1V88A

Solution structure of the pleckstrin homology domain of oxysterol-binding protein-related protein 8 (kiaa1451 protein)
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
130
structure length
130
Chain Sequence
b'GSSGSSGIVMADWLKIRGTLKSWTKLWCVLKPGVLLIYKTQKNGQWVGTVLLNACEIIERPSKKDGFCFKLFHPLEQSIWAVKGPKGEAVGSITQPLPSSYLIIRATSESDGRCWMDALELALKSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Oxysterol binding protein-related protein 8
publication title Solution Structure of the Pleckstrin Homology Domain of Oxysterol-Binding Protein-Related Protein 8 (KIAA1451 Protein)
rcsb
source organism Homo sapiens
molecule tags Lipid transport
total genus 16
structure length 130
sequence length 130
ec nomenclature
pdb deposition date 2003-12-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1v88A00
2UZSA 3F0WA 3HQCA 3OANA 1W1HA 1V5MA 1PFJA 2DYNA 1WJ1A 2P0FA 1OMWA 3DXDA 1OQNA 3PP2A 3QIJA 1J19A 4HAUB 4YONA 1QQGA 1TXDA 4WVFB 4NSWA 3PVUA 1MAIA 1I2HA 5C6RA 1PMSA 3KSYA 2DYQA 4HB4B 3BJIA 1SHCA 1GC6A 5HE2A 1RJ2A 4P7IA 1NTVA 1LB1A 4DX8A 3PVLA 2YVCA 2NZ8B 2N0YA 3WA0A 1MIXA 2Y7BA 2Y8GA 2HTHB 4GMVA 1EVHA 2VKIA 1U5EA 2PZ1A 5KQ1A 1X86A 4HAXB 2Q13A 2J0JA 1J0WA 2L2IA 1W1DA 2DTCA 1RRPB 2I1KA 2COFA 2YRYA 3CXBB 1SGHA 2D9XA 3GYOA 5DHAB 1ZVRA 2MKRA 2DX5A 4MK0A 4HAVB 2DFKA 4EMOA 2JP2A 2LOXA 1N3HA 3PSCA 2X18A 2MWNB 2COAA 1FAOA 3MDBC 2V76A 1MIZB 2OQBA 1V5PA 2QKLA 1UPRA 2CY4A 1V61A 5DH9B 1BAKA 1E5WA 3CIKA 2CODA 4CHMA 1AQCA 3WYFB 3P7ZA 2W2XC 3X23A 4CHJA 3GYPA 5GOWB 4XWXA 3RCPA 2ADZA 4IFSA 2KUPA 1FHXA 4B6HA 2XQNM 4HB2B 5EFXA 2CY5A 4HAZB 3DXEA 2ELAA 1Z87A 4KHOA 3F5RA 1BTKA 2I1JA 1MKEA 1DYNA 1MPHA 3PVWA 4KHBB 2DN6A 4WJ7A 5C79A 2D9ZA 4HAYB 2DX1A 4NY0A 4PNKA 2YT1A 1X05A 4MY6A 4GN1A 2N23A 3SNHA 2RUKB 4Z2NA 3SO6A 4GZUA 2E2XA 2KGXB 5LOPB 1K5GB 2YS5A 1ZC4B 5C16A 3D8DA 2UVMA 2VRWB 4A6FA 4F7GA 2LULA 1XX0A 2EC1A 3KY9A 5JLJB 2P0HA 3VIAA 5HE1A 1X1FA 1V5UA 2J0MA 2RVBB 1BWNA 4F7HA 4DBBA 1FGZA 4MT7A 1EAZA 1I7AA 1UNQA 2GCJA 2OTXA 5J3TA 1NU2A 1XD4A 2H7DA 2DA0A 4ZRKA 5HE0A 5C5BA 1U5GA 2GCLA 1X1GA 1KI1B 2YS1A 3KZ1A 1U29A 3ULCA 3P6AA 2GS0A 1H10A 2Y8FA 5JHHA 4BBKA 4K2PA 4A6HA 1NI2A 3A8QA 2COCA 4Z2MB 3G9WA 1MK9B 2DKQA 1MK7B 1H4RA 4D0NB 1UNRA 3D8FA 4A5KA 2DKPA 2P0DA 2K2UA 5JP4A 2RLOA 1KZ7A 1DDWA 1FHOA 3KRWA 1XR0B 1WG7A 3M1IB 1K5DB 2EJ8A 2DHJA 1DROA 3ZVRA 1EGXA 2Z0QA 4DX90 3N7CA 3QBVB 3QWMA 4CYEA 1BTNA 1WGUA 2EMSA 3MPXA 1AWEA 1DDVA 2Z0PA 3T06A 1WGQA 1Q67A 1PLSA 3UZTA 4HDOA 1XODA 4HATB 2IFSA 3AU5A 2K2JA 5KCVA 3TW1A 4KAXB 5CLQB 3ODXA 3U7DA 2FJLA 2YSZA 4K2OA 4GMXB 5L81A 2H7EA 1ISNA 5FI0A 2EMTA 3KRXA 2Z0OA 2GJYA 3V5WA 1U5DA 4HHVA 1UNPA 5D3WA 3ZDTA 2ROVA 1Y5OA 4L6EA 4TYZA 1ZSQA 2R0DA 3TVVA 2D4QA 2D9VA 1FGYA 3LJUX 4HB0B 4F7UP 3NSUA 3DXCA 1P5TA 3HW2B 3O96A 1UEFA 3TFMA 3TO1A 1KZGA 2YT0A 1UPQA 5DIFB 4GPTB 4HDQA 2AEHA 2I5CA 1Y19B 2J59M 3ML4A 5LONB 1TJ6A 3PEGA 1M7RA 2YF0A 3FSSA 1EF1A 4IAPA 3IVFA 2DHIA 1TQZA 4IOYX 1DBHA 2YS3A 3TCAA 