3QWMA

Crystal structure of gep100, the plextrin homology domain of iq motif and sec7 domain-containing protein 1 isoform a
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
130
structure length
127
Chain Sequence
HRRLVCYCRLFEVPDPNKPQKLGLHQREIFLFNDLLVVTKIFQNSVTYSFRQSFSLYGMQVLLFENQYYPNGIRLTSSVPGADIKVLINFNAPNPQDRKKFTDDLRESIAEVQEMEKHRIESELEKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structure of GEP100, the plextrin homology domain of IQ motif and SEC7 domain-containing protein 1 isoform a
rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords IQ motif and SEC7 domain-containing protein 1
total genus 31
structure length 127
sequence length 130
ec nomenclature
pdb deposition date 2011-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16453 IQ_SEC7_PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3qwmA00
2ADZA 3WYFB 2D4QA 3OANA 2COAA 4HAZB 2DX5A 4Y94A 1FHOA 3HQCA 4WVFB 3QWMA 4D0NB 3RCPA 5C6RA 3HW2B 3ZDTA 2RNRB 5FI0A 3KZ1A 2CY5A 2D9YA 4NSWA 2J0KA 2RSGA 3VIAA 2MKRA 1U5DA 2W2WA 4F7UP 3BJIA 3ZVRA 2ELBA 2I1KA 1MAIA 3SYXA 1N3HA 1W1HA 2DA0A 1AWEA 2V76A 2VKIA 4ZRJA 1FB8A 4DX8A 1E5WA 2DTCA 4WSFA 2IYBA 1DDMA 2M38A 4HHVA 2I5CA 2J0JA 2UZSA 3AU5A 1ZVRA 2P0HA 2QKMA 4DX90 3KRWA 2RVBB 4HB0B 5HE0A 1K5GB 2DKPA 2LG1A 1QC6A 2W2XD 5D3XA 1M7EA 2RLOA 2DLWA 1NTVA 5D3VA 5C16A 2MWNB 3PVWA 1PFJA 1PMSA 3NSUA 3CIKA 1XR0B 1EVHA 3PP2A 4HB2B 1MK9B 4PQ0A 2UVMA 2Z0QA 1DROA 1UNPA 2LOZA 1WVHA 3DXDA 2KGXB 2QKLA 3V5WA 5CLLB 2P0DA 3GYOA 4KAXB 2W2XC 4A6FA 1FHXA 2P8VA 1U5EA 4GN1A 2CY4A 1LW3A 1DDWA 5LONB 1X05A 3SUZA 2FJLA 3A8QA 4A6KA 4EKUA 2ROZB 3PEGA 2YS1A 1XKEA 3KY9A 5JP4A 3F5RA 2ELAA 5D3YA 2D11A 1ZC3B 1V5UA 1MIZB 1UPRA 3U8ZA 1GC7A 2G35A 1OMWA 4GXBA 4EMOA 4K2OA 1PLSA 2YT0A 1V61A 2YS5A 2Y8GA 1UPQA 1J0WA 3F0WA 4HDOA 3FEHA 1TQZA 2AL6A 1WGQA 4HAUB 2L1CA 4L6EA 3FSSA 5DI9B 3PVLA 4Z2NA 2LYDA 1EF1A 1H4RA 2YS3A 4PNKA 4GMXB 1DYNA 5KCVA 4HAXB 4MT7A 2DFKA 4HB3B 1U5GA 4DBBA 3KRXA 3A8PA 2KCJA 2EC1A 2DKQA 4K2PA 2GCJA 2BCJA 2J0MA 2YVCA 2P0FA 1U2BA 3TVVA 1UNRA 1OQNA 1W1DA 4TYZA 2K2UA 1MK7B 5EFXA 3PSCA 2YT1A 3ODWA 1I2HA 5C5BA 5JLJB 4KHOA 1KZGA 1X1FA 1XX0A 4HAVB 3ODXA 2GCLA 4F7GA 1TJ6A 3U7DA 4HAWB 4KVGB 2GJYA 1V5PA 4IOYX 3TFMA 2RGNB 1FOEA 2ROVA 2NZ8B 1Y5OA 1EAZA 2D9VA 2H7DA 5J3QA 1I7AA 5JHHA 5C79A 2LKOA 5J3YA 1DBHA 4YONA 1B55A 3D8EA 1U29A 2OTXA 3WA0A 1WGUA 2D9WA 1BTNA 1X1GA 4EJNA 5HE3A 5KQ4A 2E2XA 4HDQA 2JP2A 2CAYA 3D8DA 4WJ7A 1IRSA 1ZSQA 2GS0A 3SV1A 1UEFA 1XODA 1BTKA 5D3WA 1W1GA 3DXCA 3M1IB 3PG7A 1ZM0A 1V88A 5J3TA 2D2QA 1K5DB 1WJMA 1MKEA 2M14A 4XWXA 3MPXA 2MDXA 2MFQA 2UZRA 4A6HA 1WJ1A 5HE1A 2PZ1A 2R0DA 2OQBA 1NTYA 2DYNA 2EJ8A 3PZDA 3LJUX 5JHGA 4GZUA 5GOWB 4IFSA 1X86A 1RRPB 5D27A 2DHKA 3UZTA 1LB1A 4K81A 1X11A 3SNHA 1U27A 2Y8FA 1BWNA 2NMBA 1EGXA 1H10A 4KHAA 2YF0A 1XD4A 5L81A 2L2IA 3IVFA 1ISNA 2HE7A 2N23A 4B6HA 3O96A 5DH9B 1SGHA 1GG3A 3ULBA 1P6SA 2Y7BA 2R09A 2K00A 3BINA 3D8FA 2ZPYA 3A98B 4TKNA 2HTHB 3G9WA 1KZ7A 