1V88A

Solution structure of the pleckstrin homology domain of oxysterol-binding protein-related protein 8 (kiaa1451 protein)
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
130
structure length
130
Chain Sequence
GSSGSSGIVMADWLKIRGTLKSWTKLWCVLKPGVLLIYKTQKNGQWVGTVLLNACEIIERPSKKDGFCFKLFHPLEQSIWAVKGPKGEAVGSITQPLPSSYLIIRATSESDGRCWMDALELALKSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Oxysterol binding protein-related protein 8
publication title Solution Structure of the Pleckstrin Homology Domain of Oxysterol-Binding Protein-Related Protein 8 (KIAA1451 Protein)
rcsb
source organism Homo sapiens
molecule tags Lipid transport
total genus 16
structure length 130
sequence length 130
ec nomenclature
pdb deposition date 2003-12-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1v88A00
5FI1A 2I5FA 5D3WA 3PVWA 4GXBA 4GN1A 3PG7A 2QKMA 2COAA 2DA0A 4KVGB 1RRPB 2DX5A 5JLJB 1UNQA 5D3VA 2K2JA 3DXCA 2RLOA 4EMOA 2K00A 3HW2B 3TO1A 3U7DA 2Q13A 5KQ4A 2P0FA 2VSZA 2KUPA 5HE1A 2HE7A 1MIXA 1P3RA 1XCGA 3PVUA 2D10A 3FSSA 5D3YA 2UVMA 3PSCA 1MAIA 3DXDA 2YVCA 1QC6A 3ODXA 1OQNA 4HHVA 2D9WA 1UPRA 2CAYA 3ULCA 2RNRB 4HB3B 1Z87A 1X86A 1ISNA 1FHXA 2YS3A 2RUKB 3GYOA 3GYPA 2X18A 2KGXB 3PZDA 3SYXA 4HB0B 1FHWA 2D2QA 5HE0A 2ELAA 4Z2MB 1BTNA 1GC7A 4HAZB 5EFXA 1K5GB 1U5FA 4HAYB 1XODA 1X1FA 2MKRA 1SHCA 3KRWA 5C16A 1FHOA 3WA0A 2J0JA 4PNKA 3SUZA 4WSFA 1MIZB 3TW1A 2D9XA 1ZC3B 2Y8FA 4HB2B 2COCA 2M38A 4A5KA 3IVFA 4CHMA 5DHAB 4A6FA 5C5BA 3X23A 3PP2A 1FGZA 4Z2NA 4K17A 2RSGA 4K2PA 1V5UA 2CY5A 1EF1A 2KCJA 3KY9A 3LJUX 2COFA 4HATB 5DH9B 1W1GA 1DROA 1U27A 3D8EA 4F7GA 4A6KA 1U2BA 3PEGA 1UPQA 2CRFA 3AU4A 5KCVA 3A8PA 3FM8C 4B6HA 3QBVB 2DHJA 4DBBA 1LW3A 3BJIA 2DKPA 2YF0A 1MK7B 2ADZA 2YS1A 4Y94A 1TJ6A 3ZVRA 1WVHA 4YL8A 1UNPA 3F5RA 1X1GA 2Y7BA 3DXEA 2LKOA 2GJYA 2NMBA 1AQCA 2LYDA 2DKQA 1ZC4B 2RVBB 1V89A 4GMVA 3P7ZA 1U29A 1DYNA 2MFQA 1RJ2A 5JHGA 3SV1A 3F0WA 4IAPA 2W2WA 2G35A 5CLLB 4XWXA 4MT7A 3SO6A 1U5EA 2Z0QA 4MK0A 2DLWA 1W1DA 4ZRKA 1XKEA 2GS0A 1DBHA 2D9VA 1AWEA 1ZSQA 2R0DA 2UZSA 5DHFB 4IFSA 3RCPA 1J19A 1GC6A 2YT1A 4HB4B 3HK0A 2ZPYA 2AL6A 2DTCA 5CLQB 1KZ7A 5J3TA 5FI0A 1XD4A 2AEHA 3ZDTA 3A8QA 2P0DA 4NSWA 1DDVA 1OY2A 2MDXA 4K2OA 3VIAA 3MDBC 1H4RA 1X11A 4WVFB 1V5PA 2GCLA 2L1CA 1EVHA 3D8DA 2HTHB 2IYBA 5L81A 1B55A 1WGQA 1ZVRA 2D9ZA 2K2UA 2ELBA 1X05A 2ROVA 1EGXA 4ZRJA 5J3YA 1OMWA 3ULBA 2P0HA 2CODA 4KHBB 2VKIA 2I1JA 4K81A 2J59M 4A6FB 1V88A 5C5BB 4EJNA 1U5GA 1XX0A 5C79A 2J0KA 4P7IA 2P8VA 2N23A 5GOWB 1MKEA 2DX1A 2Y8GA 3G9WA 3D8FA 1NTVA 4H8SA 4KHOA 2D11A 4F7UP 4HDOA 1UEFA 4KAXB 1XR0B 1IRSA 2ROZB 1WI1A 4IOYX 2DYQA 3TVVA 1W1HA 3CIKA 4TKNA 3P6AA 1PMSA 3A98B 4GMXB 2DHIA 1P6SA 5JP4A 2OQBA 3ODWA 1K5DB 3PVLA 3MPXA 5HE2A 3M1IB 3KZ1A 4HAUB 1NI2A 1H10A 2VRWB 1U5DA 4D0NB 4YONA 3VOQA 1KZGA 2BCJA 2LOXA 1BWNA 1WGUA 3OANA 2E2XA 1V61A 2CY4A 4BBKA 4TYZA 4NY0A 1BAKA 1I7AA 2Z0OA 1Q67A 2GCJA 4L6EA 4EKUA 1WJ1A 3ML4A 