1V88A

Solution structure of the pleckstrin homology domain of oxysterol-binding protein-related protein 8 (kiaa1451 protein)
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
130
structure length
130
Chain Sequence
GSSGSSGIVMADWLKIRGTLKSWTKLWCVLKPGVLLIYKTQKNGQWVGTVLLNACEIIERPSKKDGFCFKLFHPLEQSIWAVKGPKGEAVGSITQPLPSSYLIIRATSESDGRCWMDALELALKSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lipid transport
molecule keywords Oxysterol binding protein-related protein 8
publication title Solution Structure of the Pleckstrin Homology Domain of Oxysterol-Binding Protein-Related Protein 8 (KIAA1451 Protein)
rcsb
source organism Homo sapiens
total genus 16
structure length 130
sequence length 130
ec nomenclature
pdb deposition date 2003-12-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1v88A00
4GMXB 3DXCA 1ZVRA 4GPTB 2D10A 1K5DB 2RLOA 2YF0A 4WJ7A 1MK9B 1EGXA 1P6SA 2EJ8A 2AL6A 2K2JA 2NMBA 2LULA 2E2XA 4KHOA 1BTNA 5FI0A 3O96A 4K17A 4P7IA 2KCJA 2UZRA 1XCGA 3DXEA 1UPRA 1Q67A 2R0DA 3BJIA 4ZRIA 1W1DA 2H7EA 3KSYA 1I2HA 4HAYB 2NZ8B 4H8SA 1FHOA 4B6HA 1V88A 1Y19B 5DIFB 2YRYA 2N0YA 3FSSA 4HB2B 4MK0A 2EMTA 1P3RA 4F7UP 4EMOA 1WI1A 1V5PA 1MK7B 2ADZA 2I1KA 1H10A 2GJYA 4HDOA 1W1GA 1J19A 1ZSQA 2R09A 5JHHA 5HE3A 3P7ZA 4HAZB 1P5TA 1V89A 2UVMA 3GYOA 2UZSA 1XR0B 3PZDA 4Y94A 2ROVA 3SUZA 4HDQA 2DHIA 1Y5OA 4CYEA 2OQBA 2HTHB 2LOZA 3FM8C 2X18A 5D3WA 1WJ1A 4GN1A 5DI9B 2P0HA 1EAZA 5L81A 1FHWA 5HE1A 4CHJA 1UEFA 4HAWB 4EJNA 3G9WA 3PSCA 3VIAA 4K2OA 2COFA 2GCJA 2M14A 4EKUA 1J0WA 1NTVA 2VKIA 3WA0A 3SV1A 4DBBA 3KRWA 2KGXB 1LB1A 2LKOA 3ML4A 5JP4A 2V76A 3PVWA 2L2IA 2D4QA 3T06A 2P0FA 1FB8A 1FGYA 2W2WA 1AWEA 2Z0QA 4GMVA 3VOQA 4ZRKA 2DX1A 2OTXA 2VRWB 1TQZA 1XD4A 2DTCA 3F5RA 2XQNM 1OMWA 4Z2NA 2YT1A 5KQ4A 1SGHA 3ULCA 2CY4A 2YS3A 4TYZA 4A6HA 3TO1A 5C79A 1MKEA 1MIZB 4A6FB 2DN6A 2AEHA 4K2PA 2IYBA 4F7GA 1DDMA 1DBHA 3MDBC 5C6RA 4L6EA 2LG1A 2W2XD 1GC6A 1FAOA 2CODA 1PFJA 2Q13A 1EVHA 1OQNA 3UZTA 2PZ1A 3TVVA 1DROA 1U5GA 3SNHA 4PNKA 5HE0A 1FOEA 2I1JA 5JLJB 3PVLA 5FI1A 1RJ2A 1UNPA 2BCJA 5J3QA 2MWNB 4A6FA 4HB0B 1H4RA 3PG7A 2MFQA 2G35A 3QIJA 4F7HA 1PLSA 4YL8A 5LONB 3ULBA 4A5KA 2MKRA 3F0WA 2LOXA 2K00A 3DXDA 2LYDA 1ZC4B 2COAA 3PVUA 4MT7A 4NSWA 1V5UA 2DYNA 3MPXA 1DDWA 3ODOA 1U29A 2D9YA 2D9XA 4HATB 3SYXA 3WYFB 3A98B 5GOWB 3IVFA 5J3TA 4A6KA 1MIXA 1XODA 3QBVB 2EMSA 4Z2MB 4IAPA 4GXBA 3D8FA 1XKEA 5CLLB 2RGNB 4IOYX 1X05A 2ELAA 2JP2A 3AJ4A 2DHKA 4IFSA 1NTYA 1K5GB 2D2QA 3M1IB 4DXAB 1KZGA 3TFMA 2VSZA 2YS1A 3U7DA 1NU2A 3ZVRA 1M7EA 1IRSA 1BWNA 3LJUX 3CIKA 2D9VA 5DHAB 2L1CA 3U8ZA 2D9WA 1WGUA 1BAKA 2DLWA 3V5WA 1SHCA 4PQ0A 4K81A 2Y8FA 1NI2A 5D27A 1BTKA 3AU4A 4MY6A 1WG7A 3BINA 4KHAA 2DYQA 3A8PA 5C5BB 1B55A 1TXDA 2I5CA 3KRXA 3GYPA 1U5EA 4TKNA 2FJLA 2J59M 2RVBB 3TW1A 2GCLA 2CY5A 1KI1B 2Z0PA 3HW2B 5LOPB 1X86A 4HB3B 3TCAA 2RSGA 5C16A 1M7RA 5D3VA 2Y8GA 2D11A 2W2XC 1X1GA 4D0NB 5HE2A 5CLQB 1V5MA 3PEGA 1I7AA 3X23A 5EFXA 1WJMA 2J0MA 3D8EA 5DHFB 