3QWMA

Crystal structure of gep100, the plextrin homology domain of iq motif and sec7 domain-containing protein 1 isoform a
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
130
structure length
127
Chain Sequence
HRRLVCYCRLFEVPDPNKPQKLGLHQREIFLFNDLLVVTKIFQNSVTYSFRQSFSLYGMQVLLFENQYYPNGIRLTSSVPGADIKVLINFNAPNPQDRKKFTDDLRESIAEVQEMEKHRIESELEKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords IQ motif and SEC7 domain-containing protein 1
publication title Crystal Structure of GEP100, the plextrin homology domain of IQ motif and SEC7 domain-containing protein 1 isoform a
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 31
structure length 127
sequence length 130
ec nomenclature
pdb deposition date 2011-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16453 IQ_SEC7_PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3qwmA00
3GYPA 2LULA 3A8PA 4TYZA 1TQZA 4A5KA 4TKNA 4F7GA 5KCVA 3UZTA 1NU2A 2D9WA 1TJ6A 2UZSA 3NSUA 1XKEA 2UVMA 1UNQA 1V88A 2LOXA 1WG7A 1J19A 4K81A 3KSYA 2YS3A 2RNRB 4ZRJA 4DBBA 2W2XC 2I5FA 1Y5OA 2YRYA 4K2PA 5HE0A 1EF1A 1UPQA 4NSWA 1Q67A 2M38A 1AQCA 2M14A 5CLQB 2J0KA 5C79A 2N23A 2ELBA 4DX90 2Y8FA 2D9XA 2YF0A 3D8DA 3D8EA 3G9WA 3X23A 1MPHA 5JHHA 4HDOA 1GC7A 5C16A 1DDVA 3BJIA 4KHOA 2QKLA 2W2WA 1EAZA 4GZUA 4HHVA 2GCJA 3IVFA 3DXCA 2L2IA 3VIAA 1BWNA 2R09A 2K2UA 1Z87A 2DX5A 3A98B 3F0WA 2EC1A 4HB3B 3MDBC 3PVUA 4KVGB 5LONB 4HAWB 1XD4A 3PVWA 2Z0OA 1ZC4B 2COAA 3ULBA 1Y19B 1DYNA 1PLSA 1ZSQA 3FM8C 4ZRIA 3ODOA 2VSZA 4A6FB 5DHAB 2IYBA 3SUZA 1X1GA 5CLLB 2RVBB 3KZ1A 2G35A 2DKQA 1MK7B 1MKEA 1V89A 2AEHA 4IAPA 3D8FA 5EFXA 1E5WA 1RRPB 2KGXB 4H8SA 2LG1A 2DYNA 2DFKA 4CYEA 4PQ0A 2Y7BA 3F5RA 1OQNA 4HAZB 3SNHA 2DTCA 1X1FA 2COFA 1FGYA 2RGNB 3U8ZA 1FGZA 1U5GA 4HAYB 2V76A 3HQCA 3WYFB 2DHJA 1W1DA 5DIFB 2DLWA 1IRSA 2MDXA 2ROZB 2K2JA 3QIJA 5LOPB 1FHOA 3LJUX 2OQBA 4CHJA 2HE7A 1V5MA 1SGHA 4HDQA 1U5DA 3QWMA 1RJ2A 2D9VA 4D0NB 3BINA 3ULCA 1DROA 1N3HA 4WSFA 4KHBB 4HATB 1J0WA 2DN6A 1FB8A 1GC6A 1WVHA 4DX8A 1LW3A 4HAXB 2CAYA 2J0JA 4KAXB 1X11A 3VOQA 1DDWA 4YL8A 1UNPA 3N7CA 1DBHA 2Z0PA 2FJLA 1XODA 1K5GB 2EJ8A 2COCA 4F7UP 3KRWA 2YVCA 2ZPYA 1V5UA 5L81A 4C0AA 1OY2A 3SYXA 5FI0A 5D3VA 3TO1A 3M1IB 4WVFB 5JHGA 2GJYA 2DHKA 2E2XA 3QBVB 4P7IA 1BAKA 2ADZA 2DX1A 1KZ7A 3PVLA 1SHCA 1U29A 4MY6A 1U5EA 2J59M 2NMBA 2KCJA 1ISNA 1I7AA 1BTNA 2VRWB 1K5DB 3KRXA 5HE2A 4NY0A 4EJNA 2LKOA 2CRFA 5C5BA 3DXEA 1M7RA 3PSCA 3KY9A 1H4RA 3T06A 1MIZB 4WJ7A 1FHXA 1WJMA 1P5TA 5JLJB 5KQ4A 2J0MA 3P7ZA 4GXBA 3DXDA 4EKUA 3SO6A 4PNKA 1GG3A 3HK0A 2GS0A 2YT0A 4MK0A 2W2XD 5HE1A 2AL6A 2HTHB 3AU5A 3AU4A 5GOWB 1U2BA 4Z2NA 1QQGA 5D27A 2R0DA 2Y8GA 2YSZA 4HB4B 2Q13A 1H10A 2N0YA 2KUPA 4F7HA 2I1JA 4BBKA 2NZ8B 2RSGA 2UZRA 5J3QA 3TFMA 2GCLA 3TVVA 2D11A 1I2HA 2D2QA 3O96A 3V5WA 1XCGA 3PZDA 1EVHA 2D4QA 2D10A 1XR0B 3ZVRA 5KQ1A 2RUKB 1OMWA 1DDMA 1MIXA 4XWXA 5HE3A 1P3RA 5J3YA 1EGXA 1BTKA 4Y94A 3CIKA 4Z2MB 1WI1A 3MPXA 4EMOA 2OTXA 3HW2B 4K2OA 1B55A 1LB1A 