4EJNA 4A6KA 4PQ0A 2G35A 1IRSA 5DI9B 2M14A 2P8VA 5D3YA 3SUZA 2KCJA 2W2WA 1P6SA 3D8EA 2W2XD 1U5FA 2D9YA 4ZRIA 4ZRJA 1DDMA 1M7EA 4GXBA 5D3XA 1GG3A 5CLLB 3SYXA 1NTYA 1QC6A 3VOQA 1WVHA 3FEHA 4WSFA 1U27A 1LW3A 4KVGB 3SV1A 3BINA 2K00A 1U2BA 3PZDA 5D27A 2L1CA 2D10A 3A98B 1FHWA 2LYDA 1ZM0A 1B55A 1ZC3B 2IYBA 4KHAA 4Y94A 3FM8C 2LKOA 2UZRA 3U8ZA 2MFQA 2DHKA 3PG7A 4EKUA 2I5FA 3AJ4A 4C0AA 1P3RA 2DLWA 2AL6A 2RSGA 4A6FB 2VSZA 1XCGA 1X11A 1WJMA 2LG1A 5DHFB 2CAYA 4HB3B 5J3QA 3HK0A 4YL8A 2HE7A 2R09A 5KQ4A 5JHGA 3ODWA 5C5BB 2BCJA 1FOEA 2QKMA 1W1GA 3A8PA 2RGNB 1V89A 2M38A 2NMBA 2ZPYA 3ODOA 4H8SA 2D9WA 4K17A 1GC7A 1WI1A 1FB8A 1OY2A 5D3VA 4DXAB 2ELBA 4HAWB 5J3YA 1V88A 2LOZA 3AU4A 2CRFA 2J0KA 2MDXA 5FI1A 4K81A 2D2QA 1XKEA 3ULBA 2D11A 2ROZB 4TKNA 2RNRB 5HE3A
chains in the Genus database with same CATH superfamily
5LG4B 2UZSA 3F0WA 3HQCA 3OANA 1W1HA 1V5MA 1PFJA 2DYNA 3U12A 1WJ1A 2P0FA 1OMWA 3DXDA 1OQNA 3PP2A 3QIJA 1J19A 4HAUB 4YONA 1QQGA 1TXDA 4WVFB 4NSWA 3PVUA 4GOUA 1MAIA 1I2HA 5C6RA 1PMSA 3KSYA 2DYQA 4HB4B 3BJIA 1SHCA 3NWDA 1GC6A 5I2SA 5HE2A 1RJ2A 4P7IA 1NTVA 1LB1A 4DX8A 3PVLA 2YVCA 2NZ8B 2Z14A 2N0YA 3WA0A 1MIXA 2Y7BA 2Y8GA 2HTHB 4GMVA 1EVHA 2VKIA 1U5EA 2PZ1A 1MI1A 5KQ1A 1X86A 4HAXB 2Q13A 2J0JA 1J0WA 2L2IA 1W1DA 2DTCA 1RRPB 2I1KA 2COFA 2YRYA 3CXBB 1SGHA 2D9XA 3GYOA 5DHAB 1ZVRA 2MKRA 2DX5A 4MK0A 4OT1A 3NWAA 4HAVB 2FJUB 2DFKA 4EMOA 2JP2A 2LOXA 1N3HA 3PSCA 2X18A 2MWNB 2COAA 1FAOA 3MDBC 2V76A 1MIZB 2OQBA 1V5PA 2QKLA 1UPRA 2CY4A 1V61A 5DH9B 1BAKA 3HSAA 1E5WA 3CIKA 2CODA 4CHMA 1AQCA 3WYFB 3P7ZA 2W2XC 3X23A 4CHJA 3GYPA 5GOWB 4XWXA 3RCPA 2ADZA 4IFSA 2KUPA 1FHXA 4B6HA 2XQNM 4HB2B 5EFXA 2CY5A 4HAZB 3DXEA 2ELAA 1Z87A 4KHOA 3F5RA 1BTKA 2I1JA 1MKEA 1DYNA 1MPHA 3PVWA 4QJ3B 4KHBB 2DN6A 4WJ7A 5C79A 2D9ZA 2RRFA 4HAYB 2DX1A 4NY0A 4PNKA 2YT1A 1X05A 4MY6A 4GN1A 2N23A 3SNHA 2RUKB 4Z2NA 3SO6A 4GZUA 2E2XA 2KGXB 5LOPB 1K5GB 2YS5A 1ZC4B 5C16A 3D8DA 4QXAB 2UVMA 2VRWB 4A6FA 4F7GA 2LULA 4L1RA 1XX0A 2EC1A 2KR0A 3KY9A 5JLJB 2P0HA 3VIAA 3FVCA 1X1FA 5HE1A 1V5UA 2J0MA 2RVBB 1BWNA 4F7HA 4DBBA 1FGZA 4MT7A 1EAZA 1I7AA 1UNQA 2GCJA 2OTXA 5J3TA 1NU2A 1XD4A 2H7DA 2DA0A 4ZRKA 5HE0A 5C5BA 1U5GA 2GCLA 1X1GA 4DIXA 1KI1B 2YS1A 3KZ1A 1U29A 3ULCA 3P6AA 2GS0A 1H10A 2Y8FA 5JHHA 4BBKA 3NW8A 4K2PA 4A6HA 1NI2A 3A8QA 2COCA 4Z2MB 3G9WA 1MK9B 2DKQA 1MK7B 1H4RA 4D0NB 1UNRA 2Z13A 3D8FA 4A5KA 2DKPA 2P0DA 2K2UA 4D6WA 5JP4A 5IRSA 2RLOA 1KZ7A 1DDWA 1FHOA 3KRWA 1XR0B 1WG7A 3M1IB 1K5DB 2EJ8A 2DHJA 1DROA 3ZVRA 1EGXA 2Z0QA 4DX90 3N7CA 3QBVB 3QWMA 4CYEA 1BTNA 1WGUA 2EMSA 3MPXA 1AWEA 1DDVA 2Z0PA 3T06A 1WGQA 1Q67A 1PLSA 3UZTA 4HDOA 1XODA 4HATB 2IFSA 3AU5A 2K2JA 5KCVA 3TW1A 4KAXB 5CLQB 3ODXA 3U7DA 2FJLA 2YSZA 4K2OA 4GMXB 5L81A 2H7EA 1ISNA 5FI0A 2EMTA 3KRXA 4GNKB 2Z0OA 2GJYA 3V5WA 1U5DA 4HHVA 1UNPA 2ZKMX 5D3WA 3ZDTA 2ROVA 1Y5OA 4L6EA 4TYZA 1ZSQA 2R0DA 3TVVA 2D4QA 2D9VA 1FGYA 3LJUX 4HB0B 4F7UP 3NSUA 5I2MA 3DXCA 1P5TA 3HW2B 3O96A 1UEFA 5M4YB 3TFMA 3TO1A 1KZGA 2YT0A 