1U27A 3AU5A 1U5DA 4HHVA 1PMSA 5C5BA 4CHMA 2J0KA 2P0DA 2ROZB 3QWMA 4BBKA 3RCPA 1U5FA 1Z87A 1TJ6A 4KHBB 3NSUA 3KY9A 1QQGA 3SO6A 3FEHA 2M38A 3ZDTA 3ODXA 1ZC3B 2H7DA 2KUPA 2DHJA 3A8QA 1ZM0A 2I5FA 2COCA 2DA0A 1UPQA 3P6AA 3HQCA 2YSZA 4WVFB 1V61A 2EC1A 1N3HA 1FGZA 2YT0A 2N23A 2IFSA 4HAUB 4ZRJA 2ELBA 1AQCA 4KVGB 4YONA 2P8VA 2MDXA 1DDVA 4KAXB 1UNRA 2QKLA 1GG3A 1UNQA 1E5WA 1U2BA 3KZ1A 2DKPA 5JHGA 4NY0A 1MAIA 3ODWA 1QC6A 2QKMA 2GS0A 5KCVA 4HAXB 4XWXA 1WGQA 2Z0OA 1WVHA 1XX0A 3OANA 2YVCA 5KQ1A 5J3YA 2DFKA 2DKQA 2RNRB 2HE7A 2CRFA 1KZ7A 1EF1A 2D9ZA 1MPHA 3HK0A 2K2UA 1FHXA 3D8DA 1OY2A 1GC7A 4GZUA 2RUKB 2ZPYA 3CXBB 1LW3A 4DX8A 4HAVB 1ISNA 5D3YA 1X1FA 4C0AA 2Y7BA 1DYNA 2CAYA 4DX90 4WSFA 5D3XA 5DH9B 3PP2A 3N7CA 1RRPB 2J0JA 2DX5A 1W1HA 2YS5A 4HB4B 1X11A
chains in the Genus database with same CATH superfamily
4GMXB 3DXCA 1ZVRA 4GPTB 2D10A 3B77A 1K5DB 2RLOA 2YF0A 4WJ7A 1MK9B 1EGXA 4QJ3B 1P6SA 2EJ8A 2RRFA 2AL6A 2K2JA 2NMBA 2LULA 2E2XA 4KHOA 1BTNA 5FI0A 3O96A 2KIEA 4K17A 4P7IA 2KCJA 2UZRA 4L1RA 1XCGA 2KIGA 3DXEA 1UPRA 2FJUB 1Q67A 2R0DA 3BJIA 4ZRIA 1W1DA 2H7EA 3KSYA 1I2HA 4HAYB 2NZ8B 4H8SA 1FHOA 4B6HA 1V88A 1Y19B 5DIFB 2YRYA 2N0YA 3FSSA 4HB2B 4MK0A 2EMTA 1P3RA 4F7UP 4EMOA 4D6WA 1WI1A 2KR0A 1V5PA 1MK7B 2ADZA 2I1KA 1H10A 2GJYA 4HDOA 1W1GA 1J19A 1ZSQA 2R09A 4OT1A 5JHHA 5HE3A 3P7ZA 4HAZB 1P5TA 1V89A 2UVMA 3GYOA 2UZSA 3DCXA 1XR0B 3PZDA 4Y94A 2ROVA 3SUZA 4HDQA 2DHIA 1Y5OA 4CYEA 2OQBA 2HTHB 2LOZA 3FM8C 2X18A 5D3WA 1WJ1A 4GN1A 5DI9B 2P0HA 1EAZA 5L81A 1FHWA 5HE1A 4CHJA 4CSQA 1UEFA 4HAWB 4EJNA 3G9WA 3PSCA 3VIAA 4K2OA 2COFA 2GCJA 4DIXA 2M14A 4EKUA 1J0WA 1NTVA 4QXAB 2VKIA 3NW8A 3WA0A 3SV1A 4DBBA 1ZYIA 3KRWA 2KGXB 1LB1A 2LKOA 3ML4A 5JP4A 2V76A 3PVWA 2Z4DA 3NWFA 2L2IA 2D4QA 3T06A 2P0FA 1FB8A 1FGYA 2W2WA 1AWEA 2Z0QA 4GMVA 4QJ4B 3VOQA 4ZRKA 2DX1A 2OTXA 2VRWB 1TQZA 1XD4A 3NWDA 2DTCA 3F5RA 2XQNM 1OMWA 4Z2NA 2YT1A 5IRSA 5KQ4A 1SGHA 3ULCA 2CY4A 4GNKB 2YS3A 4TYZA 4A6HA 3TO1A 5C79A 1MKEA 1MIZB 4A6FB 2DN6A 2AEHA 4K2PA 2GUMA 2IYBA 4F7GA 1DDMA 1DBHA 3MDBC 5C6RA 4L6EA 2LG1A 2W2XD 1GC6A 3NWAA 1FAOA 2CODA 1PFJA 2Q13A 1EVHA 1OQNA 3UZTA 2PZ1A 3FVCA 3TVVA 1DROA 1U5GA 3SNHA 2Z14A 4PNKA 5HE0A 4QJ5B 1FOEA 2I1JA 5JLJB 3PVLA 5FI1A 1RJ2A 1UNPA 2BCJA 5J3QA 2MWNB 4A6FA 4HB0B 1H4RA 3PG7A 2MFQA 2G35A 3QIJA 4F7HA 1PLSA 4YL8A 5M4YB 5LONB 3ULBA 4A5KA 2MKRA 3F0WA 2LOXA 2K00A 3DXDA 2LYDA 1ZC4B 2COAA 3PVUA 4MT7A 4NSWA 1V5UA 2DYNA 4HSIA 3MPXA 1DDWA 3ODOA 1U29A 2ZKMX 2D9YA 2D9XA 4HATB 3SYXA 3WYFB 3A98B 5GOWB 3IVFA 5J3TA 4A6KA 1MIXA 2Z13A 1XODA 3QBVB 2EMSA 4Z2MB 4IAPA 4GXBA 3D8FA 1XKEA 5CLLB 4GOUA 2RGNB 4IOYX 1X05A 2ELAA 2JP2A 3AJ4A 2DHKA 1MI1A 4IFSA 1NTYA 1K5GB 2K49A 2D2QA 3M1IB 4DXAB 1KZGA 3TFMA 2VSZA 2YS1A 3U7DA 1NU2A 3ZVRA 1M7EA 5I2SA 1IRSA 1BWNA 3LJUX 5I2MA 3CIKA 2D9VA 5DHAB 2L1CA 3U8ZA 2R2YA 2D9WA 1WGUA 1BAKA 2DLWA 3V5WA 1SHCA 4PQ0A 4K81A 2Y8FA 1NI2A 3OHMB 5D27A 1BTKA 3AU4A 4MY6A 1WG7A 3BINA 4KHAA 2DYQA 3A8PA 5C5BB 1B55A 1TXDA 2I5CA 3KRXA 