1FOEA 4HAWB 1LB1A 5LOPB 2MWNB 4HDQA 2OTXA 2PZ1A 5JHHA 2W2XC 4GZUA 2D4QA 3WYFB 3QIJA 1MK9B 2J0MA 3TFMA 5DIFB 2IFSA 4DXAB 1TXDA 1DDWA 2YT0A 2LOZA 4C0AA 2EMSA 2H7DA 1ZM0A 2DFKA 5KQ1A 3QWMA 2YRYA 3AJ4A 1FB8A 1KI1B 3KSYA 3TCAA 2NZ8B 1I2HA 4MY6A 3N7CA 5LONB 2DN6A 3UZTA 1DDMA 1J0WA 1QQGA 1UNRA 2W2XD 4DX90 1MPHA 3O96A 1WJMA 3HQCA 5DI9B 1PFJA 4GPTB 3NSUA 5HE3A 4CYEA 2Z0PA 2I5CA 2JP2A 5D3XA 2L2IA 2R09A 2DHKA 2EMTA 1EAZA 4ZRIA 3T06A 3V5WA 2H7EA 3AU5A 4DX8A 2QKLA 3ODOA 3FEHA 4PQ0A 1V5MA 1P5TA 3SNHA 1M7RA 2FJLA 2N0YA 4CHJA 2RGNB 1FGYA 1N3HA 1TQZA 2XQNM 4F7HA 2D9YA 2M14A 1PLSA 1E5WA 2V76A 2LULA 2YS5A 5D27A 3BINA 1NTYA 2I1KA 4HAVB 4HAXB 3U8ZA 2UZRA 1Y19B 5C6RA 1GG3A 2YSZA 4A6HA 2DYNA 1WG7A 3KRXA 4WJ7A 5J3QA 1SGHA 2LG1A 1FAOA 4KHAA 2EJ8A 3CXBB 2EC1A 1BTKA 1NU2A 1M7EA 1Y5OA
chains in the Genus database with same CATH superfamily
5FI1A 2I5FA 5D3WA 3PVWA 4GXBA 4GN1A 3PG7A 2QKMA 2COAA 2DA0A 4KVGB 2KR0A 1RRPB 2DX5A 5JLJB 1UNQA 5D3VA 2K2JA 3DXCA 2RLOA 4EMOA 2K00A 3HW2B 3TO1A 3U7DA 2Q13A 5KQ4A 2P0FA 2VSZA 2KUPA 5HE1A 2HE7A 1MIXA 1P3RA 1XCGA 3PVUA 2D10A 3FSSA 3DCXA 5D3YA 2UVMA 3PSCA 1MAIA 3DXDA 2YVCA 1QC6A 3ODXA 1OQNA 4HHVA 2D9WA 1UPRA 2CAYA 3ULCA 2RNRB 4HB3B 1Z87A 1X86A 1ISNA 1FHXA 2YS3A 2RUKB 3GYOA 3GYPA 2X18A 2KGXB 3PZDA 3SYXA 4HB0B 1FHWA 2D2QA 2YT2A 2K8EA 2RRFA 5HE0A 2ELAA 4Z2MB 1BTNA 1GC7A 4HAZB 5EFXA 1K5GB 1U5FA 4HAYB 1XODA 1X1FA 2MKRA 1SHCA 3KRWA 5C16A 1FHOA 3WA0A 2J0JA 4PNKA 3SUZA 4WSFA 1MIZB 3TW1A 2D9XA 1ZC3B 2Y8FA 4L1RA 4HB2B 2COCA 4KHBA 2M38A 4A5KA 3IVFA 4CHMA 5DHAB 4A6FA 5C5BA 3X23A 3PP2A 5M4YB 1FGZA 4Z2NA 4K17A 2RSGA 4K2PA 1V5UA 2CY5A 2Z59A 1EF1A 2KCJA 3KY9A 3LJUX 2COFA 4HATB 5DH9B 1W1GA 1DROA 1U27A 4HSIA 3D8EA 4F7GA 4A6KA 1U2BA 3PEGA 1UPQA 2CRFA 3AU4A 5KCVA 3A8PA 3FM8C 4GOUA 4B6HA 3QBVB 2DHJA 4DBBA 1LW3A 3BJIA 2DKPA 2YF0A 1MK7B 2ADZA 2YS1A 3FVCA 3OHMB 4Y94A 1TJ6A 3ZVRA 1WVHA 4YL8A 5I2MA 1UNPA 3F5RA 1X1GA 2Y7BA 3DXEA 2LKOA 2GJYA 2NMBA 1AQCA 2LYDA 2DKQA 1ZC4B 2RVBB 2KUQA 1V89A 4GMVA 3P7ZA 1U29A 1DYNA 2MFQA 1RJ2A 5JHGA 3SV1A 3F0WA 4IAPA 2W2WA 2G35A 5CLLB 4XWXA 4MT7A 2Z4DA 3SO6A 1U5EA 2Z0QA 4MK0A 2DLWA 1W1DA 4ZRKA 1XKEA 2GS0A 5LG4B 1DBHA 2D9VA 1AWEA 1ZSQA 2R0DA 2UZSA 5DHFB 5I2SA 4IFSA 3RCPA 1J19A 1GC6A 2YT1A 4HB4B 3HK0A 4QJ3B 3HSAA 2ZPYA 2AL6A 2DTCA 5CLQB 1KZ7A 5J3TA 4GNKB 5FI0A 1XD4A 2AEHA 1T77A 3ZDTA 3A8QA 2P0DA 4NSWA 1DDVA 1OY2A 2MDXA 4K2OA 3VIAA 3MDBC 1H4RA 1X11A 4WVFB 1V5PA 2GCLA 2L1CA 1EVHA 2KIEA 3D8DA 2HTHB 2IYBA 5L81A 1B55A 1WGQA 1ZVRA 2D9ZA 2K2UA 2ELBA 1X05A 2ROVA 1EGXA 4ZRJA 5J3YA 1OMWA 3ULBA 2P0HA 2CODA 4KHBB 2VKIA 2I1JA 4QJ4B 4K81A 4QXAB 4OSNA 2J59M 4A6FB 1V88A 5C5BB 4EJNA 2GUMA 1U5GA 1XX0A 5C79A 2J0KA 4P7IA 2P8VA 2N23A 5GOWB 1MKEA 2DX1A 2Y8GA 3G9WA 3D8FA 1NTVA 4H8SA 4KHOA 2D11A 4F7UP 4HDOA 1UEFA 4KAXB 3NWAA 1XR0B 1IRSA 2ROZB 3B77A 3HIEA 1WI1A 4IOYX 2DYQA 3TVVA 1W1HA 3CIKA 4TKNA 3P6AA 1PMSA 3A98B 4GMXB 2DHIA 1P6SA 5JP4A 5IRSA 2OQBA 3ODWA 1K5DB 