA 4F7HA 2P0HA 5HE0A 2M14A 2N0YA 4A5KA 2RUKB 4DBBA 2DN6A 1KZ7A 3HK0A 2BCJA 1K5DB 3FM8C 5C5BB 1MK9B 2DFKA 2YF0A 4HB4B 1U5DA 3SYXA 2YS3A 2K2JA 1SGHA 2G35A 2OTXA 1M7EA 1DDVA 3NSUA 3LJUX 3A8PA 4MT7A 2R0DA 1V88A 3MPXA 1Y19B 3GYOA 5C79A 4DIXA 4D6WA 1BTNA 3M1IB 3O96A 2HTHB 4YL8A 5J3QA 4OSNA 2NMBA 1KZGA 2UVMA 4F7GA 2Z0OA 1TJ6A 2AEHA 3HSAA 1BAKA 1FGYA 3PSCA 2VRWB 3D8DA 3PVUA 3P6AA 4HB2B 1FB8A 3TVVA 1ZVRA 1EGXA 1QC6A 2D4QA 2D2QA 2CY4A 3BINA 2DHKA 1U5EA 2K8EA 3RCPA 4TYZA 4BBKA 3G9WA 1UEFA 1GC7A 1EVHA 2K49A 2H7EA 2D10A 2Z59A 4GMVA 2GS0A 3PVLA 2DYNA 4GOUA 2ZPYA 5JHGA 3OANA 4GXBA 2DHJA 4IAPA 4EKUA 3QIJA 2COAA 4EMOA 2DLWA 5M4YB 1T77A 3NWAA 1XD4A 2I1KA 3SO6A 2Y8FA 2Z13A 5I2SA 3SNHA 2ELAA 1DYNA 2YS1A 2KR0A 2D11A 2KIGA 3CXBB 1FGZA 3ZVRA 2R09A 1WJMA 1EAZA 1FHXA 2DYQA 2YT1A 4K17A 4ZRIA 4D0NB 3VIAA 4CSQA 3NW8A 3ULBA 1PFJA 2Z0PA 1IRSA 2J0KA 2HE7A 2Y8GA 1NI2A 2P0DA 2AL6A 5C5BA 3PP2A 2NBVA 1GC6A 5D3XA 1RRPB 2EJ8A 2D9WA 1WJ1A 2CRFA 2VSZA 5JP4A 2I5FA 3NWDA 1OQNA 1P6SA 4CHMA 5J3TA 1J0WA 2P0FA 2ZKMX 4GN1A 4OT1A 4HDOA 2DTCA 5CLLB 2QKLA 1XX0A 3D8FA 1E5WA 5D27A 2XQNM 4F7UP 3HIEA 2K00A 5EFXA 1I2HA 4MY6A 3DCXA 4TKNA 3PG7A 5JLJB 2R2YA 2DHIA 2M38A 3KY9A 2W2WA 1WGQA 2LKOA 2D9YA 4WSFA 3ML4A 4P7IA 2NZ8B
chains in the Genus database with same CATH topology
5JHHA 1UNQA 2CAYA 1BTKA 2YT0A 2IFSA 3X23A 4GPTB 4HATB 2RSGA 2FJLA 2MDXA 4HAZB 3ULCA 1LW3A 5HE2A 4HDQA 3SV1A 4C0AA 5L81A 3KRWA 2X18A 3QWMA 3ODOA 2RLOA 1U27A 2KGXB 1AWEA 1U5FA 3ZDTA 4CHJA 1X1GA 2Q13A 5HE1A 4DX8A 2J59M 2GCLA 1DROA 3A98B 1I7AA 1PLSA 3KSYA 3A8QA 1U2BA 1FOEA 2P8VA 1DBHA 4HHVA 3UZTA 1LB1A 1OMWA 1W1GA 1OY2A 4HB0B 3TCAA 4MK0A 1ZSQA 2I1JA 3HQCA 4KVGB 1N3HA 3V5WA 1Y5OA 1SHCA 1Q67A 4KHAA 5CLQB 1XR0B 4Z2NA 1GG3A 2OQBA 4WJ7A 2EMTA 2GJYA 2DKPA 3TO1A 1BWNA 2YS5A 1XCGA 2Z0QA 3GYPA 3TFMA 2LYDA 3PEGA 1MIZB 1K5GB 2DX1A 1FAOA 1WG7A 5KQ1A 1ZC4B 2E2XA 2YVCA 3MDBC 2L1CA 1DDWA 2ROVA 4DX90 4WVFB 1P5TA 1U5GA 2LULA 1XODA 5DHAB 1X11A 2KCJA 3IVFA 1MAIA 1XKEA 2ELBA 2RVBB 2I5CA 5LOPB 4B6HA 2D9VA 1V61A 1U29A 2N23A 4KHOA 4KHBB 1NTVA 2ADZA 3FSSA 2UZRA 4HAYB 4GZUA 2ROZB 5C6RA 4HAVB 2J0JA 4XWXA 2W2XD 3AU5A 3DXDA 3N7CA 2DA0A 4HAUB 4EJNA 1V89A 4K2PA 4ZRJA 1B55A 3KZ1A 1X86A 2W2XC 3BJIA 4A6HA 1X1FA 1W1DA 