3GYPA 1U5EA 4TKNA 2FJLA 2J59M 2RVBB 3TW1A 2GCLA 2CY5A 1KI1B 2Z0PA 3HIEA 3HW2B 5LOPB 1X86A 4HB3B 3TCAA 2RSGA 5C16A 1M7RA 5D3VA 2Y8GA 2D11A 2W2XC 1X1GA 4D0NB 5HE2A 5CLQB 5LG4B 1V5MA 3PEGA 1I7AA 3X23A 2K8EA 5EFXA 1WJMA 2J0MA 2NBVA 3D8EA 5DHFB 1U27A 3AU5A 1U5DA 4HHVA 1PMSA 5C5BA 3HSAA 4CHMA 2J0KA 2P0DA 2Z59A 2ROZB 3QWMA 4BBKA 3RCPA 1T77A 1U5FA 1Z87A 1TJ6A 4KHBB 3NSUA 3KY9A 1QQGA 3SO6A 3FEHA 2M38A 3ZDTA 3ODXA 1ZC3B 2H7DA 2KUPA 3U12A 2DHJA 3A8QA 1ZM0A 2I5FA 2COCA 2DA0A 1UPQA 3P6AA 2KUQA 3HQCA 2YSZA 4WVFB 1V61A 2EC1A 1N3HA 1FGZA 2YT0A 2N23A 2IFSA 4HAUB 4ZRJA 2ELBA 1AQCA 4KVGB 4YONA 4OSNA 2P8VA 2MDXA 1DDVA 4KAXB 1UNRA 2QKLA 1GG3A 1UNQA 1E5WA 1U2BA 3KZ1A 2DKPA 5JHGA 4NY0A 1MAIA 3ODWA 1QC6A 4KHBA 2QKMA 2GS0A 5KCVA 4HAXB 4XWXA 1WGQA 2Z0OA 1WVHA 1XX0A 3OANA 2YVCA 5KQ1A 5J3YA 2DFKA 2DKQA 2RNRB 2HE7A 2CRFA 1KZ7A 1EF1A 2D9ZA 1MPHA 2YT2A 3HK0A 2K2UA 1FHXA 3D8DA 1OY2A 1GC7A 4GZUA 2RUKB 2ZPYA 3CXBB 1LW3A 4DX8A 4HAVB 1ISNA 5D3YA 1X1FA 4C0AA 2Y7BA 1DYNA 2CAYA 4DX90 4WSFA 5D3XA 5DH9B 3PP2A 3N7CA 1RRPB 2J0JA 2DX5A 1W1HA 2YS5A 3A58A 4HB4B 1X11A
chains in the Genus database with same CATH topology
4GMXB 3DXCA 1ZVRA 4GPTB 2D10A 1K5DB 2RLOA 2YF0A 4WJ7A 1MK9B 1EGXA 1P6SA 2EJ8A 2AL6A 2K2JA 2NMBA 2LULA 2E2XA 4KHOA 1BTNA 5FI0A 3O96A 4K17A 4P7IA 2KCJA 2UZRA 1XCGA 3DXEA 1UPRA 1Q67A 2R0DA 3BJIA 4ZRIA 1W1DA 2H7EA 3KSYA 1I2HA 4HAYB 2NZ8B 4H8SA 1FHOA 4B6HA 1V88A 1Y19B 5DIFB 2YRYA 2N0YA 3FSSA 4HB2B 4MK0A 2EMTA 1P3RA 4F7UP 4EMOA 1WI1A 1V5PA 1MK7B 2ADZA 2I1KA 1H10A 2GJYA 4HDOA 1W1GA 1J19A 1ZSQA 2R09A 5JHHA 5HE3A 3P7ZA 4HAZB 1P5TA 1V89A 2UVMA 3GYOA 2UZSA 1XR0B 3PZDA 4Y94A 2ROVA 3SUZA 4HDQA 2DHIA 1Y5OA 4CYEA 2OQBA 2HTHB 2LOZA 3FM8C 2X18A 5D3WA 1WJ1A 4GN1A 5DI9B 2P0HA 1EAZA 5L81A 1FHWA 5HE1A 4CHJA 1UEFA 4HAWB 4EJNA 3G9WA 3PSCA 3VIAA 4K2OA 2COFA 2GCJA 2M14A 4EKUA 1J0WA 1NTVA 2VKIA 3WA0A 3SV1A 4DBBA 3KRWA 2KGXB 1LB1A 2LKOA 3ML4A 5JP4A 2V76A 3PVWA 2L2IA 2D4QA 3T06A 2P0FA 1FB8A 1FGYA 2W2WA 1AWEA 2Z0QA 4GMVA 3VOQA 4ZRKA 2DX1A 2OTXA 2VRWB 1TQZA 1XD4A 2DTCA 3F5RA 2XQNM 1OMWA 4Z2NA 2YT1A 5KQ4A 1SGHA 3ULCA 2CY4A 2YS3A 4TYZA 4A6HA 3TO1A 5C79A 1MKEA 1MIZB 4A6FB 2DN6A 2AEHA 4K2PA 2IYBA 4F7GA 1DDMA 1DBHA 3MDBC 5C6RA 4L6EA 2LG1A 2W2XD 1GC6A 1FAOA 2CODA 1PFJA 2Q13A 1EVHA 1OQNA 3UZTA 2PZ1A 3TVVA 1DROA 1U5GA 3SNHA 4PNKA 5HE0A 1FOEA 2I1JA 5JLJB 3PVLA 5FI1A 1RJ2A 1UNPA 2BCJA 5J3QA 2MWNB 4A6FA 4HB0B 1H4RA 3PG7A 2MFQA 2G35A 3QIJA 4F7HA 1PLSA 4YL8A 5LONB 3ULBA 4A5KA 2MKRA 3F0WA 2LOXA 2K00A 3DXDA 2LYDA 1ZC4B 2COAA 3PVUA 4MT7A 4NSWA 1V5UA 2DYNA 3MPXA 1DDWA 3ODOA 1U29A 2D9YA 2D9XA 4HATB 3SYXA 3WYFB 3A98B 5GOWB 3IVFA 5J3TA 4A6KA 1MIXA 1XODA 3QBVB 2EMSA 4Z2MB 4IAPA 4GXBA 3D8FA 1XKEA 5CLLB 2RGNB 4IOYX 1X05A 2ELAA 2JP2A 3AJ4A 2DHKA 4IFSA 1NTYA 1K5GB 2D2QA 3M1IB 4DXAB 1KZGA 3TFMA 2VSZA 2YS1A 3U7DA 1NU2A 3ZVRA 1M7EA 1IRSA 1BWNA 3LJUX 3CIKA 2D9VA 5DHAB 2L1CA 3U8ZA 2D9WA 1WGUA 1BAKA 2DLWA 3V5WA 1SHCA 4PQ0A 4K81A 2Y8FA 1NI2A 5D27A 1BTKA 3AU4A 