4CSQA 3PVLA 3MPXA 2R2YA 5HE2A 3M1IB 3KZ1A 4HAUB 1NI2A 1H10A 2VRWB 1U5DA 4D0NB 4YONA 3VOQA 2KIGA 1KZGA 2BCJA 2LOXA 1BWNA 1MI1A 1WGUA 4OT1A 3OANA 2E2XA 3NWDA 1V61A 2CY4A 4BBKA 4TYZA 4NY0A 1BAKA 1I7AA 2Z0OA 1Q67A 2GCJA 4L6EA 4EKUA 1WJ1A 3ML4A 1FOEA 4HAWB 1LB1A 5LOPB 2MWNB 4HDQA 2OTXA 2PZ1A 5JHHA 2W2XC 4GZUA 2D4QA 3WYFB 3QIJA 1MK9B 2J0MA 3U12A 3TFMA 5DIFB 2IFSA 4DXAB 1TXDA 3NWFA 1ZYIA 1DDWA 2YT0A 2LOZA 4C0AA 2EMSA 2H7DA 1ZM0A 2NBVA 2DFKA 5KQ1A 3QWMA 2YRYA 3AJ4A 1FB8A 1KI1B 3KSYA 3NW8A 2NZ8B 3TCAA 1I2HA 4DIXA 4MY6A 3N7CA 5LONB 2DN6A 3UZTA 1DDMA 1J0WA 1QQGA 1UNRA 2W2XD 4DX90 1MPHA 3O96A 2ZKMX 1WJMA 4D6WA 3HQCA 2FJUB 2K49A 5DI9B 1PFJA 4GPTB 3NSUA 5HE3A 4CYEA 2Z0PA 2I5CA 2JP2A 5D3XA 2L2IA 2R09A 2Z14A 2DHKA 3A58A 2EMTA 1EAZA 4ZRIA 3T06A 3V5WA 2H7EA 3AU5A 4DX8A 2QKLA 3ODOA 3FEHA 4PQ0A 1V5MA 1P5TA 3SNHA 1M7RA 2FJLA 2N0YA 4CHJA 2RGNB 1FGYA 1N3HA 1TQZA 2Z13A 2XQNM 4F7HA 2D9YA 2M14A 1PLSA 1E5WA 2V76A 2LULA 2YS5A 5D27A 3BINA 1NTYA 2I1KA 4HAVB 4HAXB 3U8ZA 2UZRA 1Y19B 5C6RA 1GG3A 2YSZA 4A6HA 2DYNA 1WG7A 3KRXA 4WJ7A 5J3QA 1SGHA 2LG1A 1FAOA 4QJ5B 4KHAA 2EJ8A 3CXBB 2EC1A 1BTKA 1NU2A 1M7EA 1Y5OA
chains in the Genus database with same CATH topology
5FI1A 2I5FA 5D3WA 3PVWA 4GXBA 4GN1A 3PG7A 2QKMA 2COAA 2DA0A 4KVGB 1RRPB 2DX5A 5JLJB 1UNQA 5D3VA 2K2JA 3DXCA 2RLOA 4EMOA 2K00A 3HW2B 3TO1A 3U7DA 2Q13A 5KQ4A 2P0FA 2VSZA 2KUPA 5HE1A 2HE7A 1MIXA 1P3RA 1XCGA 3PVUA 2D10A 3FSSA 5D3YA 2UVMA 3PSCA 1MAIA 3DXDA 2YVCA 1QC6A 3ODXA 1OQNA 4HHVA 2D9WA 1UPRA 2CAYA 3ULCA 2RNRB 4HB3B 1Z87A 1X86A 1ISNA 1FHXA 2YS3A 2RUKB 3GYOA 3GYPA 2X18A 2KGXB 3PZDA 3SYXA 4HB0B 1FHWA 2D2QA 5HE0A 2ELAA 4Z2MB 1BTNA 1GC7A 4HAZB 5EFXA 1K5GB 1U5FA 4HAYB 1XODA 1X1FA 2MKRA 1SHCA 3KRWA 5C16A 1FHOA 3WA0A 2J0JA 4PNKA 3SUZA 4WSFA 1MIZB 3TW1A 2D9XA 1ZC3B 2Y8FA 4HB2B 2COCA 2M38A 4A5KA 3IVFA 4CHMA 5DHAB 4A6FA 5C5BA 3X23A 3PP2A 1FGZA 4Z2NA 4K17A 2RSGA 4K2PA 1V5UA 2CY5A 1EF1A 2KCJA 3KY9A 3LJUX 2COFA 4HATB 5DH9B 1W1GA 1DROA 1U27A 3D8EA 4F7GA 4A6KA 1U2BA 3PEGA 1UPQA 2CRFA 3AU4A 5KCVA 3A8PA 3FM8C 4B6HA 3QBVB 2DHJA 4DBBA 1LW3A 3BJIA 2DKPA 2YF0A 1MK7B 2ADZA 2YS1A 4Y94A 1TJ6A 3ZVRA 1WVHA 4YL8A 1UNPA 3F5RA 1X1GA 2Y7BA 3DXEA 2LKOA 2GJYA 2NMBA 1AQCA 2LYDA 2DKQA 1ZC4B 2RVBB 1V89A 4GMVA 3P7ZA 1U29A 1DYNA 2MFQA 1RJ2A 5JHGA 3SV1A 3F0WA 4IAPA 2W2WA 2G35A 5CLLB 4XWXA 4MT7A 3SO6A 1U5EA 2Z0QA 4MK0A 2DLWA 1W1DA 4ZRKA 1XKEA 2GS0A 1DBHA 2D9VA 1AWEA 1ZSQA 2R0DA 2UZSA 5DHFB 4IFSA 3RCPA 1J19A 1GC6A 2YT1A 4HB4B 3HK0A 2ZPYA 2AL6A 2DTCA 5CLQB 1KZ7A 5J3TA 5FI0A 1XD4A 2AEHA 3ZDTA 3A8QA 2P0DA 4NSWA 1DDVA 1OY2A 2MDXA 4K2OA 3VIAA 3MDBC 1H4RA 1X11A 4WVFB 1V5PA 2GCLA 2L1CA 1EVHA 3D8DA 2HTHB 2IYBA 5L81A 1B55A 1WGQA 1ZVRA 2D9ZA 2K2UA 2ELBA 1X05A 2ROVA 1EGXA 4ZRJA 5J3YA 1OMWA 3ULBA 2P0HA 2CODA 4KHBB 2VKIA 2I1JA 4K81A 2J59M 4A6FB 1V88A 5C5BB 4EJNA 1U5GA 1XX0A 5C79A 2J0KA 4P7IA 2P8VA 2N23A 5GOWB 1MKEA 2DX1A 2Y8GA 3G9WA 3D8FA 1NTVA 4H8SA 4KHOA 2D11A 4F7UP 4HDOA 