3QWMA

Crystal structure of gep100, the plextrin homology domain of iq motif and sec7 domain-containing protein 1 isoform a
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
130
structure length
127
Chain Sequence
HRRLVCYCRLFEVPDPNKPQKLGLHQREIFLFNDLLVVTKIFQNSVTYSFRQSFSLYGMQVLLFENQYYPNGIRLTSSVPGADIKVLINFNAPNPQDRKKFTDDLRESIAEVQEMEKHRIESELEKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Signaling protein
molecule keywords IQ motif and SEC7 domain-containing protein 1
publication title Crystal Structure of GEP100, the plextrin homology domain of IQ motif and SEC7 domain-containing protein 1 isoform a
rcsb
source organism Homo sapiens
total genus 31
structure length 127
sequence length 130
ec nomenclature
pdb deposition date 2011-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16453 IQ_SEC7_PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3qwmA00
1BWNA 2KCJA 3WYFB 2K00A 4WVFB 3DXCA 3HK0A 5FI1A 2ADZA 5JHHA 4XWXA 2J59M 2PZ1A 3P6AA 2YT1A 4A6FA 3T06A 3VOQA 1Y19B 2YS1A 5D3WA 4K81A 1FGZA 5FI0A 1KZGA 1NU2A 2MKRA 4NSWA 1BAKA 1K5GB 3D8FA 4HAUB 4IOYX 2DHKA 1XODA 3SO6A 4KHBB 4HAVB 1UNQA 5J3QA 3OANA 1I2HA 3VIAA 1XCGA 2D9ZA 1XD4A 1B55A 1P5TA 2DTCA 1RRPB 2P0HA 2W2XC 2KGXB 3DXDA 4GXBA 1J0WA 4MT7A 2K2UA 2Z0PA 4GPTB 2OQBA 1KI1B 5GOWB 5CLQB 3TO1A 1ZC3B 2LULA 2EJ8A 5DIFB 3D8EA 2YF0A 3FSSA 1V5UA 5EFXA 1P6SA 1MIZB 2K2JA 2N23A 1OQNA 2YS5A 4HDOA 4HB2B 3LJUX 5HE0A 4H8SA 3D8DA 3A98B 2J0KA 3WA0A 2Y8FA 1Q67A 1GC7A 1XKEA 1RJ2A 3QWMA 2L1CA 3PZDA 1MK9B 2D9XA 2DX1A 1M7RA 3HQCA 4GZUA 1LW3A 2DKPA 1TXDA 5KCVA 2MFQA 2R0DA 3V5WA 4MK0A 1W1HA 2YT0A 4MY6A 2D9VA 2QKMA 2I5CA 2UZRA 3ODOA 2CY5A 3MPXA 2ELBA 3PP2A 2Z0OA 3G9WA 2JP2A 3A8QA 2IYBA 1XR0B 1W1GA 2CODA 2KUPA 2Z0QA 1X11A 3KRXA 2G35A 2N0YA 2R09A 3F0WA 3N7CA 1OY2A 4Z2NA 2DX5A 4TYZA 1WVHA 1FB8A 1DDWA 2I1JA 1Z87A 1DBHA 2P0FA 2L2IA 3IVFA 5D3YA 3TW1A 1U29A 2ROVA 3SYXA 1UNRA 3P7ZA 4IFSA 2I1KA 1X86A 5D3XA 3SUZA 5L81A 2H7EA 1FHXA 4EJNA 2ZPYA 1W1DA 3X23A 4PNKA 2XQNM 3DXEA 1GG3A 2CAYA 4A6FB 2Y8GA 1U5DA 4K2OA 1V88A 2VKIA 4Y94A 5D27A 1SHCA 2D4QA 4CHJA 3PVUA 4A6KA 2I5FA 2DYNA 3UZTA 3FEHA 4K17A 3GYPA 2EC1A 1NTYA 4HAZB 1PMSA 5DH9B 1SGHA 5HE1A 3PEGA 2DA0A 2ELAA 1QC6A 2DHIA 2RGNB 4HAWB 1FAOA 4K2PA 2Y7BA 4DXAB 4DBBA 4Z2MB 1K5DB 2UZSA 1FOEA 3KZ1A 5JLJB 1H4RA 2V76A 3ULCA 4F7UP 5HE3A 5DHAB 1FHOA 1PFJA 1ZM0A 2RNRB 2EMSA 1X1FA 5C5BA 1NTVA 3PSCA 1WJMA 3QBVB 4HB3B 2P8VA 1KZ7A 1MKEA 4HAYB 4A6HA 3QIJA 2CRFA 1V61A 1WG7A 1XX0A 1H10A 1WI1A 3ZVRA 1WGUA 1EGXA 3CIKA 2X18A 2HTHB 1ZVRA 4HATB 5C6RA 1PLSA 2M14A 2OTXA 3KSYA 3U8ZA 4C0AA 2DHJA 1V89A 5KQ1A 2COFA 1DROA 2COCA 4P7IA 1E5WA 2RLOA 5DHFB 2CY4A 4GMVA 2VSZA 2D2QA 1FHWA 4TKNA 3PVWA 4ZRIA 1X05A 1FGYA 1LB1A 2MDXA 3MDBC 1U5FA 4YL8A 4HAXB 2W2WA 2P0DA 2Q13A 3KY9A 5JHGA 5J3YA 1ZSQA 1UPQA 3ML4A 1I7AA 4NY0A 1DDMA 4CYEA 1EAZA 4DX8A 1QQGA 2H7DA 1MAIA 1N3HA 4L6EA 3BINA 3AU4A 1U27A 1NI2A 2LKOA 4F7HA 2GCJA 1MIXA 4IAPA 4KHAA 4EKUA 1DYNA 3U7DA 