4MY6A 1WG7A 3BINA 4KHAA 2DYQA 3A8PA 5C5BB 1B55A 1TXDA 2I5CA 3KRXA 3GYPA 1U5EA 4TKNA 2FJLA 2J59M 2RVBB 3TW1A 2GCLA 2CY5A 1KI1B 2Z0PA 3HW2B 5LOPB 1X86A 4HB3B 3TCAA 2RSGA 5C16A 1M7RA 5D3VA 2Y8GA 2D11A 2W2XC 1X1GA 4D0NB 5HE2A 5CLQB 1V5MA 3PEGA 1I7AA 3X23A 5EFXA 1WJMA 2J0MA 3D8EA 5DHFB 1U27A 3AU5A 1U5DA 4HHVA 1PMSA 5C5BA 4CHMA 2J0KA 2P0DA 2ROZB 3QWMA 4BBKA 3RCPA 1U5FA 1Z87A 1TJ6A 4KHBB 3NSUA 3KY9A 1QQGA 3SO6A 3FEHA 2M38A 3ZDTA 3ODXA 1ZC3B 2H7DA 2KUPA 2DHJA 3A8QA 1ZM0A 2I5FA 2COCA 2DA0A 1UPQA 3P6AA 3HQCA 2YSZA 4WVFB 1V61A 2EC1A 1N3HA 1FGZA 2YT0A 2N23A 2IFSA 4HAUB 4ZRJA 2ELBA 1AQCA 4KVGB 4YONA 2P8VA 2MDXA 1DDVA 4KAXB 1UNRA 2QKLA 1GG3A 1UNQA 1E5WA 1U2BA 3KZ1A 2DKPA 5JHGA 4NY0A 1MAIA 3ODWA 1QC6A 2QKMA 2GS0A 5KCVA 4HAXB 4XWXA 1WGQA 2Z0OA 1WVHA 1XX0A 3OANA 2YVCA 5KQ1A 5J3YA 2DFKA 2DKQA 2RNRB 2HE7A 2CRFA 1KZ7A 1EF1A 2D9ZA 1MPHA 3HK0A 2K2UA 1FHXA 3D8DA 1OY2A 1GC7A 4GZUA 2RUKB 2ZPYA 3CXBB 1LW3A 4DX8A 4HAVB 1ISNA 5D3YA 1X1FA 4C0AA 2Y7BA 1DYNA 2CAYA 4DX90 4WSFA 5D3XA 5DH9B 3PP2A 3N7CA 1RRPB 2J0JA 2DX5A 1W1HA 2YS5A 4HB4B 1X11A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GMX B;  3DXC A;  1ZVR A;  4GPT B;  2D10 A;  1K5D B;  2RLO A;  2YF0 A;  4WJ7 A;  1MK9 B;  1EGX A;  1P6S A;  2EJ8 A;  2AL6 A;  2K2J A;  2NMB A;  2LUL A;  2E2X A;  4KHO A;  1BTN A;  5FI0 A;  3O96 A;  4K17 A;  4P7I A;  2KCJ A;  2UZR A;  1XCG A;  3DXE A;  1UPR A;  1Q67 A;  2R0D A;  3BJI A;  4ZRI A;  1W1D A;  2H7E A;  3KSY A;  1I2H A;  4HAY B;  2NZ8 B;  4H8S A;  1FHO A;  4B6H A;  1V88 A;  1Y19 B;  5DIF B;  2YRY A;  2N0Y A;  3FSS A;  4HB2 B;  4MK0 A;  2EMT A;  1P3R A;  4F7U P;  4EMO A;  1WI1 A;  1V5P A;  1MK7 B;  2ADZ A;  2I1K A;  1H10 A;  2GJY A;  4HDO A;  1W1G A;  1J19 A;  1ZSQ A;  2R09 A;  5JHH A;  5HE3 A;  3P7Z A;  4HAZ B;  1P5T A;  1V89 A;  2UVM A;  3GYO A;  2UZS A;  1XR0 B;  3PZD A;  4Y94 A;  2ROV A;  3SUZ A;  4HDQ A;  2DHI A;  1Y5O A;  4CYE A;  2OQB A;  2HTH B;  2LOZ A;  3FM8 C;  2X18 A;  5D3W A;  1WJ1 A;  4GN1 A;  5DI9 B;  2P0H A;  1EAZ A;  5L81 A;  1FHW A;  5HE1 A;  4CHJ A;  1UEF A;  4HAW B;  4EJN A;  3G9W A;  3PSC A;  3VIA A;  4K2O A;  2COF A;  2GCJ A;  2M14 A;  4EKU A;  1J0W A;  1NTV A;  2VKI A;  3WA0 A;  3SV1 A;  4DBB A;  3KRW A;  2KGX B;  1LB1 A;  2LKO A;  3ML4 A;  5JP4 A;  2V76 A;  3PVW A;  2L2I A;  2D4Q A;  3T06 A;  2P0F A;  1FB8 A;  1FGY A;  2W2W A;  1AWE A;  2Z0Q A;  4GMV A;  3VOQ A;  4ZRK A;  2DX1 A;  2OTX A;  2VRW B;  1TQZ A;  1XD4 A;  2DTC A;  3F5R A;  2XQN M;  1OMW A;  4Z2N A;  2YT1 A;  5KQ4 A;  1SGH A;  3ULC A;  2CY4 A;  2YS3 A;  4TYZ A;  4A6H A;  3TO1 A;  5C79 A;  1MKE A;  1MIZ B;  4A6F B;  2DN6 A;  2AEH A;  4K2P A;  2IYB A;  4F7G A;  1DDM A;  1DBH A;  3MDB C;  5C6R A;  4L6E A;  2LG1 A;  2W2X D;  1GC6 A;  1FAO A;  2COD A;  1PFJ A;  2Q13 A;  1EVH A;  1OQN A;  3UZT A;  2PZ1 A;  3TVV A;  1DRO A;  1U5G A;  3SNH A;  4PNK A;  5HE0 A;  1FOE A;  2I1J A;  5JLJ B;  3PVL A;  5FI1 A;  1RJ2 A;  1UNP A;  