2D9YA 2EMSA 3ODXA 4HAVB 2BCJA 5DH9B 3CXBB 1V5PA 4ZRKA 2DHIA 3OANA 3FSSA 1WGQA 1W1GA 2JP2A 4HAUB 1AWEA 2DA0A 1FAOA 2H7EA 2XQNM 2YS5A 2YS1A 2I1KA 4MT7A 5J3TA 1U5FA 2K00A 2DYQA 2P0HA 5D3WA 1UEFA 2X18A 4A6KA 2ELAA 2DKPA 2VKIA 3TW1A 1ZM0A 3SV1A 1NTVA 1M7EA 3ZDTA 3PP2A 2MFQA 3AJ4A 4A6FA 5JP4A 1UNRA 3ODWA 3A8QA 2MKRA 4K17A 3U7DA 1TXDA 3P6AA 1WJ1A 3PEGA 5C5BB 3FEHA 1QC6A 2IFSA 2L1CA 4IFSA 4HB2B 1KZGA 1PMSA 5FI1A 1X05A 1W1HA 2P0FA 4A6HA 5DI9B 1NI2A 1U27A 4HB0B 1ZC3B 4KHAA 4DXAB 1FHWA 4IOYX 2D9ZA 4GN1A 1MK9B 1P6SA 1V61A 5D3XA 1PFJA 1MAIA 4GMXB 1WGUA 2EMTA 1KI1B 3PG7A 2I5CA 2CY5A 5DHFB 4L6EA 1XX0A 2P0DA 2LOZA 4B6HA 5D3YA 4GPTB 2CY4A 1NTYA 2LYDA 2Z0QA 2QKMA 2H7DA 2PZ1A 2P8VA 5C6RA 4CHMA 2ROVA 3GYOA 3WA0A 1UPRA 3RCPA 2RLOA 4YONA 1FOEA 2MWNB 2CODA 4GMVA 1X86A 3ML4A 1ZVRA 3TCAA 2YT1A
chains in the Genus database with same CATH superfamily
3GYPA 2LULA 3A8PA 4TYZA 5M4YB 1TQZA 4A5KA 4TKNA 4F7GA 5KCVA 3UZTA 1NU2A 2D9WA 1TJ6A 2UZSA 3NSUA 1XKEA 2UVMA 1UNQA 1V88A 2LOXA 1WG7A 1J19A 4K81A 3KSYA 2YS3A 2RNRB 4ZRJA 4DBBA 2W2XC 2I5FA 1Y5OA 2YRYA 4K2PA 5HE0A 1EF1A 1UPQA 4NSWA 1Q67A 2M38A 1AQCA 2M14A 5CLQB 2J0KA 5C79A 2N23A 2ELBA 3OHMB 4DX90 2Y8FA 2D9XA 2YF0A 3D8DA 3D8EA 3G9WA 3FVCA 3X23A 1MPHA 5JHHA 4HDOA 1GC7A 5C16A 4DIXA 1DDVA 3BJIA 4KHOA 2QKLA 2W2WA 1EAZA 4GZUA 4HHVA 1ZYIA 2GCJA 3IVFA 3DXCA 2L2IA 3VIAA 1BWNA 2R09A 2K2UA 3NWDA 1Z87A 2DX5A 3A98B 3F0WA 2EC1A 4HB3B 3MDBC 3PVUA 4KVGB 5LONB 4HAWB 1XD4A 2KUQA 3PVWA 2Z0OA 1ZC4B 2COAA 3ULBA 1Y19B 1DYNA 1PLSA 1ZSQA 3FM8C 4ZRIA 3ODOA 2VSZA 4A6FB 5IRSA 5DHAB 2IYBA 3SUZA 1X1GA 5CLLB 2RVBB 3KZ1A 2G35A 2DKQA 1MK7B 1MKEA 1V89A 2AEHA 4IAPA 3D8FA 5EFXA 1E5WA 1RRPB 2KGXB 4H8SA 2LG1A 2DYNA 2DFKA 4CYEA 4PQ0A 2KIEA 2Y7BA 3F5RA 1OQNA 4HAZB 3SNHA 2DTCA 1X1FA 4L1RA 2COFA 1FGYA 2RGNB 3U8ZA 1FGZA 2Z13A 2YT2A 1U5GA 4HAYB 2V76A 3HQCA 4GOUA 2DHJA 3WYFB 1W1DA 5DIFB 2DLWA 1IRSA 2MDXA 2ROZB 2K2JA 3QIJA 5LOPB 1FHOA 3LJUX 2OQBA 4CHJA 2HE7A 1V5MA 1SGHA 4HDQA 1U5DA 3QWMA 3DCXA 1RJ2A 2D9VA 4D0NB 3BINA 3ULCA 1DROA 1N3HA 4WSFA 4KHBB 4HATB 1J0WA 2DN6A 1FB8A 1GC6A 1WVHA 4DX8A 1LW3A 4HAXB 3U12A 2CAYA 2J0JA 4KAXB 1X11A 3VOQA 1DDWA 4YL8A 1UNPA 3N7CA 1DBHA 2Z0PA 2FJLA 1XODA 1K5GB 2EJ8A 2COCA 4F7UP 3KRWA 2YVCA 2ZPYA 1V5UA 5L81A 4C0AA 1OY2A 3SYXA 5FI0A 5D3VA 3TO1A 3M1IB 4WVFB 4OT1A 5JHGA 2GJYA 2DHKA 2E2XA 3QBVB 4P7IA 1BAKA 2ADZA 2DX1A 1KZ7A 4OSNA 3PVLA 1SHCA 1U29A 4MY6A 3HIEA 4QJ3B 1U5EA 2J59M 2NMBA 3NW8A 2RRFA 2KCJA 2FJUB 1ISNA 2NBVA 1I7AA 1BTNA 2VRWB 1K5DB 3KRXA 5HE2A 2Z59A 4QJ4B 4NY0A 4EJNA 2LKOA 2CRFA 5C5BA 3DXEA 1M7RA 3PSCA 3KY9A 1H4RA 3T06A 1MIZB 5LG4B 4WJ7A 1FHXA 1WJMA 1P5TA 5JLJB 5KQ4A 3B77A 2J0MA 3P7ZA 4GXBA 3DXDA 4EKUA 3SO6A 4PNKA 1GG3A 3HK0A 2GS0A 2YT0A 4MK0A 4HSIA 2W2XD 2K8EA 5HE1A 4GNKB 3NWAA 2AL6A 2HTHB 2ZKMX 3AU5A 3AU4A 5GOWB 1U2BA 4Z2NA 1QQGA 5D27A 2R0DA 2Y8GA 2YSZA 4HB4B 2Z14A 2Q13A 1H10A 3A58A 2N0YA 2KUPA 4F7HA 2I1JA 4BBKA 2NZ8B 2RSGA 2UZRA 5J3QA 3TFMA 2GCLA 3TVVA 2D11A 1I2HA 