1UEFA 4KAXB 1XR0B 1IRSA 2ROZB 1WI1A 4IOYX 2DYQA 3TVVA 1W1HA 3CIKA 4TKNA 3P6AA 1PMSA 3A98B 4GMXB 2DHIA 1P6SA 5JP4A 2OQBA 3ODWA 1K5DB 3PVLA 3MPXA 5HE2A 3M1IB 3KZ1A 4HAUB 1NI2A 1H10A 2VRWB 1U5DA 4D0NB 4YONA 3VOQA 1KZGA 2BCJA 2LOXA 1BWNA 1WGUA 3OANA 2E2XA 1V61A 2CY4A 4BBKA 4TYZA 4NY0A 1BAKA 1I7AA 2Z0OA 1Q67A 2GCJA 4L6EA 4EKUA 1WJ1A 3ML4A 1FOEA 4HAWB 1LB1A 5LOPB 2MWNB 4HDQA 2OTXA 2PZ1A 5JHHA 2W2XC 4GZUA 2D4QA 3WYFB 3QIJA 1MK9B 2J0MA 3TFMA 5DIFB 2IFSA 4DXAB 1TXDA 1DDWA 2YT0A 2LOZA 4C0AA 2EMSA 2H7DA 1ZM0A 2DFKA 5KQ1A 3QWMA 2YRYA 3AJ4A 1FB8A 1KI1B 3KSYA 3TCAA 2NZ8B 1I2HA 4MY6A 3N7CA 5LONB 2DN6A 3UZTA 1DDMA 1J0WA 1QQGA 1UNRA 2W2XD 4DX90 1MPHA 3O96A 1WJMA 3HQCA 5DI9B 1PFJA 4GPTB 3NSUA 5HE3A 4CYEA 2Z0PA 2I5CA 2JP2A 5D3XA 2L2IA 2R09A 2DHKA 2EMTA 1EAZA 4ZRIA 3T06A 3V5WA 2H7EA 3AU5A 4DX8A 2QKLA 3ODOA 3FEHA 4PQ0A 1V5MA 1P5TA 3SNHA 1M7RA 2FJLA 2N0YA 4CHJA 2RGNB 1FGYA 1N3HA 1TQZA 2XQNM 4F7HA 2D9YA 2M14A 1PLSA 1E5WA 2V76A 2LULA 2YS5A 5D27A 3BINA 1NTYA 2I1KA 4HAVB 4HAXB 3U8ZA 2UZRA 1Y19B 5C6RA 1GG3A 2YSZA 4A6HA 2DYNA 1WG7A 3KRXA 4WJ7A 5J3QA 1SGHA 2LG1A 1FAOA 4KHAA 2EJ8A 3CXBB 2EC1A 1BTKA 1NU2A 1M7EA 1Y5OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FI1 A;  2I5F A;  5D3W A;  3PVW A;  4GXB A;  4GN1 A;  3PG7 A;  2QKM A;  2COA A;  2DA0 A;  4KVG B;  1RRP B;  2DX5 A;  5JLJ B;  1UNQ A;  5D3V A;  2K2J A;  3DXC A;  2RLO A;  4EMO A;  2K00 A;  3HW2 B;  3TO1 A;  3U7D A;  2Q13 A;  5KQ4 A;  2P0F A;  2VSZ A;  2KUP A;  5HE1 A;  2HE7 A;  1MIX A;  1P3R A;  1XCG A;  3PVU A;  2D10 A;  3FSS A;  5D3Y A;  2UVM A;  3PSC A;  1MAI A;  3DXD A;  2YVC A;  1QC6 A;  3ODX A;  1OQN A;  4HHV A;  2D9W A;  1UPR A;  2CAY A;  3ULC A;  2RNR B;  4HB3 B;  1Z87 A;  1X86 A;  1ISN A;  1FHX A;  2YS3 A;  2RUK B;  3GYO A;  3GYP A;  2X18 A;  2KGX B;  3PZD A;  3SYX A;  4HB0 B;  1FHW A;  2D2Q A;  5HE0 A;  2ELA A;  4Z2M B;  1BTN A;  1GC7 A;  4HAZ B;  5EFX A;  1K5G B;  1U5F A;  4HAY B;  1XOD A;  1X1F A;  2MKR A;  1SHC A;  3KRW A;  5C16 A;  1FHO A;  3WA0 A;  2J0J A;  4PNK A;  3SUZ A;  4WSF A;  1MIZ B;  3TW1 A;  2D9X A;  1ZC3 B;  2Y8F A;  4HB2 B;  2COC A;  2M38 A;  4A5K A;  3IVF A;  4CHM A;  5DHA B;  4A6F A;  5C5B A;  3X23 A;  3PP2 A;  1FGZ A;  4Z2N A;  4K17 A;  2RSG A;  4K2P A;  1V5U A;  2CY5 A;  1EF1 A;  2KCJ A;  3KY9 A;  3LJU X;  2COF A;  4HAT B;  5DH9 B;  1W1G A;  1DRO A;  1U27 A;  3D8E A;  4F7G A;  4A6K A;  1U2B A;  3PEG A;  1UPQ A;  2CRF A;  3AU4 A;  5KCV A;  3A8P A;  3FM8 C;  4B6H A;  3QBV B;  2DHJ A;  4DBB A;  1LW3 A;  3BJI A;  2DKP A;  2YF0 A;  1MK7 B;  2ADZ A;  2YS1 A;  4Y94 A;  1TJ6 A;  3ZVR A;  1WVH A;  4YL8 A;  1UNP A;  3F5R A;  1X1G A;  2Y7B A;  3DXE A;  2LKO A;  2GJY A;  2NMB A;  1AQC A;  2LYD A;  2DKQ A;  1ZC4 B;  2RVB B;  1V89 A;  4GMV A;  3P7Z A;  1U29 A;  1DYN A;  2MFQ A;  1RJ2 A;  5JHG A;  3SV1 A;  3F0W A;  4IAP A;  2W2W A;  2G35 A;  5CLL B;  4XWX A;  4MT7 A;  3SO6 A;  1U5E A;  2Z0Q