1TQZA 4KVGB 1WJ1A 3CXBB 4DX90 2DKQA 1U5GA 3ZDTA 3AJ4A 2D9WA 2AL6A 1UEFA 2DYQA 1BTNA 3AU5A 1WGQA 5KQ4A 1V5PA 2NZ8B 2DN6A 3F5RA 2LOXA 2J0JA 2E2XA 2LOZA 2D11A 5CLLB 2W2XD 2FJLA 1V5MA 5J3TA 5JP4A 4HHVA 1X1GA 1IRSA 2UVMA 3ODWA 2YSZA 1MK7B 2ROZB 4ZRJA 2MWNB 2YRYA 3ULBA 4HB4B 3KRWA 1BTKA 1M7EA 1ZC4B 2VRWB 2GS0A 4HDQA 5DI9B 1OMWA 4A5KA 3HW2B 4GN1A 2NMBA 5D3VA 5C16A 3RCPA 3BJIA 4PQ0A 1EVHA 5LONB 2RUKB 2DFKA 1EF1A 5HE2A 1P3RA 4ZRKA 1GC6A 2QKLA 1ISNA 2RSGA 3PG7A 3M1IB 3NSUA 2AEHA 2EMTA 2BCJA 3SNHA 3GYOA 1MPHA 4WSFA 1UNPA 1UPRA 4YONA 2YVCA 5C5BB 2M38A 2DLWA 3TCAA 4KAXB 4BBKA 1Y5OA 4F7GA 2D9YA 3TVVA 2LYDA 1U2BA 1AWEA 2COAA 2IFSA 1J19A 1DDVA 4B6HA 5C79A 2D10A 2LG1A 2J0MA 3O96A 4D0NB 2GCLA 3PVLA 4WJ7A 3A8PA 3SV1A 2RVBB 3FM8C 3ODXA 2YS3A 4HB0B 1AQCA 2GJYA 1TJ6A 4CHMA 5LOPB 4GMXB 2HE7A 1U5EA 3TFMA 4KHOA 4EMOA
chains in the Genus database with same CATH superfamily
1BWNA 2KCJA 3DCXA 3WYFB 2K00A 4WVFB 3DXCA 3HK0A 5FI1A 2ADZA 5JHHA 4XWXA 2J59M 2PZ1A 3P6AA 2YT1A 4A6FA 3T06A 3VOQA 2KUQA 1Y19B 2YS1A 5D3WA 4K81A 2RRFA 1FGZA 5FI0A 1KZGA 3OHMB 1NU2A 2MKRA 3NWAA 4NSWA 1BAKA 1K5GB 1ZYIA 3D8FA 4HAUB 4QJ4B 4IOYX 2DHKA 1XODA 3NWFA 3SO6A 4KHBB 4HAVB 1UNQA 5J3QA 3OANA 1I2HA 3VIAA 1XCGA 2D9ZA 2K49A 1XD4A 1B55A 1P5TA 2DTCA 1RRPB 2NBVA 2P0HA 2W2XC 2KGXB 3DXDA 4GXBA 1J0WA 4MT7A 2K2UA 2Z0PA 4GPTB 2OQBA 1KI1B 5GOWB 5CLQB 3TO1A 1ZC3B 2LULA 2EJ8A 5DIFB 3D8EA 2YF0A 3FSSA 3B77A 5I2SA 1V5UA 5EFXA 1P6SA 1MIZB 2K2JA 2N23A 1OQNA 2YS5A 4HDOA 4HB2B 3LJUX 5HE0A 4H8SA 3D8DA 3A98B 2J0KA 3WA0A 2GUMA 2Y8FA 1Q67A 1GC7A 1XKEA 1RJ2A 3QWMA 2L1CA 3PZDA 1MK9B 2D9XA 1T77A 2DX1A 4D6WA 1M7RA 3HQCA 4GZUA 2YT2A 1LW3A 2DKPA 4OT1A 1TXDA 5KCVA 4GNKB 2MFQA 2R0DA 3V5WA 4MK0A 1W1HA 2YT0A 4MY6A 2D9VA 2QKMA 2I5CA 2KIEA 2UZRA 3ODOA 2CY5A 3MPXA 2ELBA 3PP2A 2Z0OA 2FJUB 3G9WA 2JP2A 3A8QA 2IYBA 1XR0B 1W1GA 2CODA 2KUPA 2Z0QA 1X11A 3KRXA 2G35A 2N0YA 2R09A 3F0WA 4L1RA 3N7CA 1OY2A 4Z2NA 2DX5A 4TYZA 1WVHA 1FB8A 1DDWA 2I1JA 1Z87A 1DBHA 2P0FA 2L2IA 3IVFA 5D3YA 3TW1A 1U29A 2ROVA 3SYXA 1UNRA 3P7ZA 4IFSA 2I1KA 1X86A 5D3XA 3SUZA 5L81A 2H7EA 1FHXA 4QXAB 2ZPYA 4EJNA 1W1DA 3X23A 4PNKA 2XQNM 3DXEA 1GG3A 2CAYA 4A6FB 2Y8GA 1U5DA 4K2OA 4KHBA 1V88A 2VKIA 4Y94A 5D27A 5IRSA 1SHCA 2D4QA 4CHJA 2KR0A 3PVUA 4A6KA 2I5FA 2DYNA 3UZTA 3FEHA 4K17A 3GYPA 2EC1A 1NTYA 4HAZB 1PMSA 5DH9B 1SGHA 5HE1A 3PEGA 2DA0A 2ELAA 1QC6A 2DHIA 2RGNB 4HAWB 1FAOA 4K2PA 2Y7BA 4DXAB 4HSIA 4DBBA 4Z2MB 1K5DB 2UZSA 1FOEA 3KZ1A 5JLJB 2R2YA 1H4RA 3NWDA 2V76A 3ULCA 4F7UP 5HE3A 5DHAB 1FHOA 1PFJA 1ZM0A 2RNRB 2EMSA 1X1FA 5C5BA 1NTVA 3PSCA 1WJMA 3QBVB 4QJ5B 4HB3B 2P8VA 1KZ7A 1MKEA 3U12A 4HAYB 4A6HA 3QIJA 2CRFA 1V61A 1WG7A 1XX0A 1H10A 1WI1A 3ZVRA 1WGUA 1EGXA 3CIKA 2X18A 2HTHB 1ZVRA 4HATB 5C6RA 1PLSA 2M14A 2OTXA 3KSYA 3U8ZA 4C0AA 2DHJA 1V89A 5KQ1A 2COFA 1DROA 2COCA 4P7IA 1E5WA 2RLOA 5M4YB 5DHFB 2CY4A 4GMVA 2VSZA 2D2QA 1FHWA 4TKNA 3PVWA 4ZRIA 1X05A 1FGYA 1LB1A 2MDXA 2Z13A 3MDBC 1U5FA 4YL8A 4HAXB 2W2WA 3FVCA 2P0DA 2Q13A 