2D2QA 3O96A 3V5WA 1XCGA 3PZDA 1EVHA 2D4QA 2D10A 1XR0B 3ZVRA 5KQ1A 2RUKB 1OMWA 1DDMA 1MIXA 4XWXA 5HE3A 1P3RA 5J3YA 1EGXA 1BTKA 4Y94A 3CIKA 4CSQA 4Z2MB 4KHBA 1WI1A 3MPXA 2R2YA 4EMOA 2OTXA 3HW2B 4K2OA 1B55A 1LB1A 2D9YA 2EMSA 3ODXA 4HAVB 2BCJA 5DH9B 3CXBB 1V5PA 4ZRKA 2DHIA 3OANA 3FSSA 1WGQA 1W1GA 2JP2A 4HAUB 1AWEA 2DA0A 1FAOA 2H7EA 2GUMA 2XQNM 2YS5A 2YS1A 2I1KA 4MT7A 5J3TA 1U5FA 2K00A 2DYQA 2P0HA 5D3WA 2K49A 1UEFA 2X18A 4A6KA 2ELAA 2DKPA 2VKIA 3TW1A 1ZM0A 3SV1A 1NTVA 3NWFA 5I2MA 1M7EA 3ZDTA 3HSAA 3PP2A 2MFQA 3AJ4A 4A6FA 5JP4A 1UNRA 4QJ5B 3ODWA 3A8QA 4QXAB 2MKRA 4K17A 4D6WA 3U7DA 1TXDA 3P6AA 1WJ1A 3PEGA 5C5BB 3FEHA 1QC6A 2IFSA 2L1CA 4IFSA 4HB2B 1KZGA 1PMSA 5FI1A 1X05A 1W1HA 1T77A 2KR0A 2P0FA 4A6HA 5DI9B 1NI2A 1U27A 4HB0B 1ZC3B 4KHAA 2Z4DA 4DXAB 1FHWA 4IOYX 2D9ZA 4GN1A 1MK9B 1P6SA 1V61A 5D3XA 1PFJA 1MAIA 4GMXB 1WGUA 2EMTA 1KI1B 3PG7A 2I5CA 2CY5A 5DHFB 4L6EA 1XX0A 2P0DA 2LOZA 4B6HA 5D3YA 4GPTB 2CY4A 1NTYA 2LYDA 2Z0QA 2QKMA 2H7DA 2PZ1A 2P8VA 5C6RA 4CHMA 2ROVA 3GYOA 3WA0A 1UPRA 2KIGA 3RCPA 2RLOA 1MI1A 4YONA 1FOEA 2MWNB 5I2SA 2CODA 4GMVA 1X86A 3ML4A 1ZVRA 3TCAA 2YT1A
chains in the Genus database with same CATH topology
3GYPA 2LULA 3A8PA 4TYZA 1TQZA 4A5KA 4TKNA 4F7GA 5KCVA 3UZTA 1NU2A 2D9WA 1TJ6A 2UZSA 3NSUA 1XKEA 2UVMA 1UNQA 1V88A 2LOXA 1WG7A 1J19A 4K81A 3KSYA 2YS3A 2RNRB 4ZRJA 4DBBA 2W2XC 2I5FA 1Y5OA 2YRYA 4K2PA 5HE0A 1EF1A 1UPQA 4NSWA 1Q67A 2M38A 1AQCA 2M14A 5CLQB 2J0KA 5C79A 2N23A 2ELBA 4DX90 2Y8FA 2D9XA 2YF0A 3D8DA 3D8EA 3G9WA 3X23A 1MPHA 5JHHA 4HDOA 1GC7A 5C16A 1DDVA 3BJIA 4KHOA 2QKLA 2W2WA 1EAZA 4GZUA 4HHVA 2GCJA 3IVFA 3DXCA 2L2IA 3VIAA 1BWNA 2R09A 2K2UA 1Z87A 2DX5A 3A98B 3F0WA 2EC1A 4HB3B 3MDBC 3PVUA 4KVGB 5LONB 4HAWB 1XD4A 3PVWA 2Z0OA 1ZC4B 2COAA 3ULBA 1Y19B 1DYNA 1PLSA 1ZSQA 3FM8C 4ZRIA 3ODOA 2VSZA 4A6FB 5DHAB 2IYBA 3SUZA 1X1GA 5CLLB 2RVBB 3KZ1A 2G35A 2DKQA 1MK7B 1MKEA 1V89A 2AEHA 4IAPA 3D8FA 5EFXA 1E5WA 1RRPB 2KGXB 4H8SA 2LG1A 2DYNA 2DFKA 4CYEA 4PQ0A 2Y7BA 3F5RA 1OQNA 4HAZB 3SNHA 2DTCA 1X1FA 2COFA 1FGYA 2RGNB 3U8ZA 1FGZA 1U5GA 4HAYB 2V76A 3HQCA 3WYFB 2DHJA 1W1DA 5DIFB 2DLWA 1IRSA 2MDXA 2ROZB 2K2JA 3QIJA 5LOPB 1FHOA 3LJUX 2OQBA 4CHJA 2HE7A 1V5MA 1SGHA 4HDQA 1U5DA 3QWMA 1RJ2A 2D9VA 4D0NB 3BINA 3ULCA 1DROA 1N3HA 4WSFA 4KHBB 4HATB 1J0WA 2DN6A 1FB8A 1GC6A 1WVHA 4DX8A 1LW3A 4HAXB 2CAYA 2J0JA 4KAXB 1X11A 3VOQA 1DDWA 4YL8A 1UNPA 3N7CA 1DBHA 2Z0PA 2FJLA 1XODA 1K5GB 2EJ8A 2COCA 4F7UP 3KRWA 2YVCA 2ZPYA 1V5UA 5L81A 4C0AA 1OY2A 3SYXA 5FI0A 5D3VA 3TO1A 3M1IB 4WVFB 5JHGA 2GJYA 2DHKA 2E2XA 3QBVB 4P7IA 1BAKA 2ADZA 2DX1A 1KZ7A 3PVLA 1SHCA 1U29A 4MY6A 1U5EA 2J59M 2NMBA 2KCJA 1ISNA 1I7AA 1BTNA 2VRWB 1K5DB 3KRXA 5HE2A 4NY0A 4EJNA 2LKOA 2CRFA 5C5BA 3DXEA 1M7RA 3PSCA 3KY9A 1H4RA 3T06A 1MIZB 4WJ7A 1FHXA 1WJMA 1P5TA 5JLJB 5KQ4A 2J0MA 3P7ZA 4GXBA 3DXDA 4EKUA 3SO6A 4PNKA 1GG3A 3HK0A 2GS0A 2YT0A 4MK0A 2W2XD 5HE1A 2AL6A 2HTHB 3AU5A 3AU4A 5GOWB 1U2BA 4Z2NA 1QQGA 5D27A 2R0DA 2Y8GA 2YSZA 4HB4B 2Q13A 1H10A 