A;  4MK0 A;  2DLW A;  1W1D A;  4ZRK A;  1XKE A;  2GS0 A;  1DBH A;  2D9V A;  1AWE A;  1ZSQ A;  2R0D A;  2UZS A;  5DHF B;  4IFS A;  3RCP A;  1J19 A;  1GC6 A;  2YT1 A;  4HB4 B;  3HK0 A;  2ZPY A;  2AL6 A;  2DTC A;  5CLQ B;  1KZ7 A;  5J3T A;  5FI0 A;  1XD4 A;  2AEH A;  3ZDT A;  3A8Q A;  2P0D A;  4NSW A;  1DDV A;  1OY2 A;  2MDX A;  4K2O A;  3VIA A;  3MDB C;  1H4R A;  1X11 A;  4WVF B;  1V5P A;  2GCL A;  2L1C A;  1EVH A;  3D8D A;  2HTH B;  2IYB A;  5L81 A;  1B55 A;  1WGQ A;  1ZVR A;  2D9Z A;  2K2U A;  2ELB A;  1X05 A;  2ROV A;  1EGX A;  4ZRJ A;  5J3Y A;  1OMW A;  3ULB A;  2P0H A;  2COD A;  4KHB B;  2VKI A;  2I1J A;  4K81 A;  2J59 M;  4A6F B;  1V88 A;  5C5B B;  4EJN A;  1U5G A;  1XX0 A;  5C79 A;  2J0K A;  4P7I A;  2P8V A;  2N23 A;  5GOW B;  1MKE A;  2DX1 A;  2Y8G A;  3G9W A;  3D8F A;  1NTV A;  4H8S A;  4KHO A;  2D11 A;  4F7U P;  4HDO A;  1UEF A;  4KAX B;  1XR0 B;  1IRS A;  2ROZ B;  1WI1 A;  4IOY X;  2DYQ A;  3TVV A;  1W1H A;  3CIK A;  4TKN A;  3P6A A;  1PMS A;  3A98 B;  4GMX B;  2DHI A;  1P6S A;  5JP4 A;  2OQB A;  3ODW A;  1K5D B;  3PVL A;  3MPX A;  5HE2 A;  3M1I B;  3KZ1 A;  4HAU B;  1NI2 A;  1H10 A;  2VRW B;  1U5D A;  4D0N B;  4YON A;  3VOQ A;  1KZG A;  2BCJ A;  2LOX A;  1BWN A;  1WGU A;  3OAN A;  2E2X A;  1V61 A;  2CY4 A;  4BBK A;  4TYZ A;  4NY0 A;  1BAK A;  1I7A A;  2Z0O A;  1Q67 A;  2GCJ A;  4L6E A;  4EKU A;  1WJ1 A;  3ML4 A;  1FOE A;  4HAW B;  1LB1 A;  5LOP B;  2MWN B;  4HDQ A;  2OTX A;  2PZ1 A;  5JHH A;  2W2X C;  4GZU A;  2D4Q A;  3WYF B;  3QIJ A;  1MK9 B;  2J0M A;  3TFM A;  5DIF B;  2IFS A;  4DXA B;  1TXD A;  1DDW A;  2YT0 A;  2LOZ A;  4C0A A;  2EMS A;  2H7D A;  1ZM0 A;  2DFK A;  5KQ1 A;  3QWM A;  2YRY A;  3AJ4 A;  1FB8 A;  1KI1 B;  3KSY A;  3TCA A;  2NZ8 B;  1I2H A;  4MY6 A;  3N7C A;  5LON B;  2DN6 A;  3UZT A;  1DDM A;  1J0W A;  1QQG A;  1UNR A;  2W2X D;  4DX9 0;  1MPH A;  3O96 A;  1WJM A;  3HQC A;  5DI9 B;  1PFJ A;  4GPT B;  3NSU A;  5HE3 A;  4CYE A;  2Z0P A;  2I5C A;  2JP2 A;  5D3X A;  2L2I A;  2R09 A;  2DHK A;  2EMT A;  1EAZ A;  4ZRI A;  3T06 A;  3V5W A;  2H7E A;  3AU5 A;  4DX8 A;  2QKL A;  3ODO A;  3FEH A;  4PQ0 A;  1V5M A;  1P5T A;  3SNH A;  1M7R A;  2FJL A;  2N0Y A;  4CHJ A;  2RGN B;  1FGY A;  1N3H A;  1TQZ A;  2XQN M;  4F7H A;  2D9Y A;  2M14 A;  1PLS A;  1E5W A;  2V76 A;  2LUL A;  2YS5 A;  5D27 A;  3BIN A;  1NTY A;  2I1K A;  4HAV B;  4HAX B;  3U8Z A;  2UZR A;  1Y19 B;  5C6R A;  1GG3 A;  2YSZ A;  4A6H A;  2DYN A;  1WG7 A;  3KRX A;  4WJ7 A;  5J3Q A;  1SGH A;  2LG1 A;  1FAO A;  4KHA A;  2EJ8 A;  3CXB B;  2EC1 A;  1BTK A;  1NU2 A;  1M7E A;  1Y5O A; 
#chains in the Genus database with same CATH topology