3T06A 4YONA 1M7RA 2IYBA 2Y7BA 5J3YA 5DI9B 1EF1A 1ZM0A 5D3VA 1V5UA 3PVWA 3P7ZA 4Y94A 3U7DA 1MPHA 4A6KA 5KQ4A 3F0WA 1DDMA 2CODA 3KRXA 3U8ZA 4CYEA 1UPRA 1TQZA 1UNPA 2COCA 1X05A 4DXAB 2LOXA 4NY0A 5DHFB 2CY5A 1WVHA 4PQ0A 2EMSA 4HAXB 5DH9B 3SUZA 2EC1A 4L6EA 5HE3A 3F5RA 2DKQA 2KUPA 2MKRA 2D9ZA 1H10A 2V76A 4IFSA 1TXDA 4GMXB 1FHOA 2RNRB 2COFA 5D3WA 4NSWA 3AU4A 1ISNA 4KAXB 1MK7B 1MKEA 2MFQA 2L2IA 1FHWA 1V5MA 1ZC3B 5DIFB 4K81A 2GCJA 2LG1A 5FI0A 1UPQA 1W1HA 2JP2A 3AJ4A 1KI1B 1UNRA 2YRYA 1NU2A 5GOWB 4Z2MB 4K2OA 5C16A 2LOZA 3CIKA 1NTYA 3DXCA 3WA0A 1P3RA 2VKIA 1H4RA 4A6FA 1WGUA 2D9XA 4HB3B 2YSZA 1V5PA 1RJ2A 5FI1A 2RGNB 3FEHA 5D3YA 3HW2B 1Z87A 2UZSA 3PZDA 3QBVB 1MIXA 3WYFB 1QQGA 2QKMA 3VOQA 4HAWB 4H8SA 4ZRKA 3ODXA 1J19A 1PMSA 2K2UA 2PZ1A 3DXEA 3TW1A 2MWNB 5KCVA 2DX5A 4IOYX 2H7DA 4PNKA 1WI1A 5LONB 1AQCA 2J0MA 4A6FB 3D8EA 3ODWA 4F7HA 2P0HA 5HE0A 2M14A 2N0YA 4A5KA 2RUKB 4DBBA 2DN6A 1KZ7A 3HK0A 2BCJA 1K5DB 3FM8C 5C5BB 1MK9B 2DFKA 2YF0A 4HB4B 1U5DA 3SYXA 2YS3A 2K2JA 1SGHA 2G35A 2OTXA 1M7EA 1DDVA 3NSUA 3LJUX 3A8PA 4MT7A 2R0DA 1V88A 3MPXA 1Y19B 3GYOA 5C79A 1BTNA 3M1IB 3O96A 2HTHB 4YL8A 5J3QA 2NMBA 1KZGA 2UVMA 4F7GA 2Z0OA 1TJ6A 2AEHA 1BAKA 1FGYA 3PSCA 2VRWB 3D8DA 3PVUA 3P6AA 4HB2B 1FB8A 3TVVA 1ZVRA 1EGXA 1QC6A 2D4QA 2D2QA 2CY4A 3BINA 2DHKA 1U5EA 3RCPA 4TYZA 4BBKA 3G9WA 1UEFA 1GC7A 1EVHA 2H7EA 2D10A 4GMVA 2GS0A 3PVLA 2DYNA 2ZPYA 5JHGA 3OANA 4GXBA 2DHJA 4IAPA 4EKUA 3QIJA 2COAA 4EMOA 2DLWA 1XD4A 2I1KA 3SO6A 2Y8FA 3SNHA 2ELAA 1DYNA 2YS1A 2D11A 3CXBB 1FGZA 3ZVRA 2R09A 1WJMA 1EAZA 1FHXA 2DYQA 2YT1A 4K17A 4ZRIA 4D0NB 3VIAA 3ULBA 1PFJA 2Z0PA 1IRSA 2J0KA 2HE7A 2Y8GA 1NI2A 2P0DA 2AL6A 5C5BA 3PP2A 1GC6A 5D3XA 1RRPB 2EJ8A 2D9WA 1WJ1A 2CRFA 2VSZA 5JP4A 2I5FA 1OQNA 1P6SA 4CHMA 5J3TA 1J0WA 2P0FA 4GN1A 4HDOA 2DTCA 5CLLB 2QKLA 1XX0A 3D8FA 1E5WA 5D27A 2XQNM 4F7UP 2K00A 5EFXA 1I2HA 4MY6A 4TKNA 3PG7A 5JLJB 2DHIA 2M38A 3KY9A 2W2WA 1WGQA 2LKOA 2D9YA 4WSFA 3ML4A 4P7IA 2NZ8B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JHH A;  1UNQ A;  2CAY A;  1BTK A;  2YT0 A;  2IFS A;  3X23 A;  4GPT B;  4HAT B;  2RSG A;  2FJL A;  2MDX A;  4HAZ B;  3ULC A;  1LW3 A;  5HE2 A;  4HDQ A;  3SV1 A;  4C0A A;  5L81 A;  3KRW A;  2X18 A;  3QWM A;  3ODO A;  2RLO