3KY9A 5JHGA 5J3YA 1ZSQA 1UPQA 3ML4A 1I7AA 4OSNA 4NY0A 1DDMA 4CYEA 1EAZA 4DX8A 1QQGA 2H7DA 1MAIA 1N3HA 4L6EA 3BINA 4GOUA 3AU4A 1U27A 1NI2A 2LKOA 4F7HA 2GCJA 1MIXA 4IAPA 4KHAA 4EKUA 1DYNA 2Z4DA 3U7DA 1TQZA 4KVGB 1WJ1A 3CXBB 4DX90 2DKQA 1U5GA 3ZDTA 3AJ4A 2ZKMX 5LG4B 2D9WA 2AL6A 1UEFA 4CSQA 2DYQA 1BTNA 3AU5A 1WGQA 5KQ4A 4DIXA 1V5PA 2NZ8B 2DN6A 3F5RA 2LOXA 2J0JA 2E2XA 2LOZA 2D11A 5CLLB 2Z14A 2W2XD 2FJLA 3NW8A 1V5MA 5J3TA 5JP4A 4HHVA 1X1GA 1IRSA 2UVMA 3ODWA 2YSZA 1MK7B 2ROZB 4ZRJA 2MWNB 5I2MA 2YRYA 3ULBA 4HB4B 3KRWA 1BTKA 1M7EA 1ZC4B 2VRWB 2GS0A 4HDQA 5DI9B 1OMWA 4A5KA 3HW2B 4GN1A 2NMBA 5D3VA 5C16A 3RCPA 3BJIA 2K8EA 4PQ0A 1EVHA 5LONB 2RUKB 2DFKA 1EF1A 5HE2A 4QJ3B 1P3RA 4ZRKA 1GC6A 2QKLA 1ISNA 2RSGA 3PG7A 3HIEA 3M1IB 3NSUA 2AEHA 2EMTA 2BCJA 3SNHA 3GYOA 1MPHA 4WSFA 1UNPA 1UPRA 4YONA 2YVCA 5C5BB 2M38A 2DLWA 3TCAA 4KAXB 4BBKA 1Y5OA 4F7GA 3A58A 2D9YA 3TVVA 2LYDA 1U2BA 1AWEA 2COAA 2IFSA 1J19A 3HSAA 1DDVA 4B6HA 2Z59A 5C79A 2D10A 2LG1A 2J0MA 3O96A 4D0NB 2GCLA 3PVLA 1MI1A 4WJ7A 3A8PA 3SV1A 2RVBB 3FM8C 3ODXA 2YS3A 4HB0B 1AQCA 2GJYA 1TJ6A 4CHMA 2KIGA 5LOPB 4GMXB 2HE7A 1U5EA 3TFMA 4KHOA 4EMOA
chains in the Genus database with same CATH topology
1BWNA 2KCJA 3WYFB 2K00A 4WVFB 3DXCA 3HK0A 5FI1A 2ADZA 5JHHA 4XWXA 2J59M 2PZ1A 3P6AA 2YT1A 4A6FA 3T06A 3VOQA 1Y19B 2YS1A 5D3WA 4K81A 1FGZA 5FI0A 1KZGA 1NU2A 2MKRA 4NSWA 1BAKA 1K5GB 3D8FA 4HAUB 4IOYX 2DHKA 1XODA 3SO6A 4KHBB 4HAVB 1UNQA 5J3QA 3OANA 1I2HA 3VIAA 1XCGA 2D9ZA 1XD4A 1B55A 1P5TA 2DTCA 1RRPB 2P0HA 2W2XC 2KGXB 3DXDA 4GXBA 1J0WA 4MT7A 2K2UA 2Z0PA 4GPTB 2OQBA 1KI1B 5GOWB 5CLQB 3TO1A 1ZC3B 2LULA 2EJ8A 5DIFB 3D8EA 2YF0A 3FSSA 1V5UA 5EFXA 1P6SA 1MIZB 2K2JA 2N23A 1OQNA 2YS5A 4HDOA 4HB2B 3LJUX 5HE0A 4H8SA 3D8DA 3A98B 2J0KA 3WA0A 2Y8FA 1Q67A 1GC7A 1XKEA 1RJ2A 3QWMA 2L1CA 3PZDA 1MK9B 2D9XA 2DX1A 1M7RA 3HQCA 4GZUA 1LW3A 2DKPA 1TXDA 5KCVA 2MFQA 2R0DA 3V5WA 4MK0A 1W1HA 2YT0A 4MY6A 2D9VA 2QKMA 2I5CA 2UZRA 3ODOA 2CY5A 3MPXA 2ELBA 3PP2A 2Z0OA 3G9WA 2JP2A 3A8QA 2IYBA 1XR0B 1W1GA 2CODA 2KUPA 2Z0QA 1X11A 3KRXA 2G35A 2N0YA 2R09A 3F0WA 3N7CA 1OY2A 4Z2NA 2DX5A 4TYZA 1WVHA 1FB8A 1DDWA 2I1JA 1Z87A 1DBHA 2P0FA 2L2IA 3IVFA 5D3YA 3TW1A 1U29A 2ROVA 3SYXA 1UNRA 3P7ZA 4IFSA 2I1KA 1X86A 5D3XA 3SUZA 5L81A 2H7EA 1FHXA 4EJNA 2ZPYA 1W1DA 3X23A 4PNKA 2XQNM 3DXEA 1GG3A 2CAYA 4A6FB 2Y8GA 1U5DA 4K2OA 1V88A 2VKIA 4Y94A 5D27A 1SHCA 2D4QA 4CHJA 3PVUA 4A6KA 2I5FA 2DYNA 3UZTA 3FEHA 4K17A 3GYPA 2EC1A 1NTYA 4HAZB 1PMSA 5DH9B 1SGHA 5HE1A 3PEGA 2DA0A 2ELAA 1QC6A 2DHIA 2RGNB 4HAWB 1FAOA 4K2PA 2Y7BA 4DXAB 4DBBA 4Z2MB 1K5DB 2UZSA 1FOEA 3KZ1A 5JLJB 1H4RA 2V76A 3ULCA 4F7UP 5HE3A 5DHAB 1FHOA 1PFJA 1ZM0A 2RNRB 2EMSA 1X1FA 5C5BA 1NTVA 3PSCA 1WJMA 3QBVB 4HB3B 2P8VA 1KZ7A 1MKEA 4HAYB 4A6HA 3QIJA 2CRFA 1V61A 1WG7A 1XX0A 1H10A 1WI1A 3ZVRA 1WGUA 1EGXA 3CIKA 2X18A 2HTHB 1ZVRA 4HATB 5C6RA 1PLSA 2M14A 2OTXA 3KSYA 3U8ZA 4C0AA 2DHJA 1V89A 5KQ1A 2COFA 1DROA 2COCA 4P7IA 1E5WA 2RLOA 5DHFB 2CY4A 4GMVA 2VSZA 2D2QA 1FHWA 