 5FI1 A;  2I5F A;  5D3W A;  3PVW A;  4GXB A;  4GN1 A;  3PG7 A;  2QKM A;  2COA A;  2DA0 A;  4KVG B;  2KR0 A;  1RRP B;  2DX5 A;  5JLJ B;  1UNQ A;  5D3V A;  2K2J A;  3DXC A;  2RLO A;  4EMO A;  2K00 A;  3HW2 B;  3TO1 A;  3U7D A;  2Q13 A;  5KQ4 A;  2P0F A;  2VSZ A;  2KUP A;  5HE1 A;  2HE7 A;  1MIX A;  1P3R A;  1XCG A;  3PVU A;  2D10 A;  3FSS A;  3DCX A;  5D3Y A;  2UVM A;  3PSC A;  1MAI A;  3DXD A;  2YVC A;  1QC6 A;  3ODX A;  1OQN A;  4HHV A;  2D9W A;  1UPR A;  2CAY A;  3ULC A;  2RNR B;  4HB3 B;  1Z87 A;  1X86 A;  1ISN A;  1FHX A;  2YS3 A;  2RUK B;  3GYO A;  3GYP A;  2X18 A;  2KGX B;  3PZD A;  3SYX A;  4HB0 B;  1FHW A;  2D2Q A;  2YT2 A;  2K8E A;  2RRF A;  5HE0 A;  2ELA A;  4Z2M B;  1BTN A;  1GC7 A;  4HAZ B;  5EFX A;  1K5G B;  1U5F A;  4HAY B;  1XOD A;  1X1F A;  2MKR A;  1SHC A;  3KRW A;  5C16 A;  1FHO A;  3WA0 A;  2J0J A;  4PNK A;  3SUZ A;  4WSF A;  1MIZ B;  3TW1 A;  2D9X A;  1ZC3 B;  2Y8F A;  4L1R A;  4HB2 B;  2COC A;  4KHB A;  2M38 A;  4A5K A;  3IVF A;  4CHM A;  5DHA B;  4A6F A;  5C5B A;  3X23 A;  3PP2 A;  5M4Y B;  1FGZ A;  4Z2N A;  4K17 A;  2RSG A;  4K2P A;  1V5U A;  2CY5 A;  2Z59 A;  1EF1 A;  2KCJ A;  3KY9 A;  3LJU X;  2COF A;  4HAT B;  5DH9 B;  1W1G A;  1DRO A;  1U27 A;  4HSI A;  3D8E A;  4F7G A;  4A6K A;  1U2B A;  3PEG A;  1UPQ A;  2CRF A;  3AU4 A;  5KCV A;  3A8P A;  3FM8 C;  4GOU A;  4B6H A;  3QBV B;  2DHJ A;  4DBB A;  1LW3 A;  3BJI A;  2DKP A;  2YF0 A;  1MK7 B;  2ADZ A;  2YS1 A;  3FVC A;  3OHM B;  4Y94 A;  1TJ6 A;  3ZVR A;  1WVH A;  4YL8 A;  5I2M A;  1UNP A;  3F5R A;  1X1G A;  2Y7B A;  3DXE A;  2LKO A;  2GJY A;  2NMB A;  1AQC A;  2LYD A;  2DKQ A;  1ZC4 B;  2RVB B;  2KUQ A;  1V89 A;  4GMV A;  3P7Z A;  1U29 A;  1DYN A;  2MFQ A;  1RJ2 A;  5JHG A;  3SV1 A;  3F0W A;  4IAP A;  2W2W A;  2G35 A;  5CLL B;  4XWX A;  4MT7 A;  2Z4D A;  3SO6 A;  1U5E A;  2Z0Q A;  4MK0 A;  2DLW A;  1W1D A;  4ZRK A;  1XKE A;  2GS0 A;  5LG4 B;  1DBH A;  2D9V A;  1AWE A;  1ZSQ A;  2R0D A;  2UZS A;  5DHF B;  5I2S A;  4IFS A;  3RCP A;  1J19 A;  1GC6 A;  2YT1 A;  4HB4 B;  3HK0 A;  4QJ3 B;  3HSA A;  2ZPY A;  2AL6 A;  2DTC A;  5CLQ B;  1KZ7 A;  5J3T A;  4GNK B;  5FI0 A;  1XD4 A;  2AEH A;  1T77 A;  3ZDT A;  3A8Q A;  2P0D A;  4NSW A;  1DDV A;  1OY2 A;  2MDX A;  4K2O A;  3VIA A;  3MDB C;  1H4R A;  1X11 A;  4WVF B;  1V5P A;  2GCL A;  2L1C A;  1EVH A;  2KIE A;  3D8D A;  2HTH B;  2IYB A;  5L81 A;  1B55 A;  1WGQ A;  1ZVR A;  2D9Z A;  2K2U A;  2ELB A;  1X05 A;  2ROV A;  1EGX A;  4ZRJ A;  5J3Y A;  1OMW A;  3ULB A;  2P0H A;  2COD A;  4KHB B;  2VKI A;  2I1J A;  4QJ4 B;  4K81 A;  4QXA B;  4OSN A;  2J59 M;  4A6F B;  1V88 A;  5C5B B;  4EJN A;  2GUM A;  1U5G A;  1XX0 A;  5C79 A;  2J0K A;  4P7I A;  2P8V A;  2N23 A;  5GOW B;  1MKE A;  2DX1 A;  2Y8G A;  3G9W A;  3D8F A;  1NTV A;  4H8S A;  4KHO A;  2D11 A;  4F7U P;  4HDO A;  1UEF A;  4KAX B;  3NWA A;  1XR0 B;  1IRS A;  2ROZ B;  3B77 A;  3HIE A;  1WI1 A;  4IOY X;  2DYQ A;  3TVV A;  1W1H A;  3CIK A;  4TKN A;  3P6A A;  1PMS A;  3A98 B;  4GMX B;  2DHI A;  1P6S A;  5JP4 A;  5IRS A;  2OQB A;  3ODW A;  1K5D B;  4CSQ A;  3PVL A;  3MPX A;  2R2Y A;  5HE2 A;  3M1I B;  3KZ1 A;  4HAU B;  1NI2 A;  