2BCJ A;  5J3Q A;  2MWN B;  4A6F A;  4HB0 B;  1H4R A;  3PG7 A;  2MFQ A;  2G35 A;  3QIJ A;  4F7H A;  1PLS A;  4YL8 A;  5LON B;  3ULB A;  4A5K A;  2MKR A;  3F0W A;  2LOX A;  2K00 A;  3DXD A;  2LYD A;  1ZC4 B;  2COA A;  3PVU A;  4MT7 A;  4NSW A;  1V5U A;  2DYN A;  3MPX A;  1DDW A;  3ODO A;  1U29 A;  2D9Y A;  2D9X A;  4HAT B;  3SYX A;  3WYF B;  3A98 B;  5GOW B;  3IVF A;  5J3T A;  4A6K A;  1MIX A;  1XOD A;  3QBV B;  2EMS A;  4Z2M B;  4IAP A;  4GXB A;  3D8F A;  1XKE A;  5CLL B;  2RGN B;  4IOY X;  1X05 A;  2ELA A;  2JP2 A;  3AJ4 A;  2DHK A;  4IFS A;  1NTY A;  1K5G B;  2D2Q A;  3M1I B;  4DXA B;  1KZG A;  3TFM A;  2VSZ A;  2YS1 A;  3U7D A;  1NU2 A;  3ZVR A;  1M7E A;  1IRS A;  1BWN A;  3LJU X;  3CIK A;  2D9V A;  5DHA B;  2L1C A;  3U8Z A;  2D9W A;  1WGU A;  1BAK A;  2DLW A;  3V5W A;  1SHC A;  4PQ0 A;  4K81 A;  2Y8F A;  1NI2 A;  5D27 A;  1BTK A;  3AU4 A;  4MY6 A;  1WG7 A;  3BIN A;  4KHA A;  2DYQ A;  3A8P A;  5C5B B;  1B55 A;  1TXD A;  2I5C A;  3KRX A;  3GYP A;  1U5E A;  4TKN A;  2FJL A;  2J59 M;  2RVB B;  3TW1 A;  2GCL A;  2CY5 A;  1KI1 B;  2Z0P A;  3HW2 B;  5LOP B;  1X86 A;  4HB3 B;  3TCA A;  2RSG A;  5C16 A;  1M7R A;  5D3V A;  2Y8G A;  2D11 A;  2W2X C;  1X1G A;  4D0N B;  5HE2 A;  5CLQ B;  1V5M A;  3PEG A;  1I7A A;  3X23 A;  5EFX A;  1WJM A;  2J0M A;  3D8E A;  5DHF B;  1U27 A;  3AU5 A;  1U5D A;  4HHV A;  1PMS A;  5C5B A;  4CHM A;  2J0K A;  2P0D A;  2ROZ B;  3QWM A;  4BBK A;  3RCP A;  1U5F A;  1Z87 A;  1TJ6 A;  4KHB B;  3NSU A;  3KY9 A;  1QQG A;  3SO6 A;  3FEH A;  2M38 A;  3ZDT A;  3ODX A;  1ZC3 B;  2H7D A;  2KUP A;  2DHJ A;  3A8Q A;  1ZM0 A;  2I5F A;  2COC A;  2DA0 A;  1UPQ A;  3P6A A;  3HQC A;  2YSZ A;  4WVF B;  1V61 A;  2EC1 A;  1N3H A;  1FGZ A;  2YT0 A;  2N23 A;  2IFS A;  4HAU B;  4ZRJ A;  2ELB A;  1AQC A;  4KVG B;  4YON A;  2P8V A;  2MDX A;  1DDV A;  4KAX B;  1UNR A;  2QKL A;  1GG3 A;  1UNQ A;  1E5W A;  1U2B A;  3KZ1 A;  2DKP A;  5JHG A;  4NY0 A;  1MAI A;  3ODW A;  1QC6 A;  2QKM A;  2GS0 A;  5KCV A;  4HAX B;  4XWX A;  1WGQ A;  2Z0O A;  1WVH A;  1XX0 A;  3OAN A;  2YVC A;  5KQ1 A;  5J3Y A;  2DFK A;  2DKQ A;  2RNR B;  2HE7 A;  2CRF A;  1KZ7 A;  1EF1 A;  2D9Z A;  1MPH A;  3HK0 A;  2K2U A;  1FHX A;  3D8D A;  1OY2 A;  1GC7 A;  4GZU A;  2RUK B;  2ZPY A;  3CXB B;  1LW3 A;  4DX8 A;  4HAV B;  1ISN A;  5D3Y A;  1X1F A;  4C0A A;  2Y7B A;  1DYN A;  2CAY A;  4DX9 0;  4WSF A;  5D3X A;  5DH9 B;  3PP2 A;  3N7C A;  1RRP B;  2J0J A;  2DX5 A;  1W1H A;  2YS5 A;  4HB4 B;  1X11 A; 
#chains in the Genus database with same CATH topology