A;  1U27 A;  2KGX B;  1AWE A;  1U5F A;  3ZDT A;  4CHJ A;  1X1G A;  2Q13 A;  5HE1 A;  4DX8 A;  2J59 M;  2GCL A;  1DRO A;  3A98 B;  1I7A A;  1PLS A;  3KSY A;  3A8Q A;  1U2B A;  1FOE A;  2P8V A;  1DBH A;  4HHV A;  3UZT A;  1LB1 A;  1OMW A;  1W1G A;  1OY2 A;  4HB0 B;  3TCA A;  4MK0 A;  1ZSQ A;  2I1J A;  3HQC A;  4KVG B;  1N3H A;  3V5W A;  1Y5O A;  1SHC A;  1Q67 A;  4KHA A;  5CLQ B;  1XR0 B;  4Z2N A;  1GG3 A;  2OQB A;  4WJ7 A;  2EMT A;  2GJY A;  2DKP A;  3TO1 A;  1BWN A;  2YS5 A;  1XCG A;  2Z0Q A;  3GYP A;  3TFM A;  2LYD A;  3PEG A;  1MIZ B;  1K5G B;  2DX1 A;  1FAO A;  1WG7 A;  5KQ1 A;  1ZC4 B;  2E2X A;  2YVC A;  3MDB C;  2L1C A;  1DDW A;  2ROV A;  4DX9 0;  4WVF B;  1P5T A;  1U5G A;  2LUL A;  1XOD A;  5DHA B;  1X11 A;  2KCJ A;  3IVF A;  1MAI A;  1XKE A;  2ELB A;  2RVB B;  2I5C A;  5LOP B;  4B6H A;  2D9V A;  1V61 A;  1U29 A;  2N23 A;  4KHO A;  4KHB B;  1NTV A;  2ADZ A;  3FSS A;  2UZR A;  4HAY B;  4GZU A;  2ROZ B;  5C6R A;  4HAV B;  2J0J A;  4XWX A;  2W2X D;  3AU5 A;  3DXD A;  3N7C A;  2DA0 A;  4HAU B;  4EJN A;  1V89 A;  4K2P A;  4ZRJ A;  1B55 A;  3KZ1 A;  1X86 A;  2W2X C;  3BJI A;  4A6H A;  1X1F A;  1W1D A;  3T06 A;  4YON A;  1M7R A;  2IYB A;  2Y7B A;  5J3Y A;  5DI9 B;  1EF1 A;  1ZM0 A;  5D3V A;  1V5U A;  3PVW A;  3P7Z A;  4Y94 A;  3U7D A;  1MPH A;  4A6K A;  5KQ4 A;  3F0W A;  1DDM A;  2COD A;  3KRX A;  3U8Z A;  4CYE A;  1UPR A;  1TQZ A;  1UNP A;  2COC A;  1X05 A;  4DXA B;  2LOX A;  4NY0 A;  5DHF B;  2CY5 A;  1WVH A;  4PQ0 A;  2EMS A;  4HAX B;  5DH9 B;  3SUZ A;  2EC1 A;  4L6E A;  5HE3 A;  3F5R A;  2DKQ A;  2KUP A;  2MKR A;  2D9Z A;  1H10 A;  2V76 A;  4IFS A;  1TXD A;  4GMX B;  1FHO A;  2RNR B;  2COF A;  5D3W A;  4NSW A;  3AU4 A;  1ISN A;  4KAX B;  1MK7 B;  1MKE A;  2MFQ A;  2L2I A;  1FHW A;  1V5M A;  1ZC3 B;  5DIF B;  4K81 A;  2GCJ A;  2LG1 A;  5FI0 A;  1UPQ A;  1W1H A;  2JP2 A;  3AJ4 A;  1KI1 B;  1UNR A;  2YRY A;  1NU2 A;  5GOW B;  4Z2M B;  4K2O A;  5C16 A;  2LOZ A;  3CIK A;  1NTY A;  3DXC A;  3WA0 A;  1P3R A;  2VKI A;  1H4R A;  4A6F A;  1WGU A;  2D9X A;  4HB3 B;  2YSZ A;  1V5P A;  1RJ2 A;  5FI1 A;  2RGN B;  3FEH A;  5D3Y A;  3HW2 B;  1Z87 A;  2UZS A;  3PZD A;  3QBV B;  1MIX A;  3WYF B;  1QQG A;  2QKM