4TKNA 3PVWA 4ZRIA 1X05A 1FGYA 1LB1A 2MDXA 3MDBC 1U5FA 4YL8A 4HAXB 2W2WA 2P0DA 2Q13A 3KY9A 5JHGA 5J3YA 1ZSQA 1UPQA 3ML4A 1I7AA 4NY0A 1DDMA 4CYEA 1EAZA 4DX8A 1QQGA 2H7DA 1MAIA 1N3HA 4L6EA 3BINA 3AU4A 1U27A 1NI2A 2LKOA 4F7HA 2GCJA 1MIXA 4IAPA 4KHAA 4EKUA 1DYNA 3U7DA 1TQZA 4KVGB 1WJ1A 3CXBB 4DX90 2DKQA 1U5GA 3ZDTA 3AJ4A 2D9WA 2AL6A 1UEFA 2DYQA 1BTNA 3AU5A 1WGQA 5KQ4A 1V5PA 2NZ8B 2DN6A 3F5RA 2LOXA 2J0JA 2E2XA 2LOZA 2D11A 5CLLB 2W2XD 2FJLA 1V5MA 5J3TA 5JP4A 4HHVA 1X1GA 1IRSA 2UVMA 3ODWA 2YSZA 1MK7B 2ROZB 4ZRJA 2MWNB 2YRYA 3ULBA 4HB4B 3KRWA 1BTKA 1M7EA 1ZC4B 2VRWB 2GS0A 4HDQA 5DI9B 1OMWA 4A5KA 3HW2B 4GN1A 2NMBA 5D3VA 5C16A 3RCPA 3BJIA 4PQ0A 1EVHA 5LONB 2RUKB 2DFKA 1EF1A 5HE2A 1P3RA 4ZRKA 1GC6A 2QKLA 1ISNA 2RSGA 3PG7A 3M1IB 3NSUA 2AEHA 2EMTA 2BCJA 3SNHA 3GYOA 1MPHA 4WSFA 1UNPA 1UPRA 4YONA 2YVCA 5C5BB 2M38A 2DLWA 3TCAA 4KAXB 4BBKA 1Y5OA 4F7GA 2D9YA 3TVVA 2LYDA 1U2BA 1AWEA 2COAA 2IFSA 1J19A 1DDVA 4B6HA 5C79A 2D10A 2LG1A 2J0MA 3O96A 4D0NB 2GCLA 3PVLA 4WJ7A 3A8PA 3SV1A 2RVBB 3FM8C 3ODXA 2YS3A 4HB0B 1AQCA 2GJYA 1TJ6A 4CHMA 5LOPB 4GMXB 2HE7A 1U5EA 3TFMA 4KHOA 4EMOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BWN A;  2KCJ A;  3WYF B;  2K00 A;  4WVF B;  3DXC A;  3HK0 A;  5FI1 A;  2ADZ A;  5JHH A;  4XWX A;  2J59 M;  2PZ1 A;  3P6A A;  2YT1 A;  4A6F A;  3T06 A;  3VOQ A;  1Y19 B;  2YS1 A;  5D3W A;  4K81 A;  1FGZ A;  5FI0 A;  1KZG A;  1NU2 A;  2MKR A;  4NSW A;  1BAK A;  1K5G B;  3D8F A;  4HAU B;  4IOY X;  2DHK A;  1XOD A;  3SO6 A;  4KHB B;  4HAV B;  1UNQ A;  5J3Q A;  3OAN A;  1I2H A;  3VIA A;  1XCG A;  2D9Z A;  1XD4 A;  1B55 A;  1P5T A;  2DTC A;  1RRP B;  2P0H A;  2W2X C;  2KGX B;  3DXD A;  4GXB A;  1J0W A;  4MT7 A;  2K2U A;  2Z0P A;  4GPT B;  2OQB A;  1KI1 B;  5GOW B;  5CLQ B;  3TO1 A;  1ZC3 B;  2LUL A;  2EJ8 A;  5DIF B;  3D8E A;  2YF0 A;  3FSS A;  1V5U A;  5EFX A;  1P6S A;  1MIZ B;  2K2J A;  2N23 A;  1OQN A;  2YS5 A;  4HDO A;  4HB2 B;  3LJU X;  5HE0 A;  4H8S A;  3D8D A;  3A98 B;  2J0K A;  3WA0 A;  2Y8F A;  1Q67 A;  1GC7 A;  1XKE A;  1RJ2 A;  3QWM A;  2L1C A;  3PZD A;  1MK9 B;  2D9X A;  2DX1 A;  1M7R A;  3HQC A;  4GZU A;  1LW3 A;  2DKP A;  1TXD A;  5KCV A;  2MFQ A;  2R0D A;  3V5W A;  4MK0 A;  1W1H A;  2YT0 A;  4MY6 A;  2D9V A;  2QKM A;  2I5C A;  2UZR A;  3ODO A;  2CY5 A;  3MPX A;  2ELB A;  3PP2 A;  2Z0O A;  3G9W A;  2JP2 A;  3A8Q A;  2IYB A;  1XR0 B;  1W1G A;  2COD A;  2KUP A;  2Z0Q A;  1X11 A;  3KRX A;  2G35 A;  2N0Y A;  2R09 A;  3F0W A;  3N7C A;  1OY2 A;  4Z2N A;  2DX5 A;  4TYZ A;  1WVH A;  1FB8 A;  1DDW A;  2I1J A;  1Z87 A;  1DBH A;  2P0F A;  2L2I A;  3IVF A;  5D3Y A;  3TW1 A;  1U29 A;  2ROV A;  3SYX A;  1UNR A;  3P7Z A;  4IFS A;  2I1K A;  1X86 A;  5D3X A;  3SUZ A;  5L81 A;  2H7E A;  1FHX A;  4EJN A;  2ZPY A;  1W1D A;  3X23 A;  4PNK A;  2XQN M;  3DXE A;  1GG3 A;  2CAY A;  4A6F B;  2Y8G A;  1U5D A;  4K2O A;  1V88 A;  2VKI A;  4Y94 A;  5D27 A;  1SHC A;  2D4Q A;  4CHJ A;  3PVU A;  4A6K