1RJ2A 1Y19B 2EMSA 1TXDA 2EMTA 1NU2A 3TW1A 3QIJA 2D9ZA 3HK0A 5DHAB 5HE2A 2K2JA 2Z0OA 3AU4A 4ZRKA 2YRYA 2D9XA 4CHMA 1V89A 2IFSA 4BBKA 2DHIA 4H8SA 3TCAA 4A5KA 2DHJA 4Z2MB 1V5MA 1Q67A 1BAKA 3FM8C 1AQCA 4CHJA 3ML4A 1QQGA 3X23A 2I1JA 2COCA 4P7IA 2J59M 3N7CA 1KI1B 2I5FA 1DDVA 2CRFA 5FI1A 4IAPA 5DIFB 2VRWB 4HATB 2CODA 2D10A 4NY0A 1OY2A 1FAOA 3MDBC 1P3RA 2VSZA 4K17A 4C0AA 1MPHA 4YL8A 2KUPA 4F7HA 4CYEA 3KSYA 2LULA 3DXEA 2DYQA 2XQNM 4ZRIA 4GMVA 3SO6A 1ZC4B 1FGYA 4HB4B 3GYPA 2LOXA 4KHBB 1FGZA 3T06A 5DHFB 1NI2A 2DN6A 2YSZA 5CLQB 2X18A 3AJ4A 3VOQA 2RUKB 4MY6A 2Z0PA 5LOPB 4DXAB 5KQ1A 4MK0A 1XCGA 1UNQA 2COFA 3PVUA 2H7EA 5C5BB 1WG7A 3ULCA 1M7RA 3TO1A 1MIXA 1FHWA 2DX1A 2AEHA 1Z87A 4GPTB 3ODOA 1J19A 3P6AA 1GC6A 1U5FA 3CXBB 3QBVB 1SHCA 2Q13A 4A6FB 3P7ZA 4HAYB 1WI1A 2N0YA 1P5TA
chains in the Genus database with same CATH superfamily
2ADZA 3WYFB 2D4QA 3OANA 2COAA 4HAZB 2DX5A 4Y94A 1FHOA 3HQCA 4WVFB 3QWMA 4D0NB 3RCPA 5C6RA 3HW2B 1ZYIA 3ZDTA 2RNRB 5FI0A 3KZ1A 2CY5A 2D9YA 4NSWA 2J0KA 2RSGA 3VIAA 2MKRA 1U5DA 2W2WA 4F7UP 3BJIA 3ZVRA 2KIGA 2ELBA 2I1KA 1MAIA 3SYXA 1N3HA 1W1HA 2DA0A 1AWEA 2KIEA 2VKIA 2V76A 4ZRJA 1FB8A 2KR0A 4DX8A 1E5WA 2DTCA 2Z4DA 4WSFA 2IYBA 1DDMA 2KUQA 2M38A 4HHVA 2I5CA 2J0JA 2UZSA 3AU5A 1ZVRA 3NWAA 2P0HA 2QKMA 4QXAB 4DX90 3KRWA 2RVBB 4HB0B 5HE0A 1K5GB 2DKPA 2LG1A 1QC6A 2W2XD 5D3XA 1M7EA 2RLOA 2DLWA 1NTVA 5D3VA 2Z59A 4GNKB 5C16A 2MWNB 3PVWA 1PFJA 1PMSA 3NSUA 3CIKA 1XR0B 1EVHA 2K8EA 3PP2A 4HB2B 1MK9B 4PQ0A 2UVMA 2Z0QA 1DROA 1UNPA 2LOZA 2K49A 1WVHA 3DXDA 2KGXB 2QKLA 3V5WA 5CLLB 2P0DA 3GYOA 1MI1A 4KAXB 3U12A 2W2XC 4A6FA 1FHXA 2P8VA 1U5EA 4GN1A 2CY4A 1LW3A 1DDWA 5LONB 1X05A 3SUZA 2FJLA 3A8QA 4A6KA 4EKUA 2ROZB 3PEGA 2YS1A 1XKEA 3KY9A 5JP4A 3F5RA 2ELAA 5D3YA 2YT2A 2D11A 1ZC3B 1V5UA 1MIZB 1UPRA 3U8ZA 1GC7A 3OHMB 2G35A 1OMWA 4GXBA 2RRFA 4EMOA 4K2OA 1PLSA 4OSNA 2YT0A 1V61A 2YS5A 4HSIA 2Y8GA 5IRSA 1UPQA 1J0WA 3F0WA 4HDOA 3FVCA 3FEHA 1TQZA 2AL6A 1WGQA 4HAUB 2L1CA 4L6EA 3FSSA 4QJ5B 5DI9B 3PVLA 4Z2NA 2LYDA 1EF1A 1H4RA 2YS3A 4PNKA 4GMXB 1T77A 1DYNA 5KCVA 5M4YB 4HAXB 4MT7A 3NWFA 2DFKA 4HB3B 1U5GA 4DBBA 3KRXA 3A8PA 2KCJA 2EC1A 2DKQA 2NBVA 4K2PA 2GCJA 4D6WA 2BCJA 2J0MA 2YVCA 2P0FA 1U2BA 3TVVA 1UNRA 1OQNA 1W1DA 4TYZA 2K2UA 1MK7B 5EFXA 3PSCA 2YT1A 3ODWA 1I2HA 5C5BA 5JLJB 4KHOA 1KZGA 1X1FA 1XX0A 4HAVB 3ODXA 2GCLA 4F7GA 1TJ6A 3U7DA 4DIXA 4HAWB 4KVGB 2GJYA 1V5PA 4IOYX 3TFMA 2RGNB 1FOEA 2ROVA 2NZ8B 1Y5OA 1EAZA 2D9VA 2H7DA 5J3QA 1I7AA 5JHHA 5C79A 4L1RA 2LKOA 5J3YA 2FJUB 1DBHA 4YONA 1B55A 3D8EA 1U29A 2OTXA 3WA0A 3DCXA 1WGUA 2D9WA 1BTNA 1X1GA 4EJNA 5HE3A 5KQ4A 2E2XA 4HDQA 2JP2A 2CAYA 3D8DA 4WJ7A 1IRSA 1ZSQA 2GS0A 3HIEA 3SV1A 1UEFA 1XODA 1BTKA 5D3WA 1W1GA 3DXCA 3M1IB 3PG7A 1ZM0A 1V88A 5J3TA 2D2QA 1K5DB 1WJMA 1MKEA 2M14A 4XWXA 3MPXA 4QJ4B 2MDXA 2MFQA 2UZRA 4A6HA 1WJ1A 5HE1A 2PZ1A 2R0DA 2OQBA 1NTYA 2DYNA 2EJ8A 3HSAA 3PZDA 3LJUX 5JHGA 4GZUA 2GUMA 5GOWB 4IFSA 1X86A 1RRPB 5D27A 2DHKA 3UZTA 1LB1A 4QJ3B 4K81A 1X11A 