A;  3VOQ A;  4HAW B;  4H8S A;  4ZRK A;  3ODX A;  1J19 A;  1PMS A;  2K2U A;  2PZ1 A;  3DXE A;  3TW1 A;  2MWN B;  5KCV A;  2DX5 A;  4IOY X;  2H7D A;  4PNK A;  1WI1 A;  5LON B;  1AQC A;  2J0M A;  4A6F B;  3D8E A;  3ODW A;  4F7H A;  2P0H A;  5HE0 A;  2M14 A;  2N0Y A;  4A5K A;  2RUK B;  4DBB A;  2DN6 A;  1KZ7 A;  3HK0 A;  2BCJ A;  1K5D B;  3FM8 C;  5C5B B;  1MK9 B;  2DFK A;  2YF0 A;  4HB4 B;  1U5D A;  3SYX A;  2YS3 A;  2K2J A;  1SGH A;  2G35 A;  2OTX A;  1M7E A;  1DDV A;  3NSU A;  3LJU X;  3A8P A;  4MT7 A;  2R0D A;  1V88 A;  3MPX A;  1Y19 B;  3GYO A;  5C79 A;  1BTN A;  3M1I B;  3O96 A;  2HTH B;  4YL8 A;  5J3Q A;  2NMB A;  1KZG A;  2UVM A;  4F7G A;  2Z0O A;  1TJ6 A;  2AEH A;  1BAK A;  1FGY A;  3PSC A;  2VRW B;  3D8D A;  3PVU A;  3P6A A;  4HB2 B;  1FB8 A;  3TVV A;  1ZVR A;  1EGX A;  1QC6 A;  2D4Q A;  2D2Q A;  2CY4 A;  3BIN A;  2DHK A;  1U5E A;  3RCP A;  4TYZ A;  4BBK A;  3G9W A;  1UEF A;  1GC7 A;  1EVH A;  2H7E A;  2D10 A;  4GMV A;  2GS0 A;  3PVL A;  2DYN A;  2ZPY A;  5JHG A;  3OAN A;  4GXB A;  2DHJ A;  4IAP A;  4EKU A;  3QIJ A;  2COA A;  4EMO A;  2DLW A;  1XD4 A;  2I1K A;  3SO6 A;  2Y8F A;  3SNH A;  2ELA A;  1DYN A;  2YS1 A;  2D11 A;  3CXB B;  1FGZ A;  3ZVR A;  2R09 A;  1WJM A;  1EAZ A;  1FHX A;  2DYQ A;  2YT1 A;  4K17 A;  4ZRI A;  4D0N B;  3VIA A;  3ULB A;  1PFJ A;  2Z0P A;  1IRS A;  2J0K A;  2HE7 A;  2Y8G A;  1NI2 A;  2P0D A;  2AL6 A;  5C5B A;  3PP2 A;  1GC6 A;  5D3X A;  1RRP B;  2EJ8 A;  2D9W A;  1WJ1 A;  2CRF A;  2VSZ A;  5JP4 A;  2I5F A;  1OQN A;  1P6S A;  4CHM A;  5J3T A;  1J0W A;  2P0F A;  4GN1 A;  4HDO A;  2DTC A;  5CLL B;  2QKL A;  1XX0 A;  3D8F A;  1E5W A;  5D27 A;  2XQN M;  4F7U P;  2K00 A;  5EFX A;  1I2H A;  4MY6 A;  4TKN A;  3PG7 A;  5JLJ B;  2DHI A;  2M38 A;  3KY9 A;  2W2W A;  1WGQ A;  2LKO A;  2D9Y A;  4WSF A;  3ML4 A;  4P7I A;  2NZ8 B; 
#chains in the Genus database with same CATH topology