 4GMX B;  3DXC A;  1ZVR A;  4GPT B;  2D10 A;  3B77 A;  1K5D B;  2RLO A;  2YF0 A;  4WJ7 A;  1MK9 B;  1EGX A;  4QJ3 B;  1P6S A;  2EJ8 A;  2RRF A;  2AL6 A;  2K2J A;  2NMB A;  2LUL A;  2E2X A;  4KHO A;  1BTN A;  5FI0 A;  3O96 A;  2KIE A;  4K17 A;  4P7I A;  2KCJ A;  2UZR A;  4L1R A;  1XCG A;  2KIG A;  3DXE A;  1UPR A;  2FJU B;  1Q67 A;  2R0D A;  3BJI A;  4ZRI A;  1W1D A;  2H7E A;  3KSY A;  1I2H A;  4HAY B;  2NZ8 B;  4H8S A;  1FHO A;  4B6H A;  1V88 A;  1Y19 B;  5DIF B;  2YRY A;  2N0Y A;  3FSS A;  4HB2 B;  4MK0 A;  2EMT A;  1P3R A;  4F7U P;  4EMO A;  4D6W A;  1WI1 A;  2KR0 A;  1V5P A;  1MK7 B;  2ADZ A;  2I1K A;  1H10 A;  2GJY A;  4HDO A;  1W1G A;  1J19 A;  1ZSQ A;  2R09 A;  4OT1 A;  5JHH A;  5HE3 A;  3P7Z A;  4HAZ B;  1P5T A;  1V89 A;  2UVM A;  3GYO A;  2UZS A;  3DCX A;  1XR0 B;  3PZD A;  4Y94 A;  2ROV A;  3SUZ A;  4HDQ A;  2DHI A;  1Y5O A;  4CYE A;  2OQB A;  2HTH B;  2LOZ A;  3FM8 C;  2X18 A;  5D3W A;  1WJ1 A;  4GN1 A;  5DI9 B;  2P0H A;  1EAZ A;  5L81 A;  1FHW A;  5HE1 A;  4CHJ A;  4CSQ A;  1UEF A;  4HAW B;  4EJN A;  3G9W A;  3PSC A;  3VIA A;  4K2O A;  2COF A;  2GCJ A;  4DIX A;  2M14 A;  4EKU A;  1J0W A;  1NTV A;  4QXA B;  2VKI A;  3NW8 A;  3WA0 A;  3SV1 A;  4DBB A;  1ZYI A;  3KRW A;  2KGX B;  1LB1 A;  2LKO A;  3ML4 A;  5JP4 A;  2V76 A;  3PVW A;  2Z4D A;  3NWF A;  2L2I A;  2D4Q A;  3T06 A;  2P0F A;  1FB8 A;  1FGY A;  2W2W A;  1AWE A;  2Z0Q A;  4GMV A;  4QJ4 B;  3VOQ A;  4ZRK A;  2DX1 A;  2OTX A;  2VRW B;  1TQZ A;  1XD4 A;  3NWD A;  2DTC A;  3F5R A;  2XQN M;  1OMW A;  4Z2N A;  2YT1 A;  5IRS A;  5KQ4 A;  1SGH A;  3ULC A;  2CY4 A;  4GNK B;  2YS3 A;  4TYZ A;  4A6H A;  3TO1 A;  5C79 A;  1MKE A;  1MIZ B;  4A6F B;  2DN6 A;  2AEH A;  4K2P A;  2GUM A;  2IYB A;  4F7G A;  1DDM A;  1DBH A;  3MDB C;  5C6R A;  4L6E A;  2LG1 A;  2W2X D;  1GC6 A;  3NWA A;  1FAO A;  2COD A;  1PFJ A;  2Q13 A;  1EVH A;  1OQN A;  3UZT A;  2PZ1 A;  3FVC A;  3TVV A;  1DRO A;  1U5G A;  3SNH A;  2Z14 A;  4PNK A;  5HE0 A;  4QJ5 B;  1FOE A;  2I1J A;  5JLJ B;  3PVL A;  5FI1 A;  1RJ2 A;  1UNP A;  2BCJ A;  5J3Q A;  2MWN B;  4A6F A;  4HB0 B;  1H4R A;  3PG7 A;  2MFQ A;  2G35 A;  3QIJ A;  4F7H A;  1PLS A;  4YL8 A;  5M4Y B;  5LON B;  3ULB A;  4A5K A;  2MKR A;  3F0W A;  2LOX A;  2K00 A;  3DXD A;  2LYD A;  1ZC4 B;  2COA A;  3PVU A;  4MT7 A;  4NSW A;  1V5U A;  2DYN A;  4HSI A;  3MPX A;  1DDW A;  3ODO A;  1U29 A;  2ZKM X;  2D9Y A;  2D9X A;  4HAT B;  3SYX A;  3WYF B;  3A98 B;  5GOW B;  3IVF A;  5J3T A;  4A6K A;  1MIX A;  2Z13 A;  1XOD A;  3QBV B;  2EMS A;  4Z2M B;  4IAP A;  4GXB A;  3D8F A;  1XKE A;  5CLL B;  4GOU A;  2RGN B;  4IOY X;  1X05 A;  2ELA A;  2JP2 A;  3AJ4 A;  2DHK A;  1MI1 A;  4IFS A;  1NTY A;  1K5G B;  2K49 A;  2D2Q A;  3M1I B;  4DXA B;  1KZG A;  3TFM A;  2VSZ A;  2YS1 A;  3U7D A;  1NU2 A;  3ZVR A;  1M7E A;  5I2S A;  1IRS A;  1BWN A;  3LJU X;  5I2M A;  3CIK A;  2D9V A;  5DHA B;  2L1C A;  3U8Z A;  2R2Y A;  2D9W A;  1WGU A;  1BAK A;  2DLW A;  3V5W A;  1SHC A;  4PQ0 A;  4K81 A;  2Y8F A;  1NI2 A;  3OHM B;  5D27 A;  1BTK A;  3AU4 A;  4MY6 A;  1WG7 A;  3BIN A;  4KHA A;  2DYQ A;  3A8P A;  5C5B B;  1B55 A;  1TXD A;  2I5C A;  3KRX A;  3GYP A;  1U5E A;  4TKN A;  2FJL A;  2J59 M;  2RVB B;  3TW1 A;  2GCL A;  2CY5 A;  1KI1 B;  2Z0P A;  3HIE A;  3HW2 B;  5LOP B;  1X86 A;  4HB3 B;  3TCA A;  2RSG