3SNHA 1U27A 2Y8FA 1BWNA 2NMBA 1EGXA 1H10A 4KHAA 4CSQA 2YF0A 1XD4A 2ZKMX 5L81A 2L2IA 3IVFA 1ISNA 2HE7A 2N23A 4B6HA 3O96A 4OT1A 5DH9B 1SGHA 1GG3A 3ULBA 1P6SA 2Y7BA 2R09A 2K00A 5I2MA 3BINA 3D8FA 2ZPYA 3A98B 4TKNA 2HTHB 3G9WA 1KZ7A 1RJ2A 1Y19B 2EMSA 5I2SA 1TXDA 2EMTA 1NU2A 3TW1A 3QIJA 2D9ZA 3HK0A 3B77A 3NWDA 5DHAB 5HE2A 2K2JA 2Z0OA 3AU4A 4ZRKA 2YRYA 2D9XA 4CHMA 1V89A 2IFSA 4BBKA 2DHIA 4H8SA 3TCAA 4A5KA 2DHJA 4KHBA 4Z2MB 1V5MA 1Q67A 1BAKA 3FM8C 1AQCA 4CHJA 3ML4A 1QQGA 3X23A 2I1JA 2COCA 3A58A 4P7IA 2Z14A 2J59M 3N7CA 3NW8A 1KI1B 2I5FA 1DDVA 2CRFA 5FI1A 4IAPA 5DIFB 2VRWB 4HATB 2CODA 2Z13A 2D10A 4NY0A 1OY2A 1FAOA 3MDBC 1P3RA 2VSZA 4K17A 4C0AA 1MPHA 4YL8A 2KUPA 4F7HA 4CYEA 3KSYA 2LULA 3DXEA 2DYQA 2XQNM 4ZRIA 4GMVA 5LG4B 3SO6A 1ZC4B 1FGYA 4HB4B 3GYPA 2LOXA 4KHBB 1FGZA 3T06A 5DHFB 1NI2A 2DN6A 2YSZA 5CLQB 2X18A 3AJ4A 3VOQA 2RUKB 4MY6A 2Z0PA 5LOPB 4DXAB 4GOUA 5KQ1A 4MK0A 1XCGA 1UNQA 2COFA 3PVUA 2H7EA 5C5BB 1WG7A 3ULCA 1M7RA 3TO1A 1MIXA 1FHWA 2DX1A 2AEHA 1Z87A 4GPTB 3ODOA 1J19A 3P6AA 1GC6A 1U5FA 2R2YA 3CXBB 3QBVB 1SHCA 2Q13A 4A6FB 3P7ZA 4HAYB 1WI1A 2N0YA 1P5TA
chains in the Genus database with same CATH topology
2ADZA 3WYFB 2D4QA 3OANA 2COAA 4HAZB 2DX5A 4Y94A 1FHOA 3HQCA 4WVFB 3QWMA 4D0NB 3RCPA 5C6RA 3HW2B 3ZDTA 2RNRB 5FI0A 3KZ1A 2CY5A 2D9YA 4NSWA 2J0KA 2RSGA 3VIAA 2MKRA 1U5DA 2W2WA 4F7UP 3BJIA 3ZVRA 2ELBA 2I1KA 1MAIA 3SYXA 1N3HA 1W1HA 2DA0A 1AWEA 2V76A 2VKIA 4ZRJA 1FB8A 4DX8A 1E5WA 2DTCA 4WSFA 2IYBA 1DDMA 2M38A 4HHVA 2I5CA 2J0JA 2UZSA 3AU5A 1ZVRA 2P0HA 2QKMA 4DX90 3KRWA 2RVBB 4HB0B 5HE0A 1K5GB 2DKPA 2LG1A 1QC6A 2W2XD 5D3XA 1M7EA 2RLOA 2DLWA 1NTVA 5D3VA 5C16A 2MWNB 3PVWA 1PFJA 1PMSA 3NSUA 3CIKA 1XR0B 1EVHA 3PP2A 4HB2B 1MK9B 4PQ0A 2UVMA 2Z0QA 1DROA 1UNPA 2LOZA 1WVHA 3DXDA 2KGXB 2QKLA 3V5WA 5CLLB 2P0DA 3GYOA 4KAXB 2W2XC 4A6FA 1FHXA 2P8VA 1U5EA 4GN1A 2CY4A 1LW3A 1DDWA 5LONB 1X05A 3SUZA 2FJLA 3A8QA 4A6KA 4EKUA 2ROZB 3PEGA 2YS1A 1XKEA 3KY9A 5JP4A 3F5RA 2ELAA 5D3YA 2D11A 1ZC3B 1V5UA 1MIZB 1UPRA 3U8ZA 1GC7A 2G35A 1OMWA 4GXBA 4EMOA 4K2OA 1PLSA 2YT0A 1V61A 2YS5A 2Y8GA 1UPQA 1J0WA 3F0WA 4HDOA 3FEHA 1TQZA 2AL6A 1WGQA 4HAUB 2L1CA 4L6EA 3FSSA 5DI9B 3PVLA 4Z2NA 2LYDA 1EF1A 1H4RA 2YS3A 4PNKA 4GMXB 1DYNA 5KCVA 4HAXB 4MT7A 2DFKA 4HB3B 1U5GA 4DBBA 3KRXA 3A8PA 2KCJA 2EC1A 2DKQA 4K2PA 2GCJA 2BCJA 2J0MA 2YVCA 2P0FA 1U2BA 3TVVA 1UNRA 1OQNA 1W1DA 4TYZA 2K2UA 1MK7B 5EFXA 3PSCA 2YT1A 3ODWA 1I2HA 5C5BA 5JLJB 4KHOA 1KZGA 1X1FA 1XX0A 4HAVB 3ODXA 2GCLA 4F7GA 1TJ6A 3U7DA 4HAWB 4KVGB 2GJYA 1V5PA 4IOYX 3TFMA 2RGNB 1FOEA 2ROVA 2NZ8B 1Y5OA 1EAZA 2D9VA 2H7DA 5J3QA 1I7AA 5JHHA 5C79A 2LKOA 5J3YA 1DBHA 4YONA 1B55A 3D8EA 1U29A 2OTXA 3WA0A 1WGUA 2D9WA 1BTNA 1X1GA 4EJNA 5HE3A 5KQ4A 2E2XA 4HDQA 2JP2A 2CAYA 3D8DA 4WJ7A 1IRSA 1ZSQA 2GS0A 3SV1A 1UEFA 1XODA 1BTKA 5D3WA 1W1GA 3DXCA 3M1IB 3PG7A 1ZM0A 1V88A 5J3TA 2D2QA 1K5DB 1WJMA 1MKEA 2M14A 4XWXA 3MPXA 2MDXA 2MFQA 2UZRA 4A6HA 1WJ1A 5HE1A 2PZ1A 2R0DA 2OQBA 1NTYA 2DYNA 2EJ8A 3PZDA 