1UPQA 5DIFB 4GPTB 4HDQA 2AEHA 2I5CA 4CSQA 1Y19B 2J59M 3ML4A 5LONB 1TJ6A 3PEGA 1M7RA 2YF0A 3FSSA 1EF1A 4IAPA 3IVFA 2DHIA 1TQZA 3OHMB 2K49A 4IOYX 1DBHA 2YS3A 3TCAA 4EJNA 4A6KA 4PQ0A 2G35A 2KIEA 1IRSA 5DI9B 2M14A 2P8VA 5D3YA 2KUQA 3SUZA 2KCJA 2W2WA 2R2YA 1P6SA 3D8EA 2W2XD 1U5FA 2D9YA 4ZRIA 4ZRJA 1DDMA 4KHBA 1M7EA 1ZYIA 4GXBA 5D3XA 1GG3A 5CLLB 3SYXA 4OSNA 1NTYA 1QC6A 3VOQA 1WVHA 3FEHA 4WSFA 1U27A 1LW3A 4KVGB 3SV1A 3BINA 2K00A 1U2BA 3PZDA 5D27A 2L1CA 3DCXA 2D10A 3A98B 1FHWA 2LYDA 1ZM0A 1B55A 1ZC3B 2IYBA 4KHAA 2KIGA 4Y94A 3FM8C 2LKOA 2UZRA 3U8ZA 2MFQA 2DHKA 3PG7A 4EKUA 2I5FA 2NBVA 3AJ4A 4C0AA 1P3RA 2DLWA 2AL6A 2RSGA 4HSIA 4A6FB 2VSZA 2YT2A 1XCGA 3B77A 1X11A 1WJMA 2LG1A 5DHFB 2CAYA 4HB3B 5J3QA 3HK0A 4YL8A 2HE7A 2R09A 3A58A 5KQ4A 4QJ5B 5JHGA 3ODWA 5C5BB 2BCJA 1FOEA 2QKMA 1W1GA 3A8PA 2RGNB 1V89A 2M38A 2NMBA 2ZPYA 3ODOA 4H8SA 2D9WA 1T77A 4K17A 1GC7A 2GUMA 1WI1A 1FB8A 1OY2A 5D3VA 3NWFA 4DXAB 2ELBA 4HAWB 5J3YA 1V88A 2LOZA 2K8EA 3AU4A 2CRFA 2J0KA 2MDXA 3HIEA 5FI1A 4K81A 2D2QA 1XKEA 3ULBA 2D11A 2ROZB 4TKNA 2Z59A 2RNRB 4QJ4B 2Z4DA 5HE3A
chains in the Genus database with same CATH topology
2UZSA 3F0WA 3HQCA 3OANA 1W1HA 1V5MA 1PFJA 2DYNA 1WJ1A 2P0FA 1OMWA 3DXDA 1OQNA 3PP2A 3QIJA 1J19A 4HAUB 4YONA 1QQGA 1TXDA 4WVFB 4NSWA 3PVUA 1MAIA 1I2HA 5C6RA 1PMSA 3KSYA 2DYQA 4HB4B 3BJIA 1SHCA 1GC6A 5HE2A 1RJ2A 4P7IA 1NTVA 1LB1A 4DX8A 3PVLA 2YVCA 2NZ8B 2N0YA 3WA0A 1MIXA 2Y7BA 2Y8GA 2HTHB 4GMVA 1EVHA 2VKIA 1U5EA 2PZ1A 5KQ1A 1X86A 4HAXB 2Q13A 2J0JA 1J0WA 2L2IA 1W1DA 2DTCA 1RRPB 2I1KA 2COFA 2YRYA 3CXBB 1SGHA 2D9XA 3GYOA 5DHAB 1ZVRA 2MKRA 2DX5A 4MK0A 4HAVB 2DFKA 4EMOA 2JP2A 2LOXA 1N3HA 3PSCA 2X18A 2MWNB 2COAA 1FAOA 3MDBC 2V76A 1MIZB 2OQBA 1V5PA 2QKLA 1UPRA 2CY4A 1V61A 5DH9B 1BAKA 1E5WA 3CIKA 2CODA 4CHMA 1AQCA 3WYFB 3P7ZA 2W2XC 3X23A 4CHJA 3GYPA 5GOWB 4XWXA 3RCPA 2ADZA 4IFSA 2KUPA 1FHXA 4B6HA 2XQNM 4HB2B 5EFXA 2CY5A 4HAZB 3DXEA 2ELAA 1Z87A 4KHOA 3F5RA 1BTKA 2I1JA 1MKEA 1DYNA 1MPHA 3PVWA 4KHBB 2DN6A 4WJ7A 5C79A 2D9ZA 4HAYB 2DX1A 4NY0A 4PNKA 2YT1A 1X05A 4MY6A 4GN1A 2N23A 3SNHA 2RUKB 4Z2NA 3SO6A 4GZUA 2E2XA 2KGXB 5LOPB 1K5GB 2YS5A 1ZC4B 5C16A 3D8DA 2UVMA 2VRWB 4A6FA 4F7GA 2LULA 1XX0A 2EC1A 3KY9A 5JLJB 2P0HA 3VIAA 5HE1A 1X1FA 1V5UA 2J0MA 2RVBB 1BWNA 4F7HA 4DBBA 1FGZA 4MT7A 1EAZA 1I7AA 1UNQA 2GCJA 2OTXA 5J3TA 1NU2A 1XD4A 2H7DA 2DA0A 4ZRKA 5HE0A 5C5BA 1U5GA 2GCLA 1X1GA 1KI1B 2YS1A 3KZ1A 1U29A 3ULCA 3P6AA 2GS0A 1H10A 2Y8FA 5JHHA 4BBKA 4K2PA 4A6HA 1NI2A 3A8QA 2COCA 4Z2MB 3G9WA 1MK9B 2DKQA 1MK7B 1H4RA 4D0NB 1UNRA 3D8FA 4A5KA 2DKPA 2P0DA 2K2UA 5JP4A 2RLOA 1KZ7A 1DDWA 1FHOA 3KRWA 1XR0B 1WG7A 3M1IB 1K5DB 2EJ8A 2DHJA 1DROA 3ZVRA 1EGXA 2Z0QA 4DX90 3N7CA 3QBVB 3QWMA 4CYEA 1BTNA 1WGUA 2EMSA 3MPXA 1AWEA 1DDVA 2Z0PA 3T06A 1WGQA 1Q67A 1PLSA 3UZTA 4HDOA 1XODA 4HATB 2IFSA 3AU5A 2K2JA 5KCVA 3TW1A 4KAXB 5CLQB 3ODXA 3U7DA 2FJLA 2YSZA 4K2OA 4GMXB 5L81A 2H7EA 1ISNA 5FI0A 2EMTA 3KRXA 2Z0OA 2GJYA 3V5WA 1U5DA 4HHVA 1UNPA 5D3WA 3ZDTA 