A;  5C16 A;  1M7R A;  5D3V A;  2Y8G A;  2D11 A;  2W2X C;  1X1G A;  4D0N B;  5HE2 A;  5CLQ B;  5LG4 B;  1V5M A;  3PEG A;  1I7A A;  3X23 A;  2K8E A;  5EFX A;  1WJM A;  2J0M A;  2NBV A;  3D8E A;  5DHF B;  1U27 A;  3AU5 A;  1U5D A;  4HHV A;  1PMS A;  5C5B A;  3HSA A;  4CHM A;  2J0K A;  2P0D A;  2Z59 A;  2ROZ B;  3QWM A;  4BBK A;  3RCP A;  1T77 A;  1U5F A;  1Z87 A;  1TJ6 A;  4KHB B;  3NSU A;  3KY9 A;  1QQG A;  3SO6 A;  3FEH A;  2M38 A;  3ZDT A;  3ODX A;  1ZC3 B;  2H7D A;  2KUP A;  3U12 A;  2DHJ A;  3A8Q A;  1ZM0 A;  2I5F A;  2COC A;  2DA0 A;  1UPQ A;  3P6A A;  2KUQ A;  3HQC A;  2YSZ A;  4WVF B;  1V61 A;  2EC1 A;  1N3H A;  1FGZ A;  2YT0 A;  2N23 A;  2IFS A;  4HAU B;  4ZRJ A;  2ELB A;  1AQC A;  4KVG B;  4YON A;  4OSN A;  2P8V A;  2MDX A;  1DDV A;  4KAX B;  1UNR A;  2QKL A;  1GG3 A;  1UNQ A;  1E5W A;  1U2B A;  3KZ1 A;  2DKP A;  5JHG A;  4NY0 A;  1MAI A;  3ODW A;  1QC6 A;  4KHB A;  2QKM A;  2GS0 A;  5KCV A;  4HAX B;  4XWX A;  1WGQ A;  2Z0O A;  1WVH A;  1XX0 A;  3OAN A;  2YVC A;  5KQ1 A;  5J3Y A;  2DFK A;  2DKQ A;  2RNR B;  2HE7 A;  2CRF A;  1KZ7 A;  1EF1 A;  2D9Z A;  1MPH A;  2YT2 A;  3HK0 A;  2K2U A;  1FHX A;  3D8D A;  1OY2 A;  1GC7 A;  4GZU A;  2RUK B;  2ZPY A;  3CXB B;  1LW3 A;  4DX8 A;  4HAV B;  1ISN A;  5D3Y A;  1X1F A;  4C0A A;  2Y7B A;  1DYN A;  2CAY A;  4DX9 0;  4WSF A;  5D3X A;  5DH9 B;  3PP2 A;  3N7C A;  1RRP B;  2J0J A;  2DX5 A;  1W1H A;  2YS5 A;  3A58 A;  4HB4 B;  1X11 A; 
#chains in the Genus database with same CATH homology
 4GMX B;  3DXC A;  1ZVR A;  4GPT B;  2D10 A;  1K5D B;  2RLO A;  2YF0 A;  4WJ7 A;  1MK9 B;  1EGX A;  1P6S A;  2EJ8 A;  2AL6 A;  2K2J A;  2NMB A;  2LUL A;  2E2X A;  4KHO A;  1BTN A;  5FI0 A;  3O96 A;  4K17 A;  4P7I A;  2KCJ A;  2UZR A;  1XCG A;  3DXE A;  1UPR A;  1Q67 A;  2R0D A;  3BJI A;  4ZRI A;  1W1D A;  2H7E A;  3KSY A;  1I2H A;  4HAY B;  2NZ8 B;  4H8S A;  1FHO A;  4B6H A;  1V88 A;  1Y19 B;  5DIF B;  2YRY A;  2N0Y A;  3FSS A;  4HB2 B;  4MK0 A;  2EMT A;  1P3R A;  4F7U P;  4EMO A;  1WI1 A;  1V5P A;  1MK7 B;  2ADZ A;  2I1K A;  1H10 A;  2GJY A;  4HDO A;  1W1G A;  1J19 A;  1ZSQ A;  2R09 A;  5JHH A;  5HE3 A;  3P7Z A;  4HAZ B;  1P5T A;  1V89 A;  2UVM A;  3GYO A;  2UZS A;  1XR0 B;  3PZD A;  4Y94 A;  2ROV A;  3SUZ A;  4HDQ A;  2DHI A;  1Y5O A;  4CYE A;  2OQB A;  2HTH B;  2LOZ A;  3FM8 C;  2X18 A;  5D3W A;  1WJ1 A;  4GN1 A;  5DI9 B;  2P0H A;  1EAZ A;  5L81 A;  1FHW A;  5HE1 A;  4CHJ A;  1UEF A;  4HAW B;  4EJN A;  3G9W A;  3PSC A;  3VIA A;  4K2O A;  2COF A;  2GCJ A;  2M14 A;  4EKU A;  1J0W A;  1NTV A;  2VKI A;  3WA0 A;  3SV1 A;  4DBB A;  3KRW A;  2KGX B;  1LB1 A;  2LKO A;  3ML4 A;  5JP4 A;  2V76 A;  3PVW A;  2L2I A;  2D4Q A;  3T06 A;  2P0F A;  1FB8 A;  1FGY A;  2W2W A;  1AWE A;  2Z0Q A;  4GMV A;  3VOQ A;  4ZRK A;  2DX1 A;  2OTX A;  2VRW B;  1TQZ A;  1XD4 A;  2DTC A;  3F5R A;  2XQN M;  1OMW A;  4Z2N A;  2YT1 A;  5KQ4 A;  1SGH A;  3ULC A;  2CY4 A;  2YS3 