 5JHH A;  1UNQ A;  2CAY A;  1BTK A;  4L1R A;  2YT0 A;  2IFS A;  3X23 A;  2KIE A;  4GPT B;  4HAT B;  2GUM A;  2RSG A;  2FJL A;  2MDX A;  4HAZ B;  3ULC A;  1LW3 A;  5HE2 A;  5I2M A;  4HDQ A;  3SV1 A;  4C0A A;  5L81 A;  3KRW A;  2X18 A;  3QWM A;  3NWF A;  3ODO A;  2RLO A;  1U27 A;  2KGX B;  4HSI A;  1AWE A;  1U5F A;  3ZDT A;  4CHJ A;  1X1G A;  2Q13 A;  5HE1 A;  4DX8 A;  2J59 M;  2GCL A;  1DRO A;  3A98 B;  1I7A A;  1PLS A;  3KSY A;  3A8Q A;  1U2B A;  1FOE A;  2P8V A;  1DBH A;  4HHV A;  3UZT A;  1LB1 A;  1OMW A;  1W1G A;  1OY2 A;  4HB0 B;  3TCA A;  4MK0 A;  1ZSQ A;  2I1J A;  3HQC A;  4KVG B;  1N3H A;  3V5W A;  1Y5O A;  1SHC A;  1Q67 A;  4KHA A;  5CLQ B;  1XR0 B;  4Z2N A;  1GG3 A;  2OQB A;  4WJ7 A;  2EMT A;  2GJY A;  4KHB A;  2DKP A;  2YT2 A;  3TO1 A;  1BWN A;  2YS5 A;  1XCG A;  2Z0Q A;  3GYP A;  3TFM A;  2LYD A;  3PEG A;  1MIZ B;  1K5G B;  2DX1 A;  1FAO A;  1WG7 A;  2Z4D A;  5KQ1 A;  1ZC4 B;  1ZYI A;  2E2X A;  2YVC A;  3MDB C;  2L1C A;  1DDW A;  2ROV A;  4DX9 0;  4WVF B;  1P5T A;  1U5G A;  2LUL A;  1XOD A;  5DHA B;  1X11 A;  2KCJ A;  3IVF A;  1MAI A;  1XKE A;  2ELB A;  2RVB B;  2I5C A;  5LOP B;  4B6H A;  2D9V A;  1V61 A;  1U29 A;  2N23 A;  4KHO A;  4KHB B;  1NTV A;  2ADZ A;  3FSS A;  2UZR A;  4HAY B;  4GZU A;  2ROZ B;  5C6R A;  4HAV B;  2J0J A;  4XWX A;  2W2X D;  3AU5 A;  3DXD A;  3N7C A;  2DA0 A;  4HAU B;  4EJN A;  1V89 A;  4K2P A;  2FJU B;  3B77 A;  4ZRJ A;  1B55 A;  3KZ1 A;  1X86 A;  2W2X C;  3BJI A;  4A6H A;  1X1F A;  1W1D A;  3T06 A;  4YON A;  4QJ5 B;  1M7R A;  2IYB A;  2Y7B A;  5J3Y A;  5DI9 B;  1EF1 A;  1ZM0 A;  5D3V A;  1V5U A;  3PVW A;  3P7Z A;  5LG4 B;  4Y94 A;  3U7D A;  1MPH A;  4A6K A;  5KQ4 A;  3F0W A;  3OHM B;  1DDM A;  2COD A;  3KRX A;  4QJ3 B;  3U8Z A;  4CYE A;  4GNK B;  1UPR A;  1TQZ A;  1UNP A;  2COC A;  1X05 A;  4DXA B;  2LOX A;  4NY0 A;  5DHF B;  2CY5 A;  1WVH A;  4PQ0 A;  3A58 A;  2EMS A;  4HAX B;  5DH9 B;  3SUZ A;  5IRS A;  2EC1 A;  4L6E A;  5HE3 A;  3F5R A;  2DKQ A;  2KUP A;  4QXA B;  2MKR A;  2D9Z A;  1H10 A;  2V76 A;  4IFS A;  1TXD A;  4GMX B;  1FHO A;  3U12 A;  2RNR B;  2COF A;  5D3W A;  4NSW A;  3AU4 A;  1ISN A;  4KAX B;  1MK7 B;  1MKE A;  2MFQ A;  2L2I A;  1FHW A;  1V5M A;  1ZC3 B;  5DIF B;  4K81 A;  2GCJ A;  2LG1 A;  5FI0 A;  1UPQ A;  1W1H A;  2JP2 A;  3AJ4 A;  1KI1 B;  1UNR A;  2YRY A;  3FVC A;  2RRF A;  1NU2 A;  5GOW B;  4Z2M B;  4K2O A;  2Z14 A;  5C16 A;  2LOZ A;  3CIK A;  1NTY A;  1MI1 A;  3DXC A;  3WA0 A;  1P3R A;  2VKI A;  1H4R A;  4A6F A;  1WGU A;  2D9X A;  