2ROVA 1Y5OA 4L6EA 4TYZA 1ZSQA 2R0DA 3TVVA 2D4QA 2D9VA 1FGYA 3LJUX 4HB0B 4F7UP 3NSUA 3DXCA 1P5TA 3HW2B 3O96A 1UEFA 3TFMA 3TO1A 1KZGA 2YT0A 1UPQA 5DIFB 4GPTB 4HDQA 2AEHA 2I5CA 1Y19B 2J59M 3ML4A 5LONB 1TJ6A 3PEGA 1M7RA 2YF0A 3FSSA 1EF1A 4IAPA 3IVFA 2DHIA 1TQZA 4IOYX 1DBHA 2YS3A 3TCAA 4EJNA 4A6KA 4PQ0A 2G35A 1IRSA 5DI9B 2M14A 2P8VA 5D3YA 3SUZA 2KCJA 2W2WA 1P6SA 3D8EA 2W2XD 1U5FA 2D9YA 4ZRIA 4ZRJA 1DDMA 1M7EA 4GXBA 5D3XA 1GG3A 5CLLB 3SYXA 1NTYA 1QC6A 3VOQA 1WVHA 3FEHA 4WSFA 1U27A 1LW3A 4KVGB 3SV1A 3BINA 2K00A 1U2BA 3PZDA 5D27A 2L1CA 2D10A 3A98B 1FHWA 2LYDA 1ZM0A 1B55A 1ZC3B 2IYBA 4KHAA 4Y94A 3FM8C 2LKOA 2UZRA 3U8ZA 2MFQA 2DHKA 3PG7A 4EKUA 2I5FA 3AJ4A 4C0AA 1P3RA 2DLWA 2AL6A 2RSGA 4A6FB 2VSZA 1XCGA 1X11A 1WJMA 2LG1A 5DHFB 2CAYA 4HB3B 5J3QA 3HK0A 4YL8A 2HE7A 2R09A 5KQ4A 5JHGA 3ODWA 5C5BB 2BCJA 1FOEA 2QKMA 1W1GA 3A8PA 2RGNB 1V89A 2M38A 2NMBA 2ZPYA 3ODOA 4H8SA 2D9WA 4K17A 1GC7A 1WI1A 1FB8A 1OY2A 5D3VA 4DXAB 2ELBA 4HAWB 5J3YA 1V88A 2LOZA 3AU4A 2CRFA 2J0KA 2MDXA 5FI1A 4K81A 2D2QA 1XKEA 3ULBA 2D11A 2ROZB 4TKNA 2RNRB 5HE3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UZS A;  3F0W A;  3HQC A;  3OAN A;  1W1H A;  1V5M A;  1PFJ A;  2DYN A;  1WJ1 A;  2P0F A;  1OMW A;  3DXD A;  1OQN A;  3PP2 A;  3QIJ A;  1J19 A;  4HAU B;  4YON A;  1QQG A;  1TXD A;  4WVF B;  4NSW A;  3PVU A;  1MAI A;  1I2H A;  5C6R A;  1PMS A;  3KSY A;  2DYQ A;  4HB4 B;  3BJI A;  1SHC A;  1GC6 A;  5HE2 A;  1RJ2 A;  4P7I A;  1NTV A;  1LB1 A;  4DX8 A;  3PVL A;  2YVC A;  2NZ8 B;  2N0Y A;  3WA0 A;  1MIX A;  2Y7B A;  2Y8G A;  2HTH B;  4GMV A;  1EVH A;  2VKI A;  1U5E A;  2PZ1 A;  5KQ1 A;  1X86 A;  4HAX B;  2Q13 A;  2J0J A;  1J0W A;  2L2I A;  1W1D A;  2DTC A;  1RRP B;  2I1K A;  2COF A;  2YRY A;  3CXB B;  1SGH A;  2D9X A;  3GYO A;  5DHA B;  1ZVR A;  2MKR A;  2DX5 A;  4MK0 A;  4HAV B;  2DFK A;  4EMO A;  2JP2 A;  2LOX A;  1N3H A;  3PSC A;  2X18 A;  2MWN B;  2COA A;  1FAO A;  3MDB C;  2V76 A;  1MIZ B;  2OQB A;  1V5P A;  2QKL A;  1UPR A;  2CY4 A;  1V61 A;  5DH9 B;  1BAK A;  1E5W A;  3CIK A;  2COD A;  4CHM A;  1AQC A;  3WYF B;  3P7Z A;  2W2X C;  3X23 A;  4CHJ A;  3GYP A;  5GOW B;  4XWX A;  3RCP A;  2ADZ A;  4IFS A;  2KUP A;  1FHX A;  4B6H A;  2XQN M;  4HB2 B;  5EFX A;  2CY5 A;  4HAZ B;  3DXE A;  2ELA A;  1Z87 A;  4KHO A;  3F5R A;  1BTK A;  2I1J A;  1MKE A;  1DYN A;  1MPH A;  3PVW A;  4KHB B;  2DN6 A;  4WJ7 A;  5C79 A;  2D9Z A;  4HAY B;  2DX1 A;  4NY0 A;  4PNK A;  2YT1 A;  1X05 A;  4MY6 A;  4GN1 A;  2N23 A;  3SNH A;  2RUK B;  4Z2N A;  3SO6 A;  4GZU A;  2E2X A;  2KGX B;  5LOP B;  1K5G B;  2YS5 A;  1ZC4 B;  5C16 A;  3D8D A;  2UVM A;  2VRW B;  4A6F A;  4F7G A;  2LUL A;  1XX0 A;  2EC1 A;  3KY9 A;  5JLJ B;  2P0H A;  3VIA A;  5HE1 A;  1X1F A;  1V5U A;  2J0M A;  2RVB B;  1BWN A;  4F7H A;  4DBB A;  1FGZ A;  4MT7 A;  1EAZ A;  1I7A A;  1UNQ A;  2GCJ A;  2OTX A;  5J3T A;  1NU2 A;  1XD4 A;  2H7D A;  2DA0 A;  4ZRK A;  5HE0 A;  5C5B A;  1U5G