3LJUX 5JHGA 4GZUA 5GOWB 4IFSA 1X86A 1RRPB 5D27A 2DHKA 3UZTA 1LB1A 4K81A 1X11A 3SNHA 1U27A 2Y8FA 1BWNA 2NMBA 1EGXA 1H10A 4KHAA 2YF0A 1XD4A 5L81A 2L2IA 3IVFA 1ISNA 2HE7A 2N23A 4B6HA 3O96A 5DH9B 1SGHA 1GG3A 3ULBA 1P6SA 2Y7BA 2R09A 2K00A 3BINA 3D8FA 2ZPYA 3A98B 4TKNA 2HTHB 3G9WA 1KZ7A 1RJ2A 1Y19B 2EMSA 1TXDA 2EMTA 1NU2A 3TW1A 3QIJA 2D9ZA 3HK0A 5DHAB 5HE2A 2K2JA 2Z0OA 3AU4A 4ZRKA 2YRYA 2D9XA 4CHMA 1V89A 2IFSA 4BBKA 2DHIA 4H8SA 3TCAA 4A5KA 2DHJA 4Z2MB 1V5MA 1Q67A 1BAKA 3FM8C 1AQCA 4CHJA 3ML4A 1QQGA 3X23A 2I1JA 2COCA 4P7IA 2J59M 3N7CA 1KI1B 2I5FA 1DDVA 2CRFA 5FI1A 4IAPA 5DIFB 2VRWB 4HATB 2CODA 2D10A 4NY0A 1OY2A 1FAOA 3MDBC 1P3RA 2VSZA 4K17A 4C0AA 1MPHA 4YL8A 2KUPA 4F7HA 4CYEA 3KSYA 2LULA 3DXEA 2DYQA 2XQNM 4ZRIA 4GMVA 3SO6A 1ZC4B 1FGYA 4HB4B 3GYPA 2LOXA 4KHBB 1FGZA 3T06A 5DHFB 1NI2A 2DN6A 2YSZA 5CLQB 2X18A 3AJ4A 3VOQA 2RUKB 4MY6A 2Z0PA 5LOPB 4DXAB 5KQ1A 4MK0A 1XCGA 1UNQA 2COFA 3PVUA 2H7EA 5C5BB 1WG7A 3ULCA 1M7RA 3TO1A 1MIXA 1FHWA 2DX1A 2AEHA 1Z87A 4GPTB 3ODOA 1J19A 3P6AA 1GC6A 1U5FA 3CXBB 3QBVB 1SHCA 2Q13A 4A6FB 3P7ZA 4HAYB 1WI1A 2N0YA 1P5TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ADZ A;  3WYF B;  2D4Q A;  3OAN A;  2COA A;  4HAZ B;  2DX5 A;  4Y94 A;  1FHO A;  3HQC A;  4WVF B;  3QWM A;  4D0N B;  3RCP A;  5C6R A;  3HW2 B;  3ZDT A;  2RNR B;  5FI0 A;  3KZ1 A;  2CY5 A;  2D9Y A;  4NSW A;  2J0K A;  2RSG A;  3VIA A;  2MKR A;  1U5D A;  2W2W A;  4F7U P;  3BJI A;  3ZVR A;  2ELB A;  2I1K A;  1MAI A;  3SYX A;  1N3H A;  1W1H A;  2DA0 A;  1AWE A;  2V76 A;  2VKI A;  4ZRJ A;  1FB8 A;  4DX8 A;  1E5W A;  2DTC A;  4WSF A;  2IYB A;  1DDM A;  2M38 A;  4HHV A;  2I5C A;  2J0J A;  2UZS A;  3AU5 A;  1ZVR A;  2P0H A;  2QKM A;  4DX9 0;  3KRW A;  2RVB B;  4HB0 B;  5HE0 A;  1K5G B;  2DKP A;  2LG1 A;  1QC6 A;  2W2X D;  5D3X A;  1M7E A;  2RLO A;  2DLW A;  1NTV A;  5D3V A;  5C16 A;  2MWN B;  3PVW A;  1PFJ A;  1PMS A;  3NSU A;  3CIK A;  1XR0 B;  1EVH A;  3PP2 A;  4HB2 B;  1MK9 B;  4PQ0 A;  2UVM A;  2Z0Q A;  1DRO A;  1UNP A;  2LOZ A;  1WVH A;  3DXD A;  2KGX B;  2QKL A;  3V5W A;  5CLL B;  2P0D A;  3GYO A;  4KAX B;  2W2X C;  4A6F A;  1FHX A;  2P8V A;  1U5E A;  4GN1 A;  2CY4 A;  1LW3 A;  1DDW A;  5LON B;  1X05 A;  3SUZ A;  2FJL A;  3A8Q A;  4A6K A;  4EKU A;  2ROZ B;  3PEG A;  2YS1 A;  1XKE A;  3KY9 A;  5JP4 A;  3F5R A;  2ELA A;  5D3Y A;  2D11 A;  1ZC3 B;  1V5U A;  1MIZ B;  1UPR A;  3U8Z A;  1GC7 A;  2G35 A;  1OMW A;  4GXB A;  4EMO A;  4K2O A;  1PLS A;  2YT0 A;  1V61 A;  2YS5 A;  2Y8G A;  1UPQ A;  1J0W A;  3F0W A;  4HDO A;  3FEH A;  1TQZ A;  2AL6 A;  1WGQ A;  4HAU B;  2L1C A;  4L6E A;  3FSS A;  5DI9 B;  3PVL A;  4Z2N A;  2LYD A;  1EF1 A;  1H4R A;  2YS3 A;  4PNK A;  4GMX B;  1DYN A;  5KCV A;  4HAX B;  4MT7 A;  2DFK A;  4HB3 B;  1U5G A;  4DBB A;  3KRX A;  3A8P A;  2KCJ A;  2EC1 A;  2DKQ A;  4K2P A;  2GCJ A;  2BCJ A;  2J0M A;  2YVC A;  2P0F A;  1U2B A;  3TVV A;  1UNR A;  1OQN A;  1W1D A;  4TYZ A;  2K2U A;  1MK7 