4HB3 B;  2YSZ A;  1V5P A;  1RJ2 A;  5FI1 A;  2RGN B;  3FEH A;  5D3Y A;  3HW2 B;  1Z87 A;  2UZS A;  3PZD A;  3QBV B;  1MIX A;  3WYF B;  1QQG A;  2QKM A;  3VOQ A;  4HAW B;  4H8S A;  4ZRK A;  3ODX A;  1J19 A;  1PMS A;  2K2U A;  2PZ1 A;  3DXE A;  3TW1 A;  2MWN B;  5KCV A;  2DX5 A;  4IOY X;  2H7D A;  2KUQ A;  4PNK A;  1WI1 A;  5LON B;  1AQC A;  2J0M A;  4A6F B;  3D8E A;  4QJ4 B;  3ODW A;  4F7H A;  2P0H A;  5HE0 A;  2M14 A;  2N0Y A;  4A5K A;  2RUK B;  4DBB A;  2DN6 A;  1KZ7 A;  3HK0 A;  2BCJ A;  1K5D B;  3FM8 C;  5C5B B;  1MK9 B;  2DFK A;  2YF0 A;  4HB4 B;  1U5D A;  3SYX A;  2YS3 A;  2K2J A;  1SGH A;  2G35 A;  2OTX A;  1M7E A;  1DDV A;  3NSU A;  3LJU X;  3A8P A;  4MT7 A;  2R0D A;  1V88 A;  3MPX A;  1Y19 B;  3GYO A;  5C79 A;  4DIX A;  4D6W A;  1BTN A;  3M1I B;  3O96 A;  2HTH B;  4YL8 A;  5J3Q A;  4OSN A;  2NMB A;  1KZG A;  2UVM A;  4F7G A;  2Z0O A;  1TJ6 A;  2AEH A;  3HSA A;  1BAK A;  1FGY A;  3PSC A;  2VRW B;  3D8D A;  3PVU A;  3P6A A;  4HB2 B;  1FB8 A;  3TVV A;  1ZVR A;  1EGX A;  1QC6 A;  2D4Q A;  2D2Q A;  2CY4 A;  3BIN A;  2DHK A;  1U5E A;  2K8E A;  3RCP A;  4TYZ A;  4BBK A;  3G9W A;  1UEF A;  1GC7 A;  1EVH A;  2K49 A;  2H7E A;  2D10 A;  2Z59 A;  4GMV A;  2GS0 A;  3PVL A;  2DYN A;  4GOU A;  2ZPY A;  5JHG A;  3OAN A;  4GXB A;  2DHJ A;  4IAP A;  4EKU A;  3QIJ A;  2COA A;  4EMO A;  2DLW A;  5M4Y B;  1T77 A;  3NWA A;  1XD4 A;  2I1K A;  3SO6 A;  2Y8F A;  2Z13 A;  5I2S A;  3SNH A;  2ELA A;  1DYN A;  2YS1 A;  2KR0 A;  2D11 A;  2KIG A;  3CXB B;  1FGZ A;  3ZVR A;  2R09 A;  1WJM A;  1EAZ A;  1FHX A;  2DYQ A;  2YT1 A;  4K17 A;  4ZRI A;  4D0N B;  3VIA A;  4CSQ A;  3NW8 A;  3ULB A;  1PFJ A;  2Z0P A;  1IRS A;  2J0K A;  2HE7 A;  2Y8G A;  1NI2 A;  2P0D A;  2AL6 A;  5C5B A;  3PP2 A;  2NBV A;  1GC6 A;  5D3X A;  1RRP B;  2EJ8 A;  2D9W A;  1WJ1 A;  2CRF A;  2VSZ A;  5JP4 A;  2I5F A;  3NWD A;  1OQN A;  1P6S A;  4CHM A;  5J3T A;  1J0W A;  2P0F A;  2ZKM X;  4GN1 A;  4OT1 A;  4HDO A;  2DTC A;  5CLL B;  2QKL A;  1XX0 A;  3D8F A;  1E5W A;  5D27 A;  2XQN M;  4F7U P;  3HIE A;  2K00 A;  5EFX A;  1I2H A;  4MY6 A;  3DCX A;  4TKN A;  3PG7 A;  5JLJ B;  2R2Y A;  2DHI A;  2M38 A;  3KY9 A;  2W2W A;  1WGQ A;  2LKO A;  2D9Y A;  4WSF A;  3ML4 A;  4P7I A;  2NZ8 B; 