A;  2GCL A;  1X1G A;  1KI1 B;  2YS1 A;  3KZ1 A;  1U29 A;  3ULC A;  3P6A A;  2GS0 A;  1H10 A;  2Y8F A;  5JHH A;  4BBK A;  4K2P A;  4A6H A;  1NI2 A;  3A8Q A;  2COC A;  4Z2M B;  3G9W A;  1MK9 B;  2DKQ A;  1MK7 B;  1H4R A;  4D0N B;  1UNR A;  3D8F A;  4A5K A;  2DKP A;  2P0D A;  2K2U A;  5JP4 A;  2RLO A;  1KZ7 A;  1DDW A;  1FHO A;  3KRW A;  1XR0 B;  1WG7 A;  3M1I B;  1K5D B;  2EJ8 A;  2DHJ A;  1DRO A;  3ZVR A;  1EGX A;  2Z0Q A;  4DX9 0;  3N7C A;  3QBV B;  3QWM A;  4CYE A;  1BTN A;  1WGU A;  2EMS A;  3MPX A;  1AWE A;  1DDV A;  2Z0P A;  3T06 A;  1WGQ A;  1Q67 A;  1PLS A;  3UZT A;  4HDO A;  1XOD A;  4HAT B;  2IFS A;  3AU5 A;  2K2J A;  5KCV A;  3TW1 A;  4KAX B;  5CLQ B;  3ODX A;  3U7D A;  2FJL A;  2YSZ A;  4K2O A;  4GMX B;  5L81 A;  2H7E A;  1ISN A;  5FI0 A;  2EMT A;  3KRX A;  2Z0O A;  2GJY A;  3V5W A;  1U5D A;  4HHV A;  1UNP A;  5D3W A;  3ZDT A;  2ROV A;  1Y5O A;  4L6E A;  4TYZ A;  1ZSQ A;  2R0D A;  3TVV A;  2D4Q A;  2D9V A;  1FGY A;  3LJU X;  4HB0 B;  4F7U P;  3NSU A;  3DXC A;  1P5T A;  3HW2 B;  3O96 A;  1UEF A;  3TFM A;  3TO1 A;  1KZG A;  2YT0 A;  1UPQ A;  5DIF B;  4GPT B;  4HDQ A;  2AEH A;  2I5C A;  1Y19 B;  2J59 M;  3ML4 A;  5LON B;  1TJ6 A;  3PEG A;  1M7R A;  2YF0 A;  3FSS A;  1EF1 A;  4IAP A;  3IVF A;  2DHI A;  1TQZ A;  4IOY X;  1DBH A;  2YS3 A;  3TCA A;  4EJN A;  4A6K A;  4PQ0 A;  2G35 A;  1IRS A;  5DI9 B;  2M14 A;  2P8V A;  5D3Y A;  3SUZ A;  2KCJ A;  2W2W A;  1P6S A;  3D8E A;  2W2X D;  1U5F A;  2D9Y A;  4ZRI A;  4ZRJ A;  1DDM A;  1M7E A;  4GXB A;  5D3X A;  1GG3 A;  5CLL B;  3SYX A;  1NTY A;  1QC6 A;  3VOQ A;  1WVH A;  3FEH A;  4WSF A;  1U27 A;  1LW3 A;  4KVG B;  3SV1 A;  3BIN A;  2K00 A;  1U2B A;  3PZD A;  5D27 A;  2L1C A;  2D10 A;  3A98 B;  1FHW A;  2LYD A;  1ZM0 A;  1B55 A;  1ZC3 B;  2IYB A;  4KHA A;  4Y94 A;  3FM8 C;  2LKO A;  2UZR A;  3U8Z A;  2MFQ A;  2DHK A;  3PG7 A;  4EKU A;  2I5F A;  3AJ4 A;  4C0A A;  1P3R A;  2DLW A;  2AL6 A;  2RSG A;  4A6F B;  2VSZ A;  1XCG A;  1X11 A;  1WJM A;  2LG1 A;  5DHF B;  2CAY A;  4HB3 B;  5J3Q A;  3HK0 A;  4YL8 A;  2HE7 A;  2R09 A;  5KQ4 A;  5JHG A;  3ODW A;  5C5B B;  2BCJ A;  1FOE A;  2QKM A;  1W1G A;  3A8P A;  2RGN B;  1V89 A;  2M38 A;  2NMB A;  2ZPY A;  3ODO A;  4H8S A;  2D9W A;  4K17 A;  1GC7 A;  1WI1 A;  1FB8 A;  1OY2 A;  5D3V A;  4DXA B;  2ELB A;  4HAW B;  5J3Y A;  1V88 A;  2LOZ A;  3AU4 A;  2CRF A;  2J0K A;  2MDX A;  5FI1 A;  4K81 A;  2D2Q A;  1XKE A;  3ULB A;  2D11 A;  2ROZ B;  4TKN A;  2RNR B;  5HE3 A; 
#chains in the Genus database with same CATH topology