A;  2I5F A;  2DYN A;  3UZT A;  3FEH A;  4K17 A;  3GYP A;  2EC1 A;  1NTY A;  4HAZ B;  1PMS A;  5DH9 B;  1SGH A;  5HE1 A;  3PEG A;  2DA0 A;  2ELA A;  1QC6 A;  2DHI A;  2RGN B;  4HAW B;  1FAO A;  4K2P A;  2Y7B A;  4DXA B;  4DBB A;  4Z2M B;  1K5D B;  2UZS A;  1FOE A;  3KZ1 A;  5JLJ B;  1H4R A;  2V76 A;  3ULC A;  4F7U P;  5HE3 A;  5DHA B;  1FHO A;  1PFJ A;  1ZM0 A;  2RNR B;  2EMS A;  1X1F A;  5C5B A;  1NTV A;  3PSC A;  1WJM A;  3QBV B;  4HB3 B;  2P8V A;  1KZ7 A;  1MKE A;  4HAY B;  4A6H A;  3QIJ A;  2CRF A;  1V61 A;  1WG7 A;  1XX0 A;  1H10 A;  1WI1 A;  3ZVR A;  1WGU A;  1EGX A;  3CIK A;  2X18 A;  2HTH B;  1ZVR A;  4HAT B;  5C6R A;  1PLS A;  2M14 A;  2OTX A;  3KSY A;  3U8Z A;  4C0A A;  2DHJ A;  1V89 A;  5KQ1 A;  2COF A;  1DRO A;  2COC A;  4P7I A;  1E5W A;  2RLO A;  5DHF B;  2CY4 A;  4GMV A;  2VSZ A;  2D2Q A;  1FHW A;  4TKN A;  3PVW A;  4ZRI A;  1X05 A;  1FGY A;  1LB1 A;  2MDX A;  3MDB C;  1U5F A;  4YL8 A;  4HAX B;  2W2W A;  2P0D A;  2Q13 A;  3KY9 A;  5JHG A;  5J3Y A;  1ZSQ A;  1UPQ A;  3ML4 A;  1I7A A;  4NY0 A;  1DDM A;  4CYE A;  1EAZ A;  4DX8 A;  1QQG A;  2H7D A;  1MAI A;  1N3H A;  4L6E A;  3BIN A;  3AU4 A;  1U27 A;  1NI2 A;  2LKO A;  4F7H A;  2GCJ A;  1MIX A;  4IAP A;  4KHA A;  4EKU A;  1DYN A;  3U7D A;  1TQZ A;  4KVG B;  1WJ1 A;  3CXB B;  4DX9 0;  2DKQ A;  1U5G A;  3ZDT A;  3AJ4 A;  2D9W A;  2AL6 A;  1UEF A;  2DYQ A;  1BTN A;  3AU5 A;  1WGQ A;  5KQ4 A;  1V5P A;  2NZ8 B;  2DN6 A;  3F5R A;  2LOX A;  2J0J A;  2E2X A;  2LOZ A;  2D11 A;  5CLL B;  2W2X D;  2FJL A;  1V5M A;  5J3T A;  5JP4 A;  4HHV A;  1X1G A;  1IRS A;  2UVM A;  3ODW A;  2YSZ A;  1MK7 B;  2ROZ B;  4ZRJ A;  2MWN B;  2YRY A;  3ULB A;  4HB4 B;  3KRW A;  1BTK A;  1M7E A;  1ZC4 B;  2VRW B;  2GS0 A;  4HDQ A;  5DI9 B;  1OMW A;  4A5K A;  3HW2 B;  4GN1 A;  2NMB A;  5D3V A;  5C16 A;  3RCP A;  3BJI A;  4PQ0 A;  1EVH A;  5LON B;  2RUK B;  2DFK A;  1EF1 A;  5HE2 A;  1P3R A;  4ZRK A;  1GC6 A;  2QKL A;  1ISN A;  2RSG A;  3PG7 A;  3M1I B;  3NSU A;  2AEH A;  2EMT A;  2BCJ A;  3SNH A;  3GYO A;  1MPH A;  4WSF A;  1UNP A;  1UPR A;  4YON A;  2YVC A;  5C5B B;  2M38 A;  2DLW A;  3TCA A;  4KAX B;  4BBK A;  1Y5O A;  4F7G A;  2D9Y A;  3TVV A;  2LYD A;  1U2B A;  1AWE A;  2COA A;  2IFS A;  1J19 A;  1DDV A;  4B6H A;  5C79 A;  2D10 A;  2LG1 A;  2J0M A;  3O96 A;  4D0N B;  2GCL A;  3PVL A;  4WJ7 A;  3A8P A;  3SV1 A;  2RVB B;  3FM8 C;  3ODX A;  2YS3 A;  4HB0 B;  1AQC A;  2GJY A;  1TJ6 A;  4CHM A;  5LOP B;  4GMX B;  2HE7 A;  1U5E A;  3TFM A;  4KHO A;  4EMO A; 
#chains in the Genus database with same CATH topology