B;  5EFX A;  3PSC A;  2YT1 A;  3ODW A;  1I2H A;  5C5B A;  5JLJ B;  4KHO A;  1KZG A;  1X1F A;  1XX0 A;  4HAV B;  3ODX A;  2GCL A;  4F7G A;  1TJ6 A;  3U7D A;  4HAW B;  4KVG B;  2GJY A;  1V5P A;  4IOY X;  3TFM A;  2RGN B;  1FOE A;  2ROV A;  2NZ8 B;  1Y5O A;  1EAZ A;  2D9V A;  2H7D A;  5J3Q A;  1I7A A;  5JHH A;  5C79 A;  2LKO A;  5J3Y A;  1DBH A;  4YON A;  1B55 A;  3D8E A;  1U29 A;  2OTX A;  3WA0 A;  1WGU A;  2D9W A;  1BTN A;  1X1G A;  4EJN A;  5HE3 A;  5KQ4 A;  2E2X A;  4HDQ A;  2JP2 A;  2CAY A;  3D8D A;  4WJ7 A;  1IRS A;  1ZSQ A;  2GS0 A;  3SV1 A;  1UEF A;  1XOD A;  1BTK A;  5D3W A;  1W1G A;  3DXC A;  3M1I B;  3PG7 A;  1ZM0 A;  1V88 A;  5J3T A;  2D2Q A;  1K5D B;  1WJM A;  1MKE A;  2M14 A;  4XWX A;  3MPX A;  2MDX A;  2MFQ A;  2UZR A;  4A6H A;  1WJ1 A;  5HE1 A;  2PZ1 A;  2R0D A;  2OQB A;  1NTY A;  2DYN A;  2EJ8 A;  3PZD A;  3LJU X;  5JHG A;  4GZU A;  5GOW B;  4IFS A;  1X86 A;  1RRP B;  5D27 A;  2DHK A;  3UZT A;  1LB1 A;  4K81 A;  1X11 A;  3SNH A;  1U27 A;  2Y8F A;  1BWN A;  2NMB A;  1EGX A;  1H10 A;  4KHA A;  2YF0 A;  1XD4 A;  5L81 A;  2L2I A;  3IVF A;  1ISN A;  2HE7 A;  2N23 A;  4B6H A;  3O96 A;  5DH9 B;  1SGH A;  1GG3 A;  3ULB A;  1P6S A;  2Y7B A;  2R09 A;  2K00 A;  3BIN A;  3D8F A;  2ZPY A;  3A98 B;  4TKN A;  2HTH B;  3G9W A;  1KZ7 A;  1RJ2 A;  1Y19 B;  2EMS A;  1TXD A;  2EMT A;  1NU2 A;  3TW1 A;  3QIJ A;  2D9Z A;  3HK0 A;  5DHA B;  5HE2 A;  2K2J A;  2Z0O A;  3AU4 A;  4ZRK A;  2YRY A;  2D9X A;  4CHM A;  1V89 A;  2IFS A;  4BBK A;  2DHI A;  4H8S A;  3TCA A;  4A5K A;  2DHJ A;  4Z2M B;  1V5M A;  1Q67 A;  1BAK A;  3FM8 C;  1AQC A;  4CHJ A;  3ML4 A;  1QQG A;  3X23 A;  2I1J A;  2COC A;  4P7I A;  2J59 M;  3N7C A;  1KI1 B;  2I5F A;  1DDV A;  2CRF A;  5FI1 A;  4IAP A;  5DIF B;  2VRW B;  4HAT B;  2COD A;  2D10 A;  4NY0 A;  1OY2 A;  1FAO A;  3MDB C;  1P3R A;  2VSZ A;  4K17 A;  4C0A A;  1MPH A;  4YL8 A;  2KUP A;  4F7H A;  4CYE A;  3KSY A;  2LUL A;  3DXE A;  2DYQ A;  2XQN M;  4ZRI A;  4GMV A;  3SO6 A;  1ZC4 B;  1FGY A;  4HB4 B;  3GYP A;  2LOX A;  4KHB B;  1FGZ A;  3T06 A;  5DHF B;  1NI2 A;  2DN6 A;  2YSZ A;  5CLQ B;  2X18 A;  3AJ4 A;  3VOQ A;  2RUK B;  4MY6 A;  2Z0P A;  5LOP B;  4DXA B;  5KQ1 A;  4MK0 A;  1XCG A;  1UNQ A;  2COF A;  3PVU A;  2H7E A;  5C5B B;  1WG7 A;  3ULC A;  1M7R A;  3TO1 A;  1MIX A;  1FHW A;  2DX1 A;  2AEH A;  1Z87 A;  4GPT B;  3ODO A;  1J19 A;  3P6A A;  1GC6 A;  1U5F A;  3CXB B;  3QBV B;  1SHC A;  2Q13 A;  4A6F B;  3P7Z A;  4HAY B;  1WI1 A;  2N0Y A;  1P5T A; 
#chains in the Genus database with same CATH topology