2N0YA 2KUPA 4F7HA 2I1JA 4BBKA 2NZ8B 2RSGA 2UZRA 5J3QA 3TFMA 2GCLA 3TVVA 2D11A 1I2HA 2D2QA 3O96A 3V5WA 1XCGA 3PZDA 1EVHA 2D4QA 2D10A 1XR0B 3ZVRA 5KQ1A 2RUKB 1OMWA 1DDMA 1MIXA 4XWXA 5HE3A 1P3RA 5J3YA 1EGXA 1BTKA 4Y94A 3CIKA 4Z2MB 1WI1A 3MPXA 4EMOA 2OTXA 3HW2B 4K2OA 1B55A 1LB1A 2D9YA 2EMSA 3ODXA 4HAVB 2BCJA 5DH9B 3CXBB 1V5PA 4ZRKA 2DHIA 3OANA 3FSSA 1WGQA 1W1GA 2JP2A 4HAUB 1AWEA 2DA0A 1FAOA 2H7EA 2XQNM 2YS5A 2YS1A 2I1KA 4MT7A 5J3TA 1U5FA 2K00A 2DYQA 2P0HA 5D3WA 1UEFA 2X18A 4A6KA 2ELAA 2DKPA 2VKIA 3TW1A 1ZM0A 3SV1A 1NTVA 1M7EA 3ZDTA 3PP2A 2MFQA 3AJ4A 4A6FA 5JP4A 1UNRA 3ODWA 3A8QA 2MKRA 4K17A 3U7DA 1TXDA 3P6AA 1WJ1A 3PEGA 5C5BB 3FEHA 1QC6A 2IFSA 2L1CA 4IFSA 4HB2B 1KZGA 1PMSA 5FI1A 1X05A 1W1HA 2P0FA 4A6HA 5DI9B 1NI2A 1U27A 4HB0B 1ZC3B 4KHAA 4DXAB 1FHWA 4IOYX 2D9ZA 4GN1A 1MK9B 1P6SA 1V61A 5D3XA 1PFJA 1MAIA 4GMXB 1WGUA 2EMTA 1KI1B 3PG7A 2I5CA 2CY5A 5DHFB 4L6EA 1XX0A 2P0DA 2LOZA 4B6HA 5D3YA 4GPTB 2CY4A 1NTYA 2LYDA 2Z0QA 2QKMA 2H7DA 2PZ1A 2P8VA 5C6RA 4CHMA 2ROVA 3GYOA 3WA0A 1UPRA 3RCPA 2RLOA 4YONA 1FOEA 2MWNB 2CODA 4GMVA 1X86A 3ML4A 1ZVRA 3TCAA 2YT1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GYP A;  2LUL A;  3A8P A;  4TYZ A;  1TQZ A;  4A5K A;  4TKN A;  4F7G A;  5KCV A;  3UZT A;  1NU2 A;  2D9W A;  1TJ6 A;  2UZS A;  3NSU A;  1XKE A;  2UVM A;  1UNQ A;  1V88 A;  2LOX A;  1WG7 A;  1J19 A;  4K81 A;  3KSY A;  2YS3 A;  2RNR B;  4ZRJ A;  4DBB A;  2W2X C;  2I5F A;  1Y5O A;  2YRY A;  4K2P A;  5HE0 A;  1EF1 A;  1UPQ A;  4NSW A;  1Q67 A;  2M38 A;  1AQC A;  2M14 A;  5CLQ B;  2J0K A;  5C79 A;  2N23 A;  2ELB A;  4DX9 0;  2Y8F A;  2D9X A;  2YF0 A;  3D8D A;  3D8E A;  3G9W A;  3X23 A;  1MPH A;  5JHH A;  4HDO A;  1GC7 A;  5C16 A;  1DDV A;  3BJI A;  4KHO A;  2QKL A;  2W2W A;  1EAZ A;  4GZU A;  4HHV A;  2GCJ A;  3IVF A;  3DXC A;  2L2I A;  3VIA A;  1BWN A;  2R09 A;  2K2U A;  1Z87 A;  2DX5 A;  3A98 B;  3F0W A;  2EC1 A;  4HB3 B;  3MDB C;  3PVU A;  4KVG B;  5LON B;  4HAW B;  1XD4 A;  3PVW A;  2Z0O A;  1ZC4 B;  2COA A;  3ULB A;  1Y19 B;  1DYN A;  1PLS A;  1ZSQ A;  3FM8 C;  4ZRI A;  3ODO A;  2VSZ A;  4A6F B;  5DHA B;  2IYB A;  3SUZ A;  1X1G A;  5CLL B;  2RVB B;  3KZ1 A;  2G35 A;  2DKQ A;  1MK7 B;  1MKE A;  1V89 A;  2AEH A;  4IAP A;  3D8F A;  5EFX A;  1E5W A;  1RRP B;  2KGX B;  4H8S A;  2LG1 A;  2DYN A;  2DFK A;  4CYE A;  4PQ0 A;  2Y7B A;  3F5R A;  1OQN A;  4HAZ B;  3SNH A;  2DTC A;  1X1F A;  2COF A;  1FGY A;  2RGN B;  3U8Z A;  1FGZ A;  1U5G A;  4HAY B;  2V76 A;  3HQC A;  3WYF B;  2DHJ A;  1W1D A;  5DIF B;  2DLW A;  1IRS A;  2MDX A;  2ROZ B;  2K2J A;  3QIJ A;  5LOP B;  1FHO A;  3LJU X;  2OQB A;  4CHJ A;  2HE7 A;  1V5M A;  1SGH A;  4HDQ A;  1U5D A;  3QWM A;  1RJ2 A;  2D9V A;  4D0N B;  3BIN A;  3ULC A;  1DRO A;  1N3H A;  4WSF A;  4KHB B;  4HAT B;  1J0W A;  2DN6 A;  1FB8 A;  1GC6 A;  1WVH A;  4DX8 A;  1LW3 A;  4HAX B;  2CAY A;  2J0J A;  4KAX B;  1X11 A;  3VOQ A;  1DDW A;  4YL8 A;  1UNP A;  3N7C A;  1DBH A;  