A;  4TYZ A;  4A6H A;  3TO1 A;  5C79 A;  1MKE A;  1MIZ B;  4A6F B;  2DN6 A;  2AEH A;  4K2P A;  2IYB A;  4F7G A;  1DDM A;  1DBH A;  3MDB C;  5C6R A;  4L6E A;  2LG1 A;  2W2X D;  1GC6 A;  1FAO A;  2COD A;  1PFJ A;  2Q13 A;  1EVH A;  1OQN A;  3UZT A;  2PZ1 A;  3TVV A;  1DRO A;  1U5G A;  3SNH A;  4PNK A;  5HE0 A;  1FOE A;  2I1J A;  5JLJ B;  3PVL A;  5FI1 A;  1RJ2 A;  1UNP A;  2BCJ A;  5J3Q A;  2MWN B;  4A6F A;  4HB0 B;  1H4R A;  3PG7 A;  2MFQ A;  2G35 A;  3QIJ A;  4F7H A;  1PLS A;  4YL8 A;  5LON B;  3ULB A;  4A5K A;  2MKR A;  3F0W A;  2LOX A;  2K00 A;  3DXD A;  2LYD A;  1ZC4 B;  2COA A;  3PVU A;  4MT7 A;  4NSW A;  1V5U A;  2DYN A;  3MPX A;  1DDW A;  3ODO A;  1U29 A;  2D9Y A;  2D9X A;  4HAT B;  3SYX A;  3WYF B;  3A98 B;  5GOW B;  3IVF A;  5J3T A;  4A6K A;  1MIX A;  1XOD A;  3QBV B;  2EMS A;  4Z2M B;  4IAP A;  4GXB A;  3D8F A;  1XKE A;  5CLL B;  2RGN B;  4IOY X;  1X05 A;  2ELA A;  2JP2 A;  3AJ4 A;  2DHK A;  4IFS A;  1NTY A;  1K5G B;  2D2Q A;  3M1I B;  4DXA B;  1KZG A;  3TFM A;  2VSZ A;  2YS1 A;  3U7D A;  1NU2 A;  3ZVR A;  1M7E A;  1IRS A;  1BWN A;  3LJU X;  3CIK A;  2D9V A;  5DHA B;  2L1C A;  3U8Z A;  2D9W A;  1WGU A;  1BAK A;  2DLW A;  3V5W A;  1SHC A;  4PQ0 A;  4K81 A;  2Y8F A;  1NI2 A;  5D27 A;  1BTK A;  3AU4 A;  4MY6 A;  1WG7 A;  3BIN A;  4KHA A;  2DYQ A;  3A8P A;  5C5B B;  1B55 A;  1TXD A;  2I5C A;  3KRX A;  3GYP A;  1U5E A;  4TKN A;  2FJL A;  2J59 M;  2RVB B;  3TW1 A;  2GCL A;  2CY5 A;  1KI1 B;  2Z0P A;  3HW2 B;  5LOP B;  1X86 A;  4HB3 B;  3TCA A;  2RSG A;  5C16 A;  1M7R A;  5D3V A;  2Y8G A;  2D11 A;  2W2X C;  1X1G A;  4D0N B;  5HE2 A;  5CLQ B;  1V5M A;  3PEG A;  1I7A A;  3X23 A;  5EFX A;  1WJM A;  2J0M A;  3D8E A;  5DHF B;  1U27 A;  3AU5 A;  1U5D A;  4HHV A;  1PMS A;  5C5B A;  4CHM A;  2J0K A;  2P0D A;  2ROZ B;  3QWM A;  4BBK A;  3RCP A;  1U5F A;  1Z87 A;  1TJ6 A;  4KHB B;  3NSU A;  3KY9 A;  1QQG A;  3SO6 A;  3FEH A;  2M38 A;  3ZDT A;  3ODX A;  1ZC3 B;  2H7D A;  2KUP A;  2DHJ A;  3A8Q A;  1ZM0 A;  2I5F A;  2COC A;  2DA0 A;  1UPQ A;  3P6A A;  3HQC A;  2YSZ A;  4WVF B;  1V61 A;  2EC1 A;  1N3H A;  1FGZ A;  2YT0 A;  2N23 A;  2IFS A;  4HAU B;  4ZRJ A;  2ELB A;  1AQC A;  4KVG B;  4YON A;  2P8V A;  2MDX A;  1DDV A;  4KAX B;  1UNR A;  2QKL A;  1GG3 A;  1UNQ A;  1E5W A;  1U2B A;  3KZ1 A;  2DKP A;  5JHG A;  4NY0 A;  1MAI A;  3ODW A;  1QC6 A;  2QKM A;  2GS0 A;  5KCV A;  4HAX B;  4XWX A;  1WGQ A;  2Z0O A;  1WVH A;  1XX0 A;  3OAN A;  2YVC A;  5KQ1 A;  5J3Y A;  2DFK A;  2DKQ A;  2RNR B;  2HE7 A;  2CRF A;  1KZ7 A;  1EF1 A;  2D9Z A;  1MPH A;  3HK0 A;  2K2U A;  1FHX A;  3D8D A;  1OY2 A;  1GC7 A;  4GZU A;  2RUK B;  2ZPY A;  3CXB B;  1LW3 A;  4DX8 A;  4HAV B;  1ISN A;  5D3Y A;  1X1F A;  4C0A A;  2Y7B A;  1DYN A;  2CAY A;  4DX9 0;  4WSF A;  5D3X A;  5DH9 B;  3PP2 A;  3N7C A;  1RRP B;  2J0J A;  2DX5 A;  1W1H A;  2YS5 A;  4HB4 B;  1X11 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...