 5LG4 B;  2UZS A;  3F0W A;  3HQC A;  3OAN A;  1W1H A;  1V5M A;  1PFJ A;  2DYN A;  3U12 A;  1WJ1 A;  2P0F A;  1OMW A;  3DXD A;  1OQN A;  3PP2 A;  3QIJ A;  1J19 A;  4HAU B;  4YON A;  1QQG A;  1TXD A;  4WVF B;  4NSW A;  3PVU A;  4GOU A;  1MAI A;  1I2H A;  5C6R A;  1PMS A;  3KSY A;  2DYQ A;  4HB4 B;  3BJI A;  1SHC A;  3NWD A;  1GC6 A;  5I2S A;  5HE2 A;  1RJ2 A;  4P7I A;  1NTV A;  1LB1 A;  4DX8 A;  3PVL A;  2YVC A;  2NZ8 B;  2Z14 A;  2N0Y A;  3WA0 A;  1MIX A;  2Y7B A;  2Y8G A;  2HTH B;  4GMV A;  1EVH A;  2VKI A;  1U5E A;  2PZ1 A;  1MI1 A;  5KQ1 A;  1X86 A;  4HAX B;  2Q13 A;  2J0J A;  1J0W A;  2L2I A;  1W1D A;  2DTC A;  1RRP B;  2I1K A;  2COF A;  2YRY A;  3CXB B;  1SGH A;  2D9X A;  3GYO A;  5DHA B;  1ZVR A;  2MKR A;  2DX5 A;  4MK0 A;  4OT1 A;  3NWA A;  4HAV B;  2FJU B;  2DFK A;  4EMO A;  2JP2 A;  2LOX A;  1N3H A;  3PSC A;  2X18 A;  2MWN B;  2COA A;  1FAO A;  3MDB C;  2V76 A;  1MIZ B;  2OQB A;  1V5P A;  2QKL A;  1UPR A;  2CY4 A;  1V61 A;  5DH9 B;  1BAK A;  3HSA A;  1E5W A;  3CIK A;  2COD A;  4CHM A;  1AQC A;  3WYF B;  3P7Z A;  2W2X C;  3X23 A;  4CHJ A;  3GYP A;  5GOW B;  4XWX A;  3RCP A;  2ADZ A;  4IFS A;  2KUP A;  1FHX A;  4B6H A;  2XQN M;  4HB2 B;  5EFX A;  2CY5 A;  4HAZ B;  3DXE A;  2ELA A;  1Z87 A;  4KHO A;  3F5R A;  1BTK A;  2I1J A;  1MKE A;  1DYN A;  1MPH A;  3PVW A;  4QJ3 B;  4KHB B;  2DN6 A;  4WJ7 A;  5C79 A;  2D9Z A;  2RRF A;  4HAY B;  2DX1 A;  4NY0 A;  4PNK A;  2YT1 A;  1X05 A;  4MY6 A;  4GN1 A;  2N23 A;  3SNH A;  2RUK B;  4Z2N A;  3SO6 A;  4GZU A;  2E2X A;  2KGX B;  5LOP B;  1K5G B;  2YS5 A;  1ZC4 B;  5C16 A;  3D8D A;  4QXA B;  2UVM A;  2VRW B;  4A6F A;  4F7G A;  2LUL A;  4L1R A;  1XX0 A;  2EC1 A;  2KR0 A;  3KY9 A;  5JLJ B;  2P0H A;  3VIA A;  3FVC A;  1X1F A;  5HE1 A;  1V5U A;  2J0M A;  2RVB B;  1BWN A;  4F7H A;  4DBB A;  1FGZ A;  4MT7 A;  1EAZ A;  1I7A A;  1UNQ A;  2GCJ A;  2OTX A;  5J3T A;  1NU2 A;  1XD4 A;  2H7D A;  2DA0 A;  4ZRK A;  5HE0 A;  5C5B A;  1U5G A;  2GCL A;  1X1G A;  4DIX A;  1KI1 B;  2YS1 A;  3KZ1 A;  1U29 A;  3ULC A;  3P6A A;  2GS0 A;  1H10 A;  2Y8F A;  5JHH A;  4BBK A;  3NW8 A;  4K2P A;  4A6H A;  1NI2 A;  3A8Q A;  2COC A;  4Z2M B;  3G9W A;  1MK9 B;  2DKQ A;  1MK7 B;  1H4R A;  4D0N B;  1UNR A;  2Z13 A;  3D8F A;  4A5K A;  2DKP A;  2P0D A;  2K2U A;  4D6W A;  5JP4 A;  5IRS A;  2RLO A;  1KZ7 A;  1DDW A;  1FHO A;  3KRW A;  1XR0 B;  1WG7 A;  3M1I B;  1K5D B;  2EJ8 A;  2DHJ A;  1DRO A;  3ZVR A;  1EGX A;  2Z0Q A;  4DX9 0;  3N7C A;  3QBV B;  3QWM A;  4CYE A;  1BTN A;  1WGU A;  2EMS A;  3MPX A;  1AWE A;  1DDV A;  2Z0P A;  3T06 A;  1WGQ A;  1Q67 A;  1PLS A;  3UZT A;  4HDO A;  1XOD A;  4HAT B;  2IFS A;  3AU5 A;  2K2J A;  5KCV A;  3TW1 A;  4KAX B;  5CLQ B;  3ODX A;  3U7D A;  2FJL A;  2YSZ A;  4K2O A;  4GMX B;  5L81 A;  2H7E A;  1ISN A;  5FI0 A;  2EMT A;  3KRX A;  4GNK B;  2Z0O A;  2GJY A;  3V5W A;  1U5D A;  4HHV A;  1UNP A;  2ZKM X;  5D3W A;  3ZDT A;  2ROV A;  1Y5O A;  4L6E A;  4TYZ A;  1ZSQ A;  2R0D A;  3TVV A;  2D4Q A;  2D9V A;  1FGY A;  3LJU X;  4HB0 B;  4F7U P;  3NSU A;  5I2M A;  3DXC A;  1P5T A;  3HW2 B;  3O96 A;  1UEF A;  5M4Y B;  3TFM A;  3TO1 A;  1KZG A;  2YT0 A;  1UPQ A;  5DIF B;  4GPT B;  4HDQ A;  2AEH A;  2I5C A;  4CSQ A;  1Y19 B;  2J59 M;  3ML4 A;  5LON B;  1TJ6 A;  3PEG A;  1M7R A;  2YF0 A;  3FSS A;  1EF1 A;  4IAP