2Z0P A;  2FJL A;  1XOD A;  1K5G B;  2EJ8 A;  2COC A;  4F7U P;  3KRW A;  2YVC A;  2ZPY A;  1V5U A;  5L81 A;  4C0A A;  1OY2 A;  3SYX A;  5FI0 A;  5D3V A;  3TO1 A;  3M1I B;  4WVF B;  5JHG A;  2GJY A;  2DHK A;  2E2X A;  3QBV B;  4P7I A;  1BAK A;  2ADZ A;  2DX1 A;  1KZ7 A;  3PVL A;  1SHC A;  1U29 A;  4MY6 A;  1U5E A;  2J59 M;  2NMB A;  2KCJ A;  1ISN A;  1I7A A;  1BTN A;  2VRW B;  1K5D B;  3KRX A;  5HE2 A;  4NY0 A;  4EJN A;  2LKO A;  2CRF A;  5C5B A;  3DXE A;  1M7R A;  3PSC A;  3KY9 A;  1H4R A;  3T06 A;  1MIZ B;  4WJ7 A;  1FHX A;  1WJM A;  1P5T A;  5JLJ B;  5KQ4 A;  2J0M A;  3P7Z A;  4GXB A;  3DXD A;  4EKU A;  3SO6 A;  4PNK A;  1GG3 A;  3HK0 A;  2GS0 A;  2YT0 A;  4MK0 A;  2W2X D;  5HE1 A;  2AL6 A;  2HTH B;  3AU5 A;  3AU4 A;  5GOW B;  1U2B A;  4Z2N A;  1QQG A;  5D27 A;  2R0D A;  2Y8G A;  2YSZ A;  4HB4 B;  2Q13 A;  1H10 A;  2N0Y A;  2KUP A;  4F7H A;  2I1J A;  4BBK A;  2NZ8 B;  2RSG A;  2UZR A;  5J3Q A;  3TFM A;  2GCL A;  3TVV A;  2D11 A;  1I2H A;  2D2Q A;  3O96 A;  3V5W A;  1XCG A;  3PZD A;  1EVH A;  2D4Q A;  2D10 A;  1XR0 B;  3ZVR A;  5KQ1 A;  2RUK B;  1OMW A;  1DDM A;  1MIX A;  4XWX A;  5HE3 A;  1P3R A;  5J3Y A;  1EGX A;  1BTK A;  4Y94 A;  3CIK A;  4Z2M B;  1WI1 A;  3MPX A;  4EMO A;  2OTX A;  3HW2 B;  4K2O A;  1B55 A;  1LB1 A;  2D9Y A;  2EMS A;  3ODX A;  4HAV B;  2BCJ A;  5DH9 B;  3CXB B;  1V5P A;  4ZRK A;  2DHI A;  3OAN A;  3FSS A;  1WGQ A;  1W1G A;  2JP2 A;  4HAU B;  1AWE A;  2DA0 A;  1FAO A;  2H7E A;  2XQN M;  2YS5 A;  2YS1 A;  2I1K A;  4MT7 A;  5J3T A;  1U5F A;  2K00 A;  2DYQ A;  2P0H A;  5D3W A;  1UEF A;  2X18 A;  4A6K A;  2ELA A;  2DKP A;  2VKI A;  3TW1 A;  1ZM0 A;  3SV1 A;  1NTV A;  1M7E A;  3ZDT A;  3PP2 A;  2MFQ A;  3AJ4 A;  4A6F A;  5JP4 A;  1UNR A;  3ODW A;  3A8Q A;  2MKR A;  4K17 A;  3U7D A;  1TXD A;  3P6A A;  1WJ1 A;  3PEG A;  5C5B B;  3FEH A;  1QC6 A;  2IFS A;  2L1C A;  4IFS A;  4HB2 B;  1KZG A;  1PMS A;  5FI1 A;  1X05 A;  1W1H A;  2P0F A;  4A6H A;  5DI9 B;  1NI2 A;  1U27 A;  4HB0 B;  1ZC3 B;  4KHA A;  4DXA B;  1FHW A;  4IOY X;  2D9Z A;  4GN1 A;  1MK9 B;  1P6S A;  1V61 A;  5D3X A;  1PFJ A;  1MAI A;  4GMX B;  1WGU A;  2EMT A;  1KI1 B;  3PG7 A;  2I5C A;  2CY5 A;  5DHF B;  4L6E A;  1XX0 A;  2P0D A;  2LOZ A;  4B6H A;  5D3Y A;  4GPT B;  2CY4 A;  1NTY A;  2LYD A;  2Z0Q A;  2QKM A;  2H7D A;  2PZ1 A;  2P8V A;  5C6R A;  4CHM A;  2ROV A;  3GYO A;  3WA0 A;  1UPR A;  3RCP A;  2RLO A;  4YON A;  1FOE A;  2MWN B;  2COD A;  4GMV A;  1X86 A;  3ML4 A;  1ZVR A;  3TCA A;  2YT1 A; 
#chains in the Genus database with same CATH topology