 2ADZ A;  3WYF B;  2D4Q A;  3OAN A;  2COA A;  4HAZ B;  2DX5 A;  4Y94 A;  1FHO A;  3HQC A;  4WVF B;  3QWM A;  4D0N B;  3RCP A;  5C6R A;  3HW2 B;  1ZYI A;  3ZDT A;  2RNR B;  5FI0 A;  3KZ1 A;  2CY5 A;  2D9Y A;  4NSW A;  2J0K A;  2RSG A;  3VIA A;  2MKR A;  1U5D A;  2W2W A;  4F7U P;  3BJI A;  3ZVR A;  2KIG A;  2ELB A;  2I1K A;  1MAI A;  3SYX A;  1N3H A;  1W1H A;  2DA0 A;  1AWE A;  2KIE A;  2VKI A;  2V76 A;  4ZRJ A;  1FB8 A;  2KR0 A;  4DX8 A;  1E5W A;  2DTC A;  2Z4D A;  4WSF A;  2IYB A;  1DDM A;  2KUQ A;  2M38 A;  4HHV A;  2I5C A;  2J0J A;  2UZS A;  3AU5 A;  1ZVR A;  3NWA A;  2P0H A;  2QKM A;  4QXA B;  4DX9 0;  3KRW A;  2RVB B;  4HB0 B;  5HE0 A;  1K5G B;  2DKP A;  2LG1 A;  1QC6 A;  2W2X D;  5D3X A;  1M7E A;  2RLO A;  2DLW A;  1NTV A;  5D3V A;  2Z59 A;  4GNK B;  5C16 A;  2MWN B;  3PVW A;  1PFJ A;  1PMS A;  3NSU A;  3CIK A;  1XR0 B;  1EVH A;  2K8E A;  3PP2 A;  4HB2 B;  1MK9 B;  4PQ0 A;  2UVM A;  2Z0Q A;  1DRO A;  1UNP A;  2LOZ A;  2K49 A;  1WVH A;  3DXD A;  2KGX B;  2QKL A;  3V5W A;  5CLL B;  2P0D A;  3GYO A;  1MI1 A;  4KAX B;  3U12 A;  2W2X C;  4A6F A;  1FHX A;  2P8V A;  1U5E A;  4GN1 A;  2CY4 A;  1LW3 A;  1DDW A;  5LON B;  1X05 A;  3SUZ A;  2FJL A;  3A8Q A;  4A6K A;  4EKU A;  2ROZ B;  3PEG A;  2YS1 A;  1XKE A;  3KY9 A;  5JP4 A;  3F5R A;  2ELA A;  5D3Y A;  2YT2 A;  2D11 A;  1ZC3 B;  1V5U A;  1MIZ B;  1UPR A;  3U8Z A;  1GC7 A;  3OHM B;  2G35 A;  1OMW A;  4GXB A;  2RRF A;  4EMO A;  4K2O A;  1PLS A;  4OSN A;  2YT0 A;  1V61 A;  2YS5 A;  4HSI A;  2Y8G A;  5IRS A;  1UPQ A;  1J0W A;  3F0W A;  4HDO A;  3FVC A;  3FEH A;  1TQZ A;  2AL6 A;  1WGQ A;  4HAU B;  2L1C A;  4L6E A;  3FSS A;  4QJ5 B;  5DI9 B;  3PVL A;  4Z2N A;  2LYD A;  1EF1 A;  1H4R A;  2YS3 A;  4PNK A;  4GMX B;  1T77 A;  1DYN A;  5KCV A;  5M4Y B;  4HAX B;  4MT7 A;  3NWF A;  2DFK A;  4HB3 B;  1U5G A;  4DBB A;  3KRX A;  3A8P A;  2KCJ A;  2EC1 A;  2DKQ A;  2NBV A;  4K2P A;  2GCJ A;  4D6W A;  2BCJ A;  2J0M A;  2YVC A;  2P0F A;  1U2B A;  3TVV A;  1UNR A;  1OQN A;  1W1D A;  4TYZ A;  2K2U A;  1MK7 B;  5EFX A;  3PSC A;  2YT1 A;  3ODW A;  1I2H A;  5C5B A;  5JLJ B;  4KHO A;  1KZG A;  1X1F A;  1XX0 A;  4HAV B;  3ODX A;  2GCL A;  4F7G A;  1TJ6 A;  3U7D A;  4DIX A;  4HAW B;  4KVG B;  2GJY A;  1V5P A;  4IOY X;  3TFM A;  2RGN B;  1FOE A;  2ROV A;  2NZ8 B;  1Y5O A;  1EAZ A;  2D9V A;  2H7D A;  5J3Q A;  1I7A A;  5JHH A;  5C79 A;  4L1R A;  2LKO A;  5J3Y A;  2FJU B;  1DBH A;  4YON A;  1B55 A;  3D8E A;  1U29 A;  2OTX A;  3WA0 A;  3DCX A;  1WGU A;  2D9W A;  1BTN A;  1X1G A;  4EJN A;  5HE3 A;  5KQ4 A;  2E2X A;  4HDQ A;  2JP2 A;  2CAY A;  3D8D A;  4WJ7 A;  1IRS A;  1ZSQ A;  2GS0 A;  3HIE A;  3SV1 A;  1UEF A;  1XOD A;  1BTK A;  5D3W A;  1W1G A;  3DXC A;  3M1I B;  3PG7 A;  1ZM0 A;  1V88 A;  5J3T A;  2D2Q A;  1K5D B;  1WJM A;  1MKE A;  2M14 A;  4XWX A;  3MPX A;  4QJ4 B;  2MDX A;  2MFQ A;  2UZR A;  4A6H A;  1WJ1 A;  5HE1 A;  2PZ1 A;  2R0D A;  2OQB A;  1NTY A;  2DYN A;  2EJ8 A;  3HSA A;  3PZD A;  3LJU X;  5JHG A;  4GZU A;  2GUM A;  5GOW B;  4IFS A;  1X86 A;  1RRP B;  5D27 A;  2DHK A;  3UZT A;  1LB1 A;  4QJ3 B;  4K81 A;  1X11 A;  3SNH A;  1U27 A;  2Y8F A;  1BWN A;  2NMB A;  1EGX A;  1H10 A;  4KHA A;  4CSQ A;  2YF0 A;  1XD4 A;  2ZKM X;  5L81 A;  2L2I A;  3IVF A;  1ISN A;  2HE7 A;  2N23 A;  4B6H A;  3O96 A;  4OT1 