#chains in the Genus database with same CATH homology
 5JHH A;  1UNQ A;  2CAY A;  1BTK A;  2YT0 A;  2IFS A;  3X23 A;  4GPT B;  4HAT B;  2RSG A;  2FJL A;  2MDX A;  4HAZ B;  3ULC A;  1LW3 A;  5HE2 A;  4HDQ A;  3SV1 A;  4C0A A;  5L81 A;  3KRW A;  2X18 A;  3QWM A;  3ODO A;  2RLO A;  1U27 A;  2KGX B;  1AWE A;  1U5F A;  3ZDT A;  4CHJ A;  1X1G A;  2Q13 A;  5HE1 A;  4DX8 A;  2J59 M;  2GCL A;  1DRO A;  3A98 B;  1I7A A;  1PLS A;  3KSY A;  3A8Q A;  1U2B A;  1FOE A;  2P8V A;  1DBH A;  4HHV A;  3UZT A;  1LB1 A;  1OMW A;  1W1G A;  1OY2 A;  4HB0 B;  3TCA A;  4MK0 A;  1ZSQ A;  2I1J A;  3HQC A;  4KVG B;  1N3H A;  3V5W A;  1Y5O A;  1SHC A;  1Q67 A;  4KHA A;  5CLQ B;  1XR0 B;  4Z2N A;  1GG3 A;  2OQB A;  4WJ7 A;  2EMT A;  2GJY A;  2DKP A;  3TO1 A;  1BWN A;  2YS5 A;  1XCG A;  2Z0Q A;  3GYP A;  3TFM A;  2LYD A;  3PEG A;  1MIZ B;  1K5G B;  2DX1 A;  1FAO A;  1WG7 A;  5KQ1 A;  1ZC4 B;  2E2X A;  2YVC A;  3MDB C;  2L1C A;  1DDW A;  2ROV A;  4DX9 0;  4WVF B;  1P5T A;  1U5G A;  2LUL A;  1XOD A;  5DHA B;  1X11 A;  2KCJ A;  3IVF A;  1MAI A;  1XKE A;  2ELB A;  2RVB B;  2I5C A;  5LOP B;  4B6H A;  2D9V A;  1V61 A;  1U29 A;  2N23 A;  4KHO A;  4KHB B;  1NTV A;  2ADZ A;  3FSS A;  2UZR A;  4HAY B;  4GZU A;  2ROZ B;  5C6R A;  4HAV B;  2J0J A;  4XWX A;  2W2X D;  3AU5 A;  3DXD A;  3N7C A;  2DA0 A;  4HAU B;  4EJN A;  1V89 A;  4K2P A;  4ZRJ A;  1B55 A;  3KZ1 A;  1X86 A;  2W2X C;  3BJI A;  4A6H A;  1X1F A;  1W1D A;  3T06 A;  4YON A;  1M7R A;  2IYB A;  2Y7B A;  5J3Y A;  5DI9 B;  1EF1 A;  1ZM0 A;  5D3V A;  1V5U A;  3PVW A;  3P7Z A;  4Y94 A;  3U7D A;  1MPH A;  4A6K A;  5KQ4 A;  3F0W A;  1DDM A;  2COD A;  3KRX A;  3U8Z A;  4CYE A;  1UPR A;  1TQZ A;  1UNP A;  2COC A;  1X05 A;  4DXA B;  2LOX A;  4NY0 A;  5DHF B;  2CY5 A;  1WVH A;  4PQ0 A;  2EMS A;  4HAX B;  5DH9 B;  3SUZ A;  2EC1 A;  4L6E A;  5HE3 A;  3F5R A;  2DKQ A;  2KUP A;  2MKR A;  2D9Z A;  1H10 A;  2V76 A;  4IFS A;  1TXD A;  4GMX B;  1FHO A;  2RNR B;  2COF A;  5D3W A;  4NSW A;  3AU4 A;  1ISN A;  4KAX B;  1MK7 B;  1MKE A;  2MFQ A;  2L2I A;  1FHW A;  1V5M A;  1ZC3 B;  5DIF B;  4K81 A;  2GCJ A;  2LG1 A;  5FI0 A;  1UPQ A;  1W1H A;  2JP2 A;  3AJ4 A;  1KI1 B;  1UNR A;  