 3GYP A;  2LUL A;  3A8P A;  4TYZ A;  5M4Y B;  1TQZ A;  4A5K A;  4TKN A;  4F7G A;  5KCV A;  3UZT A;  1NU2 A;  2D9W A;  1TJ6 A;  2UZS A;  3NSU A;  1XKE A;  2UVM A;  1UNQ A;  1V88 A;  2LOX A;  1WG7 A;  1J19 A;  4K81 A;  3KSY A;  2YS3 A;  2RNR B;  4ZRJ A;  4DBB A;  2W2X C;  2I5F A;  1Y5O A;  2YRY A;  4K2P A;  5HE0 A;  1EF1 A;  1UPQ A;  4NSW A;  1Q67 A;  2M38 A;  1AQC A;  2M14 A;  5CLQ B;  2J0K A;  5C79 A;  2N23 A;  2ELB A;  3OHM B;  4DX9 0;  2Y8F A;  2D9X A;  2YF0 A;  3D8D A;  3D8E A;  3G9W A;  3FVC A;  3X23 A;  1MPH A;  5JHH A;  4HDO A;  1GC7 A;  5C16 A;  4DIX A;  1DDV A;  3BJI A;  4KHO A;  2QKL A;  2W2W A;  1EAZ A;  4GZU A;  4HHV A;  1ZYI A;  2GCJ A;  3IVF A;  3DXC A;  2L2I A;  3VIA A;  1BWN A;  2R09 A;  2K2U A;  3NWD A;  1Z87 A;  2DX5 A;  3A98 B;  3F0W A;  2EC1 A;  4HB3 B;  3MDB C;  3PVU A;  4KVG B;  5LON B;  4HAW B;  1XD4 A;  2KUQ A;  3PVW A;  2Z0O A;  1ZC4 B;  2COA A;  3ULB A;  1Y19 B;  1DYN A;  1PLS A;  1ZSQ A;  3FM8 C;  4ZRI A;  3ODO A;  2VSZ A;  4A6F B;  5IRS A;  5DHA B;  2IYB A;  3SUZ A;  1X1G A;  5CLL B;  2RVB B;  3KZ1 A;  2G35 A;  2DKQ A;  1MK7 B;  1MKE A;  1V89 A;  2AEH A;  4IAP A;  3D8F A;  5EFX A;  1E5W A;  1RRP B;  2KGX B;  4H8S A;  2LG1 A;  2DYN A;  2DFK A;  4CYE A;  4PQ0 A;  2KIE A;  2Y7B A;  3F5R A;  1OQN A;  4HAZ B;  3SNH A;  2DTC A;  1X1F A;  4L1R A;  2COF A;  1FGY A;  2RGN B;  3U8Z A;  1FGZ A;  2Z13 A;  2YT2 A;  1U5G A;  4HAY B;  2V76 A;  3HQC A;  4GOU A;  2DHJ A;  3WYF B;  1W1D A;  5DIF B;  2DLW A;  1IRS A;  2MDX A;  2ROZ B;  2K2J A;  3QIJ A;  5LOP B;  1FHO A;  3LJU X;  2OQB A;  4CHJ A;  2HE7 A;  1V5M A;  1SGH A;  4HDQ A;  1U5D A;  3QWM A;  3DCX A;  1RJ2 A;  2D9V A;  4D0N B;  3BIN A;  3ULC A;  1DRO A;  1N3H A;  4WSF A;  4KHB B;  4HAT B;  1J0W A;  2DN6 A;  1FB8 A;  1GC6 A;  1WVH A;  4DX8 A;  1LW3 A;  4HAX B;  3U12 A;  2CAY A;  2J0J A;  4KAX B;  1X11 A;  3VOQ A;  1DDW A;  4YL8 A;  1UNP A;  3N7C A;  1DBH A;  2Z0P A;  2FJL A;  1XOD A;  1K5G B;  2EJ8 A;  2COC A;  4F7U P;  3KRW A;  2YVC A;  2ZPY A;  1V5U A;  5L81 A;  4C0A A;  1OY2 A;  3SYX A;  5FI0 A;  5D3V A;  3TO1 A;  3M1I B;  4WVF B;  4OT1 A;  5JHG A;  2GJY A;  2DHK A;  2E2X A;  3QBV B;  4P7I A;  1BAK A;  2ADZ A;  2DX1 A;  1KZ7 A;  4OSN A;  3PVL A;  1SHC A;  1U29 A;  4MY6 A;  3HIE A;  4QJ3 B;  1U5E A;  2J59 M;  2NMB A;  3NW8 A;  2RRF A;  2KCJ A;  2FJU B;  1ISN A;  2NBV A;  1I7A A;  1BTN A;  2VRW B;  1K5D B;  3KRX A;  5HE2 A;  2Z59 A;  4QJ4 B;  4NY0 A;  4EJN A;  2LKO A;  2CRF A;  5C5B A;  3DXE A;  1M7R A;  3PSC A;  3KY9 A;  1H4R A;  3T06 A;  1MIZ B;  5LG4 B;  4WJ7 A;  1FHX A;  1WJM A;  1P5T A;  5JLJ B;  5KQ4 A;  3B77 A;  2J0M A;  3P7Z A;  4GXB A;  3DXD A;  4EKU A;  3SO6 A;  4PNK A;  1GG3 A;  3HK0 A;  2GS0 A;  2YT0 A;  4MK0 A;  4HSI A;  2W2X D;  2K8E A;  5HE1 A;  4GNK B;  3NWA A;  2AL6 A;  2HTH B;  2ZKM X;  3AU5 A;  3AU4 A;  5GOW B;  1U2B A;  4Z2N A;  1QQG A;  5D27 A;  2R0D A;  2Y8G A;  2YSZ A;  4HB4 B;  2Z14 A;  2Q13 A;  1H10 A;  3A58 A;  2N0Y A;  2KUP A;  4F7H A;  2I1J A;  4BBK A;  2NZ8 B;  2RSG A;  2UZR A;  5J3Q A;  3TFM A;  2GCL A;  3TVV A;  2D11 A;  1I2H A;  2D2Q A;  3O96 A;  3V5W A;  1XCG A;  3PZD A;  1EVH A;  2D4Q A;  2D10 A;  1XR0 B;  3ZVR A;  5KQ1 A;  2RUK B;  1OMW A;  1DDM A;  1MIX A;  4XWX A;  5HE3 A;  1P3R A;  5J3Y A;  1EGX A;  1BTK A;  4Y94 A;  