 1BWN A;  2KCJ A;  3DCX A;  3WYF B;  2K00 A;  4WVF B;  3DXC A;  3HK0 A;  5FI1 A;  2ADZ A;  5JHH A;  4XWX A;  2J59 M;  2PZ1 A;  3P6A A;  2YT1 A;  4A6F A;  3T06 A;  3VOQ A;  2KUQ A;  1Y19 B;  2YS1 A;  5D3W A;  4K81 A;  2RRF A;  1FGZ A;  5FI0 A;  1KZG A;  3OHM B;  1NU2 A;  2MKR A;  3NWA A;  4NSW A;  1BAK A;  1K5G B;  1ZYI A;  3D8F A;  4HAU B;  4QJ4 B;  4IOY X;  2DHK A;  1XOD A;  3NWF A;  3SO6 A;  4KHB B;  4HAV B;  1UNQ A;  5J3Q A;  3OAN A;  1I2H A;  3VIA A;  1XCG A;  2D9Z A;  2K49 A;  1XD4 A;  1B55 A;  1P5T A;  2DTC A;  1RRP B;  2NBV A;  2P0H A;  2W2X C;  2KGX B;  3DXD A;  4GXB A;  1J0W A;  4MT7 A;  2K2U A;  2Z0P A;  4GPT B;  2OQB A;  1KI1 B;  5GOW B;  5CLQ B;  3TO1 A;  1ZC3 B;  2LUL A;  2EJ8 A;  5DIF B;  3D8E A;  2YF0 A;  3FSS A;  3B77 A;  5I2S A;  1V5U A;  5EFX A;  1P6S A;  1MIZ B;  2K2J A;  2N23 A;  1OQN A;  2YS5 A;  4HDO A;  4HB2 B;  3LJU X;  5HE0 A;  4H8S A;  3D8D A;  3A98 B;  2J0K A;  3WA0 A;  2GUM A;  2Y8F A;  1Q67 A;  1GC7 A;  1XKE A;  1RJ2 A;  3QWM A;  2L1C A;  3PZD A;  1MK9 B;  2D9X A;  1T77 A;  2DX1 A;  4D6W A;  1M7R A;  3HQC A;  4GZU A;  2YT2 A;  1LW3 A;  2DKP A;  4OT1 A;  1TXD A;  5KCV A;  4GNK B;  2MFQ A;  2R0D A;  3V5W A;  4MK0 A;  1W1H A;  2YT0 A;  4MY6 A;  2D9V A;  2QKM A;  2I5C A;  2KIE A;  2UZR A;  3ODO A;  2CY5 A;  3MPX A;  2ELB A;  3PP2 A;  2Z0O A;  2FJU B;  3G9W A;  2JP2 A;  3A8Q A;  2IYB A;  1XR0 B;  1W1G A;  2COD A;  2KUP A;  2Z0Q A;  1X11 A;  3KRX A;  2G35 A;  2N0Y A;  2R09 A;  3F0W A;  4L1R A;  3N7C A;  1OY2 A;  4Z2N A;  2DX5 A;  4TYZ A;  1WVH A;  1FB8 A;  1DDW A;  2I1J A;  1Z87 A;  1DBH A;  2P0F A;  2L2I A;  3IVF A;  5D3Y A;  3TW1 A;  1U29 A;  2ROV A;  3SYX A;  1UNR A;  3P7Z A;  4IFS A;  2I1K A;  1X86 A;  5D3X A;  3SUZ A;  5L81 A;  2H7E A;  1FHX A;  4QXA B;  2ZPY A;  4EJN A;  1W1D A;  3X23 A;  4PNK A;  2XQN M;  3DXE A;  1GG3 A;  2CAY A;  4A6F B;  2Y8G A;  1U5D A;  4K2O A;  4KHB A;  1V88 A;  2VKI A;  4Y94 A;  5D27 A;  5IRS A;  1SHC A;  2D4Q A;  4CHJ A;  2KR0 A;  3PVU A;  4A6K A;  2I5F A;  2DYN A;  3UZT A;  3FEH A;  4K17 A;  3GYP A;  2EC1 A;  1NTY A;  4HAZ B;  1PMS A;  5DH9 B;  1SGH A;  5HE1 A;  3PEG A;  2DA0 A;  2ELA A;  1QC6 A;  2DHI A;  2RGN B;  4HAW B;  1FAO A;  4K2P A;  2Y7B A;  4DXA B;  4HSI A;  4DBB A;  4Z2M B;  1K5D B;  2UZS A;  1FOE A;  3KZ1 A;  5JLJ B;  2R2Y A;  1H4R A;  3NWD A;  2V76 A;  3ULC A;  4F7U P;  5HE3 A;  5DHA B;  1FHO A;  1PFJ A;  1ZM0 A;  2RNR B;  2EMS A;  1X1F A;  5C5B A;  1NTV A;  3PSC A;  1WJM A;  3QBV B;  4QJ5 B;  4HB3 B;  2P8V A;  1KZ7 A;  1MKE A;  3U12 A;  4HAY B;  4A6H A;  3QIJ A;  2CRF A;  1V61 A;  1WG7 A;  1XX0 A;  1H10 A;  1WI1 A;  3ZVR A;  1WGU A;  1EGX A;  3CIK A;  2X18 A;  2HTH B;  1ZVR A;  4HAT B;  5C6R A;  1PLS A;  2M14 A;  2OTX A;  3KSY A;  3U8Z A;  4C0A A;  2DHJ A;  1V89 A;  5KQ1 A;  2COF A;  1DRO A;  2COC A;  4P7I A;  1E5W A;  2RLO A;  5M4Y B;  5DHF B;  2CY4 A;  4GMV A;  2VSZ A;  2D2Q A;  1FHW A;  4TKN A;  3PVW A;  4ZRI A;  1X05 A;  1FGY A;  1LB1 A;  2MDX A;  2Z13 A;  3MDB C;  1U5F A;  4YL8 A;  4HAX B;  2W2W A;  3FVC A;  2P0D A;  2Q13 A;  3KY9 A;  5JHG A;  5J3Y A;  1ZSQ A;  1UPQ A;  3ML4 A;  1I7A A;  4OSN A;  4NY0 A;  1DDM A;  4CYE A;  1EAZ A;  4DX8 A;  1QQG A;  2H7D A;  1MAI A;  1N3H A;  4L6E A;  3BIN A;  4GOU A;  3AU4 A;  1U27 A;  1NI2 A;  2LKO A;  4F7H