A;  3IVF A;  2DHI A;  1TQZ A;  3OHM B;  2K49 A;  4IOY X;  1DBH A;  2YS3 A;  3TCA A;  4EJN A;  4A6K A;  4PQ0 A;  2G35 A;  2KIE A;  1IRS A;  5DI9 B;  2M14 A;  2P8V A;  5D3Y A;  2KUQ A;  3SUZ A;  2KCJ A;  2W2W A;  2R2Y A;  1P6S A;  3D8E A;  2W2X D;  1U5F A;  2D9Y A;  4ZRI A;  4ZRJ A;  1DDM A;  4KHB A;  1M7E A;  1ZYI A;  4GXB A;  5D3X A;  1GG3 A;  5CLL B;  3SYX A;  4OSN A;  1NTY A;  1QC6 A;  3VOQ A;  1WVH A;  3FEH A;  4WSF A;  1U27 A;  1LW3 A;  4KVG B;  3SV1 A;  3BIN A;  2K00 A;  1U2B A;  3PZD A;  5D27 A;  2L1C A;  3DCX A;  2D10 A;  3A98 B;  1FHW A;  2LYD A;  1ZM0 A;  1B55 A;  1ZC3 B;  2IYB A;  4KHA A;  2KIG A;  4Y94 A;  3FM8 C;  2LKO A;  2UZR A;  3U8Z A;  2MFQ A;  2DHK A;  3PG7 A;  4EKU A;  2I5F A;  2NBV A;  3AJ4 A;  4C0A A;  1P3R A;  2DLW A;  2AL6 A;  2RSG A;  4HSI A;  4A6F B;  2VSZ A;  2YT2 A;  1XCG A;  3B77 A;  1X11 A;  1WJM A;  2LG1 A;  5DHF B;  2CAY A;  4HB3 B;  5J3Q A;  3HK0 A;  4YL8 A;  2HE7 A;  2R09 A;  3A58 A;  5KQ4 A;  4QJ5 B;  5JHG A;  3ODW A;  5C5B B;  2BCJ A;  1FOE A;  2QKM A;  1W1G A;  3A8P A;  2RGN B;  1V89 A;  2M38 A;  2NMB A;  2ZPY A;  3ODO A;  4H8S A;  2D9W A;  1T77 A;  4K17 A;  1GC7 A;  2GUM A;  1WI1 A;  1FB8 A;  1OY2 A;  5D3V A;  3NWF A;  4DXA B;  2ELB A;  4HAW B;  5J3Y A;  1V88 A;  2LOZ A;  2K8E A;  3AU4 A;  2CRF A;  2J0K A;  2MDX A;  3HIE A;  5FI1 A;  4K81 A;  2D2Q A;  1XKE A;  3ULB A;  2D11 A;  2ROZ B;  4TKN A;  2Z59 A;  2RNR B;  4QJ4 B;  2Z4D A;  5HE3 A; 
#chains in the Genus database with same CATH homology
 2UZS A;  3F0W A;  3HQC A;  3OAN A;  1W1H A;  1V5M A;  1PFJ A;  2DYN A;  1WJ1 A;  2P0F A;  1OMW A;  3DXD A;  1OQN A;  3PP2 A;  3QIJ A;  1J19 A;  4HAU B;  4YON A;  1QQG A;  1TXD A;  4WVF B;  4NSW A;  3PVU A;  1MAI A;  1I2H A;  5C6R A;  1PMS A;  3KSY A;  2DYQ A;  4HB4 B;  3BJI A;  1SHC A;  1GC6 A;  5HE2 A;  1RJ2 A;  4P7I A;  1NTV A;  1LB1 A;  4DX8 A;  3PVL A;  2YVC A;  2NZ8 B;  2N0Y A;  3WA0 A;  1MIX A;  2Y7B A;  2Y8G A;  2HTH B;  4GMV A;  1EVH A;  2VKI A;  1U5E A;  2PZ1 A;  5KQ1 A;  1X86 A;  4HAX B;  2Q13 A;  2J0J A;  1J0W A;  2L2I A;  1W1D A;  2DTC A;  1RRP B;  2I1K A;  2COF A;  2YRY A;  3CXB B;  1SGH A;  2D9X A;  3GYO A;  5DHA B;  1ZVR A;  2MKR A;  2DX5 A;  4MK0 A;  4HAV B;  2DFK A;  4EMO A;  2JP2 A;  2LOX A;  1N3H A;  3PSC A;  2X18 A;  2MWN B;  2COA A;  1FAO A;  3MDB C;  2V76 A;  1MIZ B;  2OQB A;  1V5P A;  2QKL A;  1UPR A;  2CY4 A;  1V61 A;  5DH9 B;  1BAK A;  1E5W A;  3CIK A;  2COD A;  4CHM A;  1AQC A;  3WYF B;  3P7Z A;  2W2X C;  3X23 A;  4CHJ A;  3GYP A;  5GOW B;  4XWX A;  3RCP A;  2ADZ A;  4IFS A;  2KUP A;  1FHX A;  4B6H A;  2XQN M;  4HB2 B;  5EFX A;  2CY5 A;  4HAZ B;  3DXE A;  2ELA A;  1Z87 A;  4KHO A;  3F5R A;  1BTK A;  2I1J A;  1MKE A;  1DYN A;  1MPH A;  3PVW A;  4KHB B;  2DN6 A;  4WJ7 A;  5C79 A;  2D9Z A;  4HAY B;  2DX1 A;  4NY0 A;  4PNK A;  2YT1 A;  1X05 A;  4MY6 A;  4GN1 A;  2N23 A;  3SNH A;  2RUK B;  4Z2N A;  3SO6 A;  4GZU A;  2E2X