3CIK A;  4CSQ A;  4Z2M B;  4KHB A;  1WI1 A;  3MPX A;  2R2Y A;  4EMO A;  2OTX A;  3HW2 B;  4K2O A;  1B55 A;  1LB1 A;  2D9Y A;  2EMS A;  3ODX A;  4HAV B;  2BCJ A;  5DH9 B;  3CXB B;  1V5P A;  4ZRK A;  2DHI A;  3OAN A;  3FSS A;  1WGQ A;  1W1G A;  2JP2 A;  4HAU B;  1AWE A;  2DA0 A;  1FAO A;  2H7E A;  2GUM A;  2XQN M;  2YS5 A;  2YS1 A;  2I1K A;  4MT7 A;  5J3T A;  1U5F A;  2K00 A;  2DYQ A;  2P0H A;  5D3W A;  2K49 A;  1UEF A;  2X18 A;  4A6K A;  2ELA A;  2DKP A;  2VKI A;  3TW1 A;  1ZM0 A;  3SV1 A;  1NTV A;  3NWF A;  5I2M A;  1M7E A;  3ZDT A;  3HSA A;  3PP2 A;  2MFQ A;  3AJ4 A;  4A6F A;  5JP4 A;  1UNR A;  4QJ5 B;  3ODW A;  3A8Q A;  4QXA B;  2MKR A;  4K17 A;  4D6W A;  3U7D A;  1TXD A;  3P6A A;  1WJ1 A;  3PEG A;  5C5B B;  3FEH A;  1QC6 A;  2IFS A;  2L1C A;  4IFS A;  4HB2 B;  1KZG A;  1PMS A;  5FI1 A;  1X05 A;  1W1H A;  1T77 A;  2KR0 A;  2P0F A;  4A6H A;  5DI9 B;  1NI2 A;  1U27 A;  4HB0 B;  1ZC3 B;  4KHA A;  2Z4D A;  4DXA B;  1FHW A;  4IOY X;  2D9Z A;  4GN1 A;  1MK9 B;  1P6S A;  1V61 A;  5D3X A;  1PFJ A;  1MAI A;  4GMX B;  1WGU A;  2EMT A;  1KI1 B;  3PG7 A;  2I5C A;  2CY5 A;  5DHF B;  4L6E A;  1XX0 A;  2P0D A;  2LOZ A;  4B6H A;  5D3Y A;  4GPT B;  2CY4 A;  1NTY A;  2LYD A;  2Z0Q A;  2QKM A;  2H7D A;  2PZ1 A;  2P8V A;  5C6R A;  4CHM A;  2ROV A;  3GYO A;  3WA0 A;  1UPR A;  2KIG A;  3RCP A;  2RLO A;  1MI1 A;  4YON A;  1FOE A;  2MWN B;  5I2S A;  2COD A;  4GMV A;  1X86 A;  3ML4 A;  1ZVR A;  3TCA A;  2YT1 A; 
#chains in the Genus database with same CATH homology
 3GYP A;  2LUL A;  3A8P A;  4TYZ A;  1TQZ A;  4A5K A;  4TKN A;  4F7G A;  5KCV A;  3UZT A;  1NU2 A;  2D9W A;  1TJ6 A;  2UZS A;  3NSU A;  1XKE A;  2UVM A;  1UNQ A;  1V88 A;  2LOX A;  1WG7 A;  1J19 A;  4K81 A;  3KSY A;  2YS3 A;  2RNR B;  4ZRJ A;  4DBB A;  2W2X C;  2I5F A;  1Y5O A;  2YRY A;  4K2P A;  5HE0 A;  1EF1 A;  1UPQ A;  4NSW A;  1Q67 A;  2M38 A;  1AQC A;  2M14 A;  5CLQ B;  2J0K A;  5C79 A;  2N23 A;  2ELB A;  4DX9 0;  2Y8F A;  2D9X A;  2YF0 A;  3D8D A;  3D8E A;  3G9W A;  3X23 A;  1MPH A;  5JHH A;  4HDO A;  1GC7 A;  5C16 A;  1DDV A;  3BJI A;  4KHO A;  2QKL A;  2W2W A;  1EAZ A;  4GZU A;  4HHV A;  2GCJ A;  3IVF A;  3DXC A;  2L2I A;  3VIA A;  1BWN A;  2R09 A;  2K2U A;  1Z87 A;  2DX5 A;  3A98 B;  3F0W A;  2EC1 A;  4HB3 B;  3MDB C;  3PVU A;  4KVG B;  5LON B;  4HAW B;  1XD4 A;  3PVW A;  2Z0O A;  1ZC4 B;  2COA A;  3ULB A;  1Y19 B;  1DYN A;  1PLS A;  1ZSQ A;  3FM8 C;  4ZRI A;  3ODO A;  2VSZ A;  4A6F B;  5DHA B;  2IYB A;  3SUZ A;  1X1G A;  5CLL B;  2RVB B;  3KZ1 A;  2G35 A;  2DKQ A;  1MK7 B;  1MKE A;  1V89 A;  2AEH A;  4IAP A;  3D8F A;  5EFX A;  1E5W A;  1RRP B;  2KGX B;  4H8S A;  2LG1 A;  2DYN A;  2DFK A;  4CYE A;  4PQ0 A;  2Y7B A;  3F5R A;  1OQN A;  4HAZ B;  3SNH A;  2DTC A;  1X1F A;  2COF A;  1FGY A;  2RGN B;  3U8Z A;  1FGZ A;  1U5G A;  4HAY B;  2V76 A;  3HQC A;  3WYF B;  2DHJ A;  1W1D A;  5DIF B;  2DLW A;  1IRS A;  2MDX A;  2ROZ B;  2K2J A;  