A;  2GCJ A;  1MIX A;  4IAP A;  4KHA A;  4EKU A;  1DYN A;  2Z4D A;  3U7D A;  1TQZ A;  4KVG B;  1WJ1 A;  3CXB B;  4DX9 0;  2DKQ A;  1U5G A;  3ZDT A;  3AJ4 A;  2ZKM X;  5LG4 B;  2D9W A;  2AL6 A;  1UEF A;  4CSQ A;  2DYQ A;  1BTN A;  3AU5 A;  1WGQ A;  5KQ4 A;  4DIX A;  1V5P A;  2NZ8 B;  2DN6 A;  3F5R A;  2LOX A;  2J0J A;  2E2X A;  2LOZ A;  2D11 A;  5CLL B;  2Z14 A;  2W2X D;  2FJL A;  3NW8 A;  1V5M A;  5J3T A;  5JP4 A;  4HHV A;  1X1G A;  1IRS A;  2UVM A;  3ODW A;  2YSZ A;  1MK7 B;  2ROZ B;  4ZRJ A;  2MWN B;  5I2M A;  2YRY A;  3ULB A;  4HB4 B;  3KRW A;  1BTK A;  1M7E A;  1ZC4 B;  2VRW B;  2GS0 A;  4HDQ A;  5DI9 B;  1OMW A;  4A5K A;  3HW2 B;  4GN1 A;  2NMB A;  5D3V A;  5C16 A;  3RCP A;  3BJI A;  2K8E A;  4PQ0 A;  1EVH A;  5LON B;  2RUK B;  2DFK A;  1EF1 A;  5HE2 A;  4QJ3 B;  1P3R A;  4ZRK A;  1GC6 A;  2QKL A;  1ISN A;  2RSG A;  3PG7 A;  3HIE A;  3M1I B;  3NSU A;  2AEH A;  2EMT A;  2BCJ A;  3SNH A;  3GYO A;  1MPH A;  4WSF A;  1UNP A;  1UPR A;  4YON A;  2YVC A;  5C5B B;  2M38 A;  2DLW A;  3TCA A;  4KAX B;  4BBK A;  1Y5O A;  4F7G A;  3A58 A;  2D9Y A;  3TVV A;  2LYD A;  1U2B A;  1AWE A;  2COA A;  2IFS A;  1J19 A;  3HSA A;  1DDV A;  4B6H A;  2Z59 A;  5C79 A;  2D10 A;  2LG1 A;  2J0M A;  3O96 A;  4D0N B;  2GCL A;  3PVL A;  1MI1 A;  4WJ7 A;  3A8P A;  3SV1 A;  2RVB B;  3FM8 C;  3ODX A;  2YS3 A;  4HB0 B;  1AQC A;  2GJY A;  1TJ6 A;  4CHM A;  2KIG A;  5LOP B;  4GMX B;  2HE7 A;  1U5E A;  3TFM A;  4KHO A;  4EMO A; 
#chains in the Genus database with same CATH homology
 1BWN A;  2KCJ A;  3WYF B;  2K00 A;  4WVF B;  3DXC A;  3HK0 A;  5FI1 A;  2ADZ A;  5JHH A;  4XWX A;  2J59 M;  2PZ1 A;  3P6A A;  2YT1 A;  4A6F A;  3T06 A;  3VOQ A;  1Y19 B;  2YS1 A;  5D3W A;  4K81 A;  1FGZ A;  5FI0 A;  1KZG A;  1NU2 A;  2MKR A;  4NSW A;  1BAK A;  1K5G B;  3D8F A;  4HAU B;  4IOY X;  2DHK A;  1XOD A;  3SO6 A;  4KHB B;  4HAV B;  1UNQ A;  5J3Q A;  3OAN A;  1I2H A;  3VIA A;  1XCG A;  2D9Z A;  1XD4 A;  1B55 A;  1P5T A;  2DTC A;  1RRP B;  2P0H A;  2W2X C;  2KGX B;  3DXD A;  4GXB A;  1J0W A;  4MT7 A;  2K2U A;  2Z0P A;  4GPT B;  2OQB A;  1KI1 B;  5GOW B;  5CLQ B;  3TO1 A;  1ZC3 B;  2LUL A;  2EJ8 A;  5DIF B;  3D8E A;  2YF0 A;  3FSS A;  1V5U A;  5EFX A;  1P6S A;  1MIZ B;  2K2J A;  2N23 A;  1OQN A;  2YS5 A;  4HDO A;  4HB2 B;  3LJU X;  5HE0 A;  4H8S A;  3D8D A;  3A98 B;  2J0K A;  3WA0 A;  2Y8F A;  1Q67 A;  1GC7 A;  1XKE A;  1RJ2 A;  3QWM A;  2L1C A;  3PZD A;  1MK9 B;  2D9X A;  2DX1 A;  1M7R A;  3HQC A;  4GZU A;  1LW3 A;  2DKP A;  1TXD A;  5KCV A;  2MFQ A;  2R0D A;  3V5W A;  4MK0 A;  1W1H A;  2YT0 A;  4MY6 A;  2D9V A;  2QKM A;  2I5C A;  2UZR A;  3ODO A;  2CY5 A;  3MPX A;  2ELB A;  3PP2 A;  2Z0O A;  3G9W A;  2JP2 A;  3A8Q A;  2IYB A;  1XR0 B;  1W1G A;  2COD A;  2KUP A;  2Z0Q A;  1X11 A;  3KRX A;  2G35 A;  2N0Y A;  2R09 A;  3F0W A;  3N7C A;  1OY2 A;  4Z2N A;  2DX5 A;  4TYZ A;  1WVH A;  1FB8 A;  1DDW A;  2I1J A;  1Z87 A;  1DBH A;  2P0F