A;  5DH9 B;  1SGH A;  1GG3 A;  3ULB A;  1P6S A;  2Y7B A;  2R09 A;  2K00 A;  5I2M A;  3BIN A;  3D8F A;  2ZPY A;  3A98 B;  4TKN A;  2HTH B;  3G9W A;  1KZ7 A;  1RJ2 A;  1Y19 B;  2EMS A;  5I2S A;  1TXD A;  2EMT A;  1NU2 A;  3TW1 A;  3QIJ A;  2D9Z A;  3HK0 A;  3B77 A;  3NWD A;  5DHA B;  5HE2 A;  2K2J A;  2Z0O A;  3AU4 A;  4ZRK A;  2YRY A;  2D9X A;  4CHM A;  1V89 A;  2IFS A;  4BBK A;  2DHI A;  4H8S A;  3TCA A;  4A5K A;  2DHJ A;  4KHB A;  4Z2M B;  1V5M A;  1Q67 A;  1BAK A;  3FM8 C;  1AQC A;  4CHJ A;  3ML4 A;  1QQG A;  3X23 A;  2I1J A;  2COC A;  3A58 A;  4P7I A;  2Z14 A;  2J59 M;  3N7C A;  3NW8 A;  1KI1 B;  2I5F A;  1DDV A;  2CRF A;  5FI1 A;  4IAP A;  5DIF B;  2VRW B;  4HAT B;  2COD A;  2Z13 A;  2D10 A;  4NY0 A;  1OY2 A;  1FAO A;  3MDB C;  1P3R A;  2VSZ A;  4K17 A;  4C0A A;  1MPH A;  4YL8 A;  2KUP A;  4F7H A;  4CYE A;  3KSY A;  2LUL A;  3DXE A;  2DYQ A;  2XQN M;  4ZRI A;  4GMV A;  5LG4 B;  3SO6 A;  1ZC4 B;  1FGY A;  4HB4 B;  3GYP A;  2LOX A;  4KHB B;  1FGZ A;  3T06 A;  5DHF B;  1NI2 A;  2DN6 A;  2YSZ A;  5CLQ B;  2X18 A;  3AJ4 A;  3VOQ A;  2RUK B;  4MY6 A;  2Z0P A;  5LOP B;  4DXA B;  4GOU A;  5KQ1 A;  4MK0 A;  1XCG A;  1UNQ A;  2COF A;  3PVU A;  2H7E A;  5C5B B;  1WG7 A;  3ULC A;  1M7R A;  3TO1 A;  1MIX A;  1FHW A;  2DX1 A;  2AEH A;  1Z87 A;  4GPT B;  3ODO A;  1J19 A;  3P6A A;  1GC6 A;  1U5F A;  2R2Y A;  3CXB B;  3QBV B;  1SHC A;  2Q13 A;  4A6F B;  3P7Z A;  4HAY B;  1WI1 A;  2N0Y A;  1P5T A; 
#chains in the Genus database with same CATH homology
 2ADZ A;  3WYF B;  2D4Q A;  3OAN A;  2COA A;  4HAZ B;  2DX5 A;  4Y94 A;  1FHO A;  3HQC A;  4WVF B;  3QWM A;  4D0N B;  3RCP A;  5C6R A;  3HW2 B;  3ZDT A;  2RNR B;  5FI0 A;  3KZ1 A;  2CY5 A;  2D9Y A;  4NSW A;  2J0K A;  2RSG A;  3VIA A;  2MKR A;  1U5D A;  2W2W A;  4F7U P;  3BJI A;  3ZVR A;  2ELB A;  2I1K A;  1MAI A;  3SYX A;  1N3H A;  1W1H A;  2DA0 A;  1AWE A;  2V76 A;  2VKI A;  4ZRJ A;  1FB8 A;  4DX8 A;  1E5W A;  2DTC A;  4WSF A;  2IYB A;  1DDM A;  2M38 A;  4HHV A;  2I5C A;  2J0J A;  2UZS A;  3AU5 A;  1ZVR A;  2P0H A;  2QKM A;  4DX9 0;  3KRW A;  2RVB B;  4HB0 B;  5HE0 A;  1K5G B;  2DKP A;  2LG1 A;  1QC6 A;  2W2X D;  5D3X A;  1M7E A;  2RLO A;  2DLW A;  1NTV A;  5D3V A;  5C16 A;  2MWN B;  3PVW A;  1PFJ A;  1PMS A;  3NSU A;  3CIK A;  1XR0 B;  1EVH A;  3PP2 A;  4HB2 B;  1MK9 B;  4PQ0 A;  2UVM A;  2Z0Q A;  1DRO A;  1UNP A;  2LOZ A;  1WVH A;  3DXD A;  2KGX B;  2QKL A;  3V5W A;  5CLL B;  2P0D A;  3GYO A;  4KAX B;  2W2X C;  4A6F A;  1FHX A;  2P8V A;  1U5E A;  4GN1 A;  2CY4 A;  1LW3 A;  1DDW A;  5LON B;  1X05 A;  3SUZ A;  2FJL A;  3A8Q A;  4A6K A;  4EKU A;  2ROZ B;  3PEG A;  2YS1 A;  1XKE A;  3KY9 A;  5JP4 A;  3F5R A;  2ELA A;  5D3Y A;  2D11 A;  1ZC3 B;  1V5U A;  1MIZ B;  1UPR A;  3U8Z A;  1GC7 A;  2G35 A;  1OMW A;  4GXB A;  4EMO A;  4K2O A;  1PLS A;  2YT0 A;  1V61 A;  2YS5 A;  2Y8G A;  1UPQ A;  1J0W A;  3F0W A;  4HDO A;  3FEH A;  1TQZ A;  2AL6 A;  