1H10 A;  2VRW B;  1U5D A;  4D0N B;  4YON A;  3VOQ A;  2KIG A;  1KZG A;  2BCJ A;  2LOX A;  1BWN A;  1MI1 A;  1WGU A;  4OT1 A;  3OAN A;  2E2X A;  3NWD A;  1V61 A;  2CY4 A;  4BBK A;  4TYZ A;  4NY0 A;  1BAK A;  1I7A A;  2Z0O A;  1Q67 A;  2GCJ A;  4L6E A;  4EKU A;  1WJ1 A;  3ML4 A;  1FOE A;  4HAW B;  1LB1 A;  5LOP B;  2MWN B;  4HDQ A;  2OTX A;  2PZ1 A;  5JHH A;  2W2X C;  4GZU A;  2D4Q A;  3WYF B;  3QIJ A;  1MK9 B;  2J0M A;  3U12 A;  3TFM A;  5DIF B;  2IFS A;  4DXA B;  1TXD A;  3NWF A;  1ZYI A;  1DDW A;  2YT0 A;  2LOZ A;  4C0A A;  2EMS A;  2H7D A;  1ZM0 A;  2NBV A;  2DFK A;  5KQ1 A;  3QWM A;  2YRY A;  3AJ4 A;  1FB8 A;  1KI1 B;  3KSY A;  3NW8 A;  2NZ8 B;  3TCA A;  1I2H A;  4DIX A;  4MY6 A;  3N7C A;  5LON B;  2DN6 A;  3UZT A;  1DDM A;  1J0W A;  1QQG A;  1UNR A;  2W2X D;  4DX9 0;  1MPH A;  3O96 A;  2ZKM X;  1WJM A;  4D6W A;  3HQC A;  2FJU B;  2K49 A;  5DI9 B;  1PFJ A;  4GPT B;  3NSU A;  5HE3 A;  4CYE A;  2Z0P A;  2I5C A;  2JP2 A;  5D3X A;  2L2I A;  2R09 A;  2Z14 A;  2DHK A;  3A58 A;  2EMT A;  1EAZ A;  4ZRI A;  3T06 A;  3V5W A;  2H7E A;  3AU5 A;  4DX8 A;  2QKL A;  3ODO A;  3FEH A;  4PQ0 A;  1V5M A;  1P5T A;  3SNH A;  1M7R A;  2FJL A;  2N0Y A;  4CHJ A;  2RGN B;  1FGY A;  1N3H A;  1TQZ A;  2Z13 A;  2XQN M;  4F7H A;  2D9Y A;  2M14 A;  1PLS A;  1E5W A;  2V76 A;  2LUL A;  2YS5 A;  5D27 A;  3BIN A;  1NTY A;  2I1K A;  4HAV B;  4HAX B;  3U8Z A;  2UZR A;  1Y19 B;  5C6R A;  1GG3 A;  2YSZ A;  4A6H A;  2DYN A;  1WG7 A;  3KRX A;  4WJ7 A;  5J3Q A;  1SGH A;  2LG1 A;  1FAO A;  4QJ5 B;  4KHA A;  2EJ8 A;  3CXB B;  2EC1 A;  1BTK A;  1NU2 A;  1M7E A;  1Y5O A; 
#chains in the Genus database with same CATH homology
 5FI1 A;  2I5F A;  5D3W A;  3PVW A;  4GXB A;  4GN1 A;  3PG7 A;  2QKM A;  2COA A;  2DA0 A;  4KVG B;  1RRP B;  2DX5 A;  5JLJ B;  1UNQ A;  5D3V A;  2K2J A;  3DXC A;  2RLO A;  4EMO A;  2K00 A;  3HW2 B;  3TO1 A;  3U7D A;  2Q13 A;  5KQ4 A;  2P0F A;  2VSZ A;  2KUP A;  5HE1 A;  2HE7 A;  1MIX A;  1P3R A;  1XCG A;  3PVU A;  2D10 A;  3FSS A;  5D3Y A;  2UVM A;  3PSC A;  1MAI A;  3DXD A;  2YVC A;  1QC6 A;  3ODX A;  1OQN A;  4HHV A;  2D9W A;  1UPR A;  2CAY A;  3ULC A;  2RNR B;  4HB3 B;  1Z87 A;  1X86 A;  1ISN A;  1FHX A;  2YS3 A;  2RUK B;  3GYO A;  3GYP A;  2X18 A;  2KGX B;  3PZD A;  3SYX A;  4HB0 B;  1FHW A;  2D2Q A;  5HE0 A;  2ELA A;  4Z2M B;  1BTN A;  1GC7 A;  4HAZ B;  5EFX A;  1K5G B;  1U5F A;  4HAY B;  1XOD A;  1X1F A;  2MKR A;  1SHC A;  3KRW A;  5C16 A;  1FHO A;  3WA0 A;  2J0J A;  4PNK A;  3SUZ A;  4WSF A;  1MIZ B;  3TW1 A;  2D9X A;  1ZC3 B;  2Y8F A;  4HB2 B;  2COC A;  2M38 A;  4A5K A;  3IVF A;  4CHM A;  5DHA B;  4A6F A;  5C5B A;  3X23 A;  3PP2 A;  1FGZ A;  4Z2N A;  4K17 A;  2RSG A;  4K2P A;  1V5U A;  2CY5 A;  1EF1 A;  2KCJ A;  3KY9 A;  3LJU X;  2COF A;  4HAT B;  5DH9 B;  1W1G A;  1DRO A;  1U27 A;  3D8E A;  4F7G A;  4A6K A;  1U2B A;  3PEG A;  1UPQ A;  2CRF A;  3AU4 A;  