3QIJ A;  5LOP B;  1FHO A;  3LJU X;  2OQB A;  4CHJ A;  2HE7 A;  1V5M A;  1SGH A;  4HDQ A;  1U5D A;  3QWM A;  1RJ2 A;  2D9V A;  4D0N B;  3BIN A;  3ULC A;  1DRO A;  1N3H A;  4WSF A;  4KHB B;  4HAT B;  1J0W A;  2DN6 A;  1FB8 A;  1GC6 A;  1WVH A;  4DX8 A;  1LW3 A;  4HAX B;  2CAY A;  2J0J A;  4KAX B;  1X11 A;  3VOQ A;  1DDW A;  4YL8 A;  1UNP A;  3N7C A;  1DBH A;  2Z0P A;  2FJL A;  1XOD A;  1K5G B;  2EJ8 A;  2COC A;  4F7U P;  3KRW A;  2YVC A;  2ZPY A;  1V5U A;  5L81 A;  4C0A A;  1OY2 A;  3SYX A;  5FI0 A;  5D3V A;  3TO1 A;  3M1I B;  4WVF B;  5JHG A;  2GJY A;  2DHK A;  2E2X A;  3QBV B;  4P7I A;  1BAK A;  2ADZ A;  2DX1 A;  1KZ7 A;  3PVL A;  1SHC A;  1U29 A;  4MY6 A;  1U5E A;  2J59 M;  2NMB A;  2KCJ A;  1ISN A;  1I7A A;  1BTN A;  2VRW B;  1K5D B;  3KRX A;  5HE2 A;  4NY0 A;  4EJN A;  2LKO A;  2CRF A;  5C5B A;  3DXE A;  1M7R A;  3PSC A;  3KY9 A;  1H4R A;  3T06 A;  1MIZ B;  4WJ7 A;  1FHX A;  1WJM A;  1P5T A;  5JLJ B;  5KQ4 A;  2J0M A;  3P7Z A;  4GXB A;  3DXD A;  4EKU A;  3SO6 A;  4PNK A;  1GG3 A;  3HK0 A;  2GS0 A;  2YT0 A;  4MK0 A;  2W2X D;  5HE1 A;  2AL6 A;  2HTH B;  3AU5 A;  3AU4 A;  5GOW B;  1U2B A;  4Z2N A;  1QQG A;  5D27 A;  2R0D A;  2Y8G A;  2YSZ A;  4HB4 B;  2Q13 A;  1H10 A;  2N0Y A;  2KUP A;  4F7H A;  2I1J A;  4BBK A;  2NZ8 B;  2RSG A;  2UZR A;  5J3Q A;  3TFM A;  2GCL A;  3TVV A;  2D11 A;  1I2H A;  2D2Q A;  3O96 A;  3V5W A;  1XCG A;  3PZD A;  1EVH A;  2D4Q A;  2D10 A;  1XR0 B;  3ZVR A;  5KQ1 A;  2RUK B;  1OMW A;  1DDM A;  1MIX A;  4XWX A;  5HE3 A;  1P3R A;  5J3Y A;  1EGX A;  1BTK A;  4Y94 A;  3CIK A;  4Z2M B;  1WI1 A;  3MPX A;  4EMO A;  2OTX A;  3HW2 B;  4K2O A;  1B55 A;  1LB1 A;  2D9Y A;  2EMS A;  3ODX A;  4HAV B;  2BCJ A;  5DH9 B;  3CXB B;  1V5P A;  4ZRK A;  2DHI A;  3OAN A;  3FSS A;  1WGQ A;  1W1G A;  2JP2 A;  4HAU B;  1AWE A;  2DA0 A;  1FAO A;  2H7E A;  2XQN M;  2YS5 A;  2YS1 A;  2I1K A;  4MT7 A;  5J3T A;  1U5F A;  2K00 A;  2DYQ A;  2P0H A;  5D3W A;  1UEF A;  2X18 A;  4A6K A;  2ELA A;  2DKP A;  2VKI A;  3TW1 A;  1ZM0 A;  3SV1 A;  1NTV A;  1M7E A;  3ZDT A;  3PP2 A;  2MFQ A;  3AJ4 A;  4A6F A;  5JP4 A;  1UNR A;  3ODW A;  3A8Q A;  2MKR A;  4K17 A;  3U7D A;  1TXD A;  3P6A A;  1WJ1 A;  3PEG A;  5C5B B;  3FEH A;  1QC6 A;  2IFS A;  2L1C A;  4IFS A;  4HB2 B;  1KZG A;  1PMS A;  5FI1 A;  1X05 A;  1W1H A;  2P0F A;  4A6H A;  5DI9 B;  1NI2 A;  1U27 A;  4HB0 B;  1ZC3 B;  4KHA A;  4DXA B;  1FHW A;  4IOY X;  2D9Z A;  4GN1 A;  1MK9 B;  1P6S A;  1V61 A;  5D3X A;  1PFJ A;  1MAI A;  4GMX B;  1WGU A;  2EMT A;  1KI1 B;  3PG7 A;  2I5C A;  2CY5 A;  5DHF B;  4L6E A;  1XX0 A;  2P0D A;  2LOZ A;  4B6H A;  5D3Y A;  4GPT B;  2CY4 A;  1NTY A;  2LYD A;  2Z0Q A;  2QKM A;  2H7D A;  2PZ1 A;  2P8V A;  5C6R A;  4CHM A;  2ROV A;  3GYO A;  3WA0 A;  1UPR A;  3RCP A;  2RLO A;  4YON A;  1FOE A;  2MWN B;  2COD A;  4GMV A;  1X86 A;  3ML4 A;  1ZVR A;  3TCA A;  2YT1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...