A;  2L2I A;  3IVF A;  5D3Y A;  3TW1 A;  1U29 A;  2ROV A;  3SYX A;  1UNR A;  3P7Z A;  4IFS A;  2I1K A;  1X86 A;  5D3X A;  3SUZ A;  5L81 A;  2H7E A;  1FHX A;  4EJN A;  2ZPY A;  1W1D A;  3X23 A;  4PNK A;  2XQN M;  3DXE A;  1GG3 A;  2CAY A;  4A6F B;  2Y8G A;  1U5D A;  4K2O A;  1V88 A;  2VKI A;  4Y94 A;  5D27 A;  1SHC A;  2D4Q A;  4CHJ A;  3PVU A;  4A6K A;  2I5F A;  2DYN A;  3UZT A;  3FEH A;  4K17 A;  3GYP A;  2EC1 A;  1NTY A;  4HAZ B;  1PMS A;  5DH9 B;  1SGH A;  5HE1 A;  3PEG A;  2DA0 A;  2ELA A;  1QC6 A;  2DHI A;  2RGN B;  4HAW B;  1FAO A;  4K2P A;  2Y7B A;  4DXA B;  4DBB A;  4Z2M B;  1K5D B;  2UZS A;  1FOE A;  3KZ1 A;  5JLJ B;  1H4R A;  2V76 A;  3ULC A;  4F7U P;  5HE3 A;  5DHA B;  1FHO A;  1PFJ A;  1ZM0 A;  2RNR B;  2EMS A;  1X1F A;  5C5B A;  1NTV A;  3PSC A;  1WJM A;  3QBV B;  4HB3 B;  2P8V A;  1KZ7 A;  1MKE A;  4HAY B;  4A6H A;  3QIJ A;  2CRF A;  1V61 A;  1WG7 A;  1XX0 A;  1H10 A;  1WI1 A;  3ZVR A;  1WGU A;  1EGX A;  3CIK A;  2X18 A;  2HTH B;  1ZVR A;  4HAT B;  5C6R A;  1PLS A;  2M14 A;  2OTX A;  3KSY A;  3U8Z A;  4C0A A;  2DHJ A;  1V89 A;  5KQ1 A;  2COF A;  1DRO A;  2COC A;  4P7I A;  1E5W A;  2RLO A;  5DHF B;  2CY4 A;  4GMV A;  2VSZ A;  2D2Q A;  1FHW A;  4TKN A;  3PVW A;  4ZRI A;  1X05 A;  1FGY A;  1LB1 A;  2MDX A;  3MDB C;  1U5F A;  4YL8 A;  4HAX B;  2W2W A;  2P0D A;  2Q13 A;  3KY9 A;  5JHG A;  5J3Y A;  1ZSQ A;  1UPQ A;  3ML4 A;  1I7A A;  4NY0 A;  1DDM A;  4CYE A;  1EAZ A;  4DX8 A;  1QQG A;  2H7D A;  1MAI A;  1N3H A;  4L6E A;  3BIN A;  3AU4 A;  1U27 A;  1NI2 A;  2LKO A;  4F7H A;  2GCJ A;  1MIX A;  4IAP A;  4KHA A;  4EKU A;  1DYN A;  3U7D A;  1TQZ A;  4KVG B;  1WJ1 A;  3CXB B;  4DX9 0;  2DKQ A;  1U5G A;  3ZDT A;  3AJ4 A;  2D9W A;  2AL6 A;  1UEF A;  2DYQ A;  1BTN A;  3AU5 A;  1WGQ A;  5KQ4 A;  1V5P A;  2NZ8 B;  2DN6 A;  3F5R A;  2LOX A;  2J0J A;  2E2X A;  2LOZ A;  2D11 A;  5CLL B;  2W2X D;  2FJL A;  1V5M A;  5J3T A;  5JP4 A;  4HHV A;  1X1G A;  1IRS A;  2UVM A;  3ODW A;  2YSZ A;  1MK7 B;  2ROZ B;  4ZRJ A;  2MWN B;  2YRY A;  3ULB A;  4HB4 B;  3KRW A;  1BTK A;  1M7E A;  1ZC4 B;  2VRW B;  2GS0 A;  4HDQ A;  5DI9 B;  1OMW A;  4A5K A;  3HW2 B;  4GN1 A;  2NMB A;  5D3V A;  5C16 A;  3RCP A;  3BJI A;  4PQ0 A;  1EVH A;  5LON B;  2RUK B;  2DFK A;  1EF1 A;  5HE2 A;  1P3R A;  4ZRK A;  1GC6 A;  2QKL A;  1ISN A;  2RSG A;  3PG7 A;  3M1I B;  3NSU A;  2AEH A;  2EMT A;  2BCJ A;  3SNH A;  3GYO A;  1MPH A;  4WSF A;  1UNP A;  1UPR A;  4YON A;  2YVC A;  5C5B B;  2M38 A;  2DLW A;  3TCA A;  4KAX B;  4BBK A;  1Y5O A;  4F7G A;  2D9Y A;  3TVV A;  2LYD A;  1U2B A;  1AWE A;  2COA A;  2IFS A;  1J19 A;  1DDV A;  4B6H A;  5C79 A;  2D10 A;  2LG1 A;  2J0M A;  3O96 A;  4D0N B;  2GCL A;  3PVL A;  4WJ7 A;  3A8P A;  3SV1 A;  2RVB B;  3FM8 C;  3ODX A;  2YS3 A;  4HB0 B;  1AQC A;  2GJY A;  1TJ6 A;  4CHM A;  5LOP B;  4GMX B;  2HE7 A;  1U5E A;  3TFM A;  4KHO A;  4EMO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...