A;  2KGX B;  5LOP B;  1K5G B;  2YS5 A;  1ZC4 B;  5C16 A;  3D8D A;  2UVM A;  2VRW B;  4A6F A;  4F7G A;  2LUL A;  1XX0 A;  2EC1 A;  3KY9 A;  5JLJ B;  2P0H A;  3VIA A;  5HE1 A;  1X1F A;  1V5U A;  2J0M A;  2RVB B;  1BWN A;  4F7H A;  4DBB A;  1FGZ A;  4MT7 A;  1EAZ A;  1I7A A;  1UNQ A;  2GCJ A;  2OTX A;  5J3T A;  1NU2 A;  1XD4 A;  2H7D A;  2DA0 A;  4ZRK A;  5HE0 A;  5C5B A;  1U5G A;  2GCL A;  1X1G A;  1KI1 B;  2YS1 A;  3KZ1 A;  1U29 A;  3ULC A;  3P6A A;  2GS0 A;  1H10 A;  2Y8F A;  5JHH A;  4BBK A;  4K2P A;  4A6H A;  1NI2 A;  3A8Q A;  2COC A;  4Z2M B;  3G9W A;  1MK9 B;  2DKQ A;  1MK7 B;  1H4R A;  4D0N B;  1UNR A;  3D8F A;  4A5K A;  2DKP A;  2P0D A;  2K2U A;  5JP4 A;  2RLO A;  1KZ7 A;  1DDW A;  1FHO A;  3KRW A;  1XR0 B;  1WG7 A;  3M1I B;  1K5D B;  2EJ8 A;  2DHJ A;  1DRO A;  3ZVR A;  1EGX A;  2Z0Q A;  4DX9 0;  3N7C A;  3QBV B;  3QWM A;  4CYE A;  1BTN A;  1WGU A;  2EMS A;  3MPX A;  1AWE A;  1DDV A;  2Z0P A;  3T06 A;  1WGQ A;  1Q67 A;  1PLS A;  3UZT A;  4HDO A;  1XOD A;  4HAT B;  2IFS A;  3AU5 A;  2K2J A;  5KCV A;  3TW1 A;  4KAX B;  5CLQ B;  3ODX A;  3U7D A;  2FJL A;  2YSZ A;  4K2O A;  4GMX B;  5L81 A;  2H7E A;  1ISN A;  5FI0 A;  2EMT A;  3KRX A;  2Z0O A;  2GJY A;  3V5W A;  1U5D A;  4HHV A;  1UNP A;  5D3W A;  3ZDT A;  2ROV A;  1Y5O A;  4L6E A;  4TYZ A;  1ZSQ A;  2R0D A;  3TVV A;  2D4Q A;  2D9V A;  1FGY A;  3LJU X;  4HB0 B;  4F7U P;  3NSU A;  3DXC A;  1P5T A;  3HW2 B;  3O96 A;  1UEF A;  3TFM A;  3TO1 A;  1KZG A;  2YT0 A;  1UPQ A;  5DIF B;  4GPT B;  4HDQ A;  2AEH A;  2I5C A;  1Y19 B;  2J59 M;  3ML4 A;  5LON B;  1TJ6 A;  3PEG A;  1M7R A;  2YF0 A;  3FSS A;  1EF1 A;  4IAP A;  3IVF A;  2DHI A;  1TQZ A;  4IOY X;  1DBH A;  2YS3 A;  3TCA A;  4EJN A;  4A6K A;  4PQ0 A;  2G35 A;  1IRS A;  5DI9 B;  2M14 A;  2P8V A;  5D3Y A;  3SUZ A;  2KCJ A;  2W2W A;  1P6S A;  3D8E A;  2W2X D;  1U5F A;  2D9Y A;  4ZRI A;  4ZRJ A;  1DDM A;  1M7E A;  4GXB A;  5D3X A;  1GG3 A;  5CLL B;  3SYX A;  1NTY A;  1QC6 A;  3VOQ A;  1WVH A;  3FEH A;  4WSF A;  1U27 A;  1LW3 A;  4KVG B;  3SV1 A;  3BIN A;  2K00 A;  1U2B A;  3PZD A;  5D27 A;  2L1C A;  2D10 A;  3A98 B;  1FHW A;  2LYD A;  1ZM0 A;  1B55 A;  1ZC3 B;  2IYB A;  4KHA A;  4Y94 A;  3FM8 C;  2LKO A;  2UZR A;  3U8Z A;  2MFQ A;  2DHK A;  3PG7 A;  4EKU A;  2I5F A;  3AJ4 A;  4C0A A;  1P3R A;  2DLW A;  2AL6 A;  2RSG A;  4A6F B;  2VSZ A;  1XCG A;  1X11 A;  1WJM A;  2LG1 A;  5DHF B;  2CAY A;  4HB3 B;  5J3Q A;  3HK0 A;  4YL8 A;  2HE7 A;  2R09 A;  5KQ4 A;  5JHG A;  3ODW A;  5C5B B;  2BCJ A;  1FOE A;  2QKM A;  1W1G A;  3A8P A;  2RGN B;  1V89 A;  2M38 A;  2NMB A;  2ZPY A;  3ODO A;  4H8S A;  2D9W A;  4K17 A;  1GC7 A;  1WI1 A;  1FB8 A;  1OY2 A;  5D3V A;  4DXA B;  2ELB A;  4HAW B;  5J3Y A;  1V88 A;  2LOZ A;  3AU4 A;  2CRF A;  2J0K A;  2MDX A;  5FI1 A;  4K81 A;  2D2Q A;  1XKE A;  3ULB A;  2D11 A;  2ROZ B;  4TKN A;  2RNR B;  5HE3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...