1WGQ A;  4HAU B;  2L1C A;  4L6E A;  3FSS A;  5DI9 B;  3PVL A;  4Z2N A;  2LYD A;  1EF1 A;  1H4R A;  2YS3 A;  4PNK A;  4GMX B;  1DYN A;  5KCV A;  4HAX B;  4MT7 A;  2DFK A;  4HB3 B;  1U5G A;  4DBB A;  3KRX A;  3A8P A;  2KCJ A;  2EC1 A;  2DKQ A;  4K2P A;  2GCJ A;  2BCJ A;  2J0M A;  2YVC A;  2P0F A;  1U2B A;  3TVV A;  1UNR A;  1OQN A;  1W1D A;  4TYZ A;  2K2U A;  1MK7 B;  5EFX A;  3PSC A;  2YT1 A;  3ODW A;  1I2H A;  5C5B A;  5JLJ B;  4KHO A;  1KZG A;  1X1F A;  1XX0 A;  4HAV B;  3ODX A;  2GCL A;  4F7G A;  1TJ6 A;  3U7D A;  4HAW B;  4KVG B;  2GJY A;  1V5P A;  4IOY X;  3TFM A;  2RGN B;  1FOE A;  2ROV A;  2NZ8 B;  1Y5O A;  1EAZ A;  2D9V A;  2H7D A;  5J3Q A;  1I7A A;  5JHH A;  5C79 A;  2LKO A;  5J3Y A;  1DBH A;  4YON A;  1B55 A;  3D8E A;  1U29 A;  2OTX A;  3WA0 A;  1WGU A;  2D9W A;  1BTN A;  1X1G A;  4EJN A;  5HE3 A;  5KQ4 A;  2E2X A;  4HDQ A;  2JP2 A;  2CAY A;  3D8D A;  4WJ7 A;  1IRS A;  1ZSQ A;  2GS0 A;  3SV1 A;  1UEF A;  1XOD A;  1BTK A;  5D3W A;  1W1G A;  3DXC A;  3M1I B;  3PG7 A;  1ZM0 A;  1V88 A;  5J3T A;  2D2Q A;  1K5D B;  1WJM A;  1MKE A;  2M14 A;  4XWX A;  3MPX A;  2MDX A;  2MFQ A;  2UZR A;  4A6H A;  1WJ1 A;  5HE1 A;  2PZ1 A;  2R0D A;  2OQB A;  1NTY A;  2DYN A;  2EJ8 A;  3PZD A;  3LJU X;  5JHG A;  4GZU A;  5GOW B;  4IFS A;  1X86 A;  1RRP B;  5D27 A;  2DHK A;  3UZT A;  1LB1 A;  4K81 A;  1X11 A;  3SNH A;  1U27 A;  2Y8F A;  1BWN A;  2NMB A;  1EGX A;  1H10 A;  4KHA A;  2YF0 A;  1XD4 A;  5L81 A;  2L2I A;  3IVF A;  1ISN A;  2HE7 A;  2N23 A;  4B6H A;  3O96 A;  5DH9 B;  1SGH A;  1GG3 A;  3ULB A;  1P6S A;  2Y7B A;  2R09 A;  2K00 A;  3BIN A;  3D8F A;  2ZPY A;  3A98 B;  4TKN A;  2HTH B;  3G9W A;  1KZ7 A;  1RJ2 A;  1Y19 B;  2EMS A;  1TXD A;  2EMT A;  1NU2 A;  3TW1 A;  3QIJ A;  2D9Z A;  3HK0 A;  5DHA B;  5HE2 A;  2K2J A;  2Z0O A;  3AU4 A;  4ZRK A;  2YRY A;  2D9X A;  4CHM A;  1V89 A;  2IFS A;  4BBK A;  2DHI A;  4H8S A;  3TCA A;  4A5K A;  2DHJ A;  4Z2M B;  1V5M A;  1Q67 A;  1BAK A;  3FM8 C;  1AQC A;  4CHJ A;  3ML4 A;  1QQG A;  3X23 A;  2I1J A;  2COC A;  4P7I A;  2J59 M;  3N7C A;  1KI1 B;  2I5F A;  1DDV A;  2CRF A;  5FI1 A;  4IAP A;  5DIF B;  2VRW B;  4HAT B;  2COD A;  2D10 A;  4NY0 A;  1OY2 A;  1FAO A;  3MDB C;  1P3R A;  2VSZ A;  4K17 A;  4C0A A;  1MPH A;  4YL8 A;  2KUP A;  4F7H A;  4CYE A;  3KSY A;  2LUL A;  3DXE A;  2DYQ A;  2XQN M;  4ZRI A;  4GMV A;  3SO6 A;  1ZC4 B;  1FGY A;  4HB4 B;  3GYP A;  2LOX A;  4KHB B;  1FGZ A;  3T06 A;  5DHF B;  1NI2 A;  2DN6 A;  2YSZ A;  5CLQ B;  2X18 A;  3AJ4 A;  3VOQ A;  2RUK B;  4MY6 A;  2Z0P A;  5LOP B;  4DXA B;  5KQ1 A;  4MK0 A;  1XCG A;  1UNQ A;  2COF A;  3PVU A;  2H7E A;  5C5B B;  1WG7 A;  3ULC A;  1M7R A;  3TO1 A;  1MIX A;  1FHW A;  2DX1 A;  2AEH A;  1Z87 A;  4GPT B;  3ODO A;  1J19 A;  3P6A A;  1GC6 A;  1U5F A;  3CXB B;  3QBV B;  1SHC A;  2Q13 A;  4A6F B;  3P7Z A;  4HAY B;  1WI1 A;  2N0Y A;  1P5T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...