2YRY A;  1NU2 A;  5GOW B;  4Z2M B;  4K2O A;  5C16 A;  2LOZ A;  3CIK A;  1NTY A;  3DXC A;  3WA0 A;  1P3R A;  2VKI A;  1H4R A;  4A6F A;  1WGU A;  2D9X A;  4HB3 B;  2YSZ A;  1V5P A;  1RJ2 A;  5FI1 A;  2RGN B;  3FEH A;  5D3Y A;  3HW2 B;  1Z87 A;  2UZS A;  3PZD A;  3QBV B;  1MIX A;  3WYF B;  1QQG A;  2QKM A;  3VOQ A;  4HAW B;  4H8S A;  4ZRK A;  3ODX A;  1J19 A;  1PMS A;  2K2U A;  2PZ1 A;  3DXE A;  3TW1 A;  2MWN B;  5KCV A;  2DX5 A;  4IOY X;  2H7D A;  4PNK A;  1WI1 A;  5LON B;  1AQC A;  2J0M A;  4A6F B;  3D8E A;  3ODW A;  4F7H A;  2P0H A;  5HE0 A;  2M14 A;  2N0Y A;  4A5K A;  2RUK B;  4DBB A;  2DN6 A;  1KZ7 A;  3HK0 A;  2BCJ A;  1K5D B;  3FM8 C;  5C5B B;  1MK9 B;  2DFK A;  2YF0 A;  4HB4 B;  1U5D A;  3SYX A;  2YS3 A;  2K2J A;  1SGH A;  2G35 A;  2OTX A;  1M7E A;  1DDV A;  3NSU A;  3LJU X;  3A8P A;  4MT7 A;  2R0D A;  1V88 A;  3MPX A;  1Y19 B;  3GYO A;  5C79 A;  1BTN A;  3M1I B;  3O96 A;  2HTH B;  4YL8 A;  5J3Q A;  2NMB A;  1KZG A;  2UVM A;  4F7G A;  2Z0O A;  1TJ6 A;  2AEH A;  1BAK A;  1FGY A;  3PSC A;  2VRW B;  3D8D A;  3PVU A;  3P6A A;  4HB2 B;  1FB8 A;  3TVV A;  1ZVR A;  1EGX A;  1QC6 A;  2D4Q A;  2D2Q A;  2CY4 A;  3BIN A;  2DHK A;  1U5E A;  3RCP A;  4TYZ A;  4BBK A;  3G9W A;  1UEF A;  1GC7 A;  1EVH A;  2H7E A;  2D10 A;  4GMV A;  2GS0 A;  3PVL A;  2DYN A;  2ZPY A;  5JHG A;  3OAN A;  4GXB A;  2DHJ A;  4IAP A;  4EKU A;  3QIJ A;  2COA A;  4EMO A;  2DLW A;  1XD4 A;  2I1K A;  3SO6 A;  2Y8F A;  3SNH A;  2ELA A;  1DYN A;  2YS1 A;  2D11 A;  3CXB B;  1FGZ A;  3ZVR A;  2R09 A;  1WJM A;  1EAZ A;  1FHX A;  2DYQ A;  2YT1 A;  4K17 A;  4ZRI A;  4D0N B;  3VIA A;  3ULB A;  1PFJ A;  2Z0P A;  1IRS A;  2J0K A;  2HE7 A;  2Y8G A;  1NI2 A;  2P0D A;  2AL6 A;  5C5B A;  3PP2 A;  1GC6 A;  5D3X A;  1RRP B;  2EJ8 A;  2D9W A;  1WJ1 A;  2CRF A;  2VSZ A;  5JP4 A;  2I5F A;  1OQN A;  1P6S A;  4CHM A;  5J3T A;  1J0W A;  2P0F A;  4GN1 A;  4HDO A;  2DTC A;  5CLL B;  2QKL A;  1XX0 A;  3D8F A;  1E5W A;  5D27 A;  2XQN M;  4F7U P;  2K00 A;  5EFX A;  1I2H A;  4MY6 A;  4TKN A;  3PG7 A;  5JLJ B;  2DHI A;  2M38 A;  3KY9 A;  2W2W A;  1WGQ A;  2LKO A;  2D9Y A;  4WSF A;  3ML4 A;  4P7I A;  2NZ8 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...