5KCV A;  3A8P A;  3FM8 C;  4B6H A;  3QBV B;  2DHJ A;  4DBB A;  1LW3 A;  3BJI A;  2DKP A;  2YF0 A;  1MK7 B;  2ADZ A;  2YS1 A;  4Y94 A;  1TJ6 A;  3ZVR A;  1WVH A;  4YL8 A;  1UNP A;  3F5R A;  1X1G A;  2Y7B A;  3DXE A;  2LKO A;  2GJY A;  2NMB A;  1AQC A;  2LYD A;  2DKQ A;  1ZC4 B;  2RVB B;  1V89 A;  4GMV A;  3P7Z A;  1U29 A;  1DYN A;  2MFQ A;  1RJ2 A;  5JHG A;  3SV1 A;  3F0W A;  4IAP A;  2W2W A;  2G35 A;  5CLL B;  4XWX A;  4MT7 A;  3SO6 A;  1U5E A;  2Z0Q A;  4MK0 A;  2DLW A;  1W1D A;  4ZRK A;  1XKE A;  2GS0 A;  1DBH A;  2D9V A;  1AWE A;  1ZSQ A;  2R0D A;  2UZS A;  5DHF B;  4IFS A;  3RCP A;  1J19 A;  1GC6 A;  2YT1 A;  4HB4 B;  3HK0 A;  2ZPY A;  2AL6 A;  2DTC A;  5CLQ B;  1KZ7 A;  5J3T A;  5FI0 A;  1XD4 A;  2AEH A;  3ZDT A;  3A8Q A;  2P0D A;  4NSW A;  1DDV A;  1OY2 A;  2MDX A;  4K2O A;  3VIA A;  3MDB C;  1H4R A;  1X11 A;  4WVF B;  1V5P A;  2GCL A;  2L1C A;  1EVH A;  3D8D A;  2HTH B;  2IYB A;  5L81 A;  1B55 A;  1WGQ A;  1ZVR A;  2D9Z A;  2K2U A;  2ELB A;  1X05 A;  2ROV A;  1EGX A;  4ZRJ A;  5J3Y A;  1OMW A;  3ULB A;  2P0H A;  2COD A;  4KHB B;  2VKI A;  2I1J A;  4K81 A;  2J59 M;  4A6F B;  1V88 A;  5C5B B;  4EJN A;  1U5G A;  1XX0 A;  5C79 A;  2J0K A;  4P7I A;  2P8V A;  2N23 A;  5GOW B;  1MKE A;  2DX1 A;  2Y8G A;  3G9W A;  3D8F A;  1NTV A;  4H8S A;  4KHO A;  2D11 A;  4F7U P;  4HDO A;  1UEF A;  4KAX B;  1XR0 B;  1IRS A;  2ROZ B;  1WI1 A;  4IOY X;  2DYQ A;  3TVV A;  1W1H A;  3CIK A;  4TKN A;  3P6A A;  1PMS A;  3A98 B;  4GMX B;  2DHI A;  1P6S A;  5JP4 A;  2OQB A;  3ODW A;  1K5D B;  3PVL A;  3MPX A;  5HE2 A;  3M1I B;  3KZ1 A;  4HAU B;  1NI2 A;  1H10 A;  2VRW B;  1U5D A;  4D0N B;  4YON A;  3VOQ A;  1KZG A;  2BCJ A;  2LOX A;  1BWN A;  1WGU A;  3OAN A;  2E2X A;  1V61 A;  2CY4 A;  4BBK A;  4TYZ A;  4NY0 A;  1BAK A;  1I7A A;  2Z0O A;  1Q67 A;  2GCJ A;  4L6E A;  4EKU A;  1WJ1 A;  3ML4 A;  1FOE A;  4HAW B;  1LB1 A;  5LOP B;  2MWN B;  4HDQ A;  2OTX A;  2PZ1 A;  5JHH A;  2W2X C;  4GZU A;  2D4Q A;  3WYF B;  3QIJ A;  1MK9 B;  2J0M A;  3TFM A;  5DIF B;  2IFS A;  4DXA B;  1TXD A;  1DDW A;  2YT0 A;  2LOZ A;  4C0A A;  2EMS A;  2H7D A;  1ZM0 A;  2DFK A;  5KQ1 A;  3QWM A;  2YRY A;  3AJ4 A;  1FB8 A;  1KI1 B;  3KSY A;  3TCA A;  2NZ8 B;  1I2H A;  4MY6 A;  3N7C A;  5LON B;  2DN6 A;  3UZT A;  1DDM A;  1J0W A;  1QQG A;  1UNR A;  2W2X D;  4DX9 0;  1MPH A;  3O96 A;  1WJM A;  3HQC A;  5DI9 B;  1PFJ A;  4GPT B;  3NSU A;  5HE3 A;  4CYE A;  2Z0P A;  2I5C A;  2JP2 A;  5D3X A;  2L2I A;  2R09 A;  2DHK A;  2EMT A;  1EAZ A;  4ZRI A;  3T06 A;  3V5W A;  2H7E A;  3AU5 A;  4DX8 A;  2QKL A;  3ODO A;  3FEH A;  4PQ0 A;  1V5M A;  1P5T A;  3SNH A;  1M7R A;  2FJL A;  2N0Y A;  4CHJ A;  2RGN B;  1FGY A;  1N3H A;  1TQZ A;  2XQN M;  4F7H A;  2D9Y A;  2M14 A;  1PLS A;  1E5W A;  2V76 A;  2LUL A;  2YS5 A;  5D27 A;  3BIN A;  1NTY A;  2I1K A;  4HAV B;  4HAX B;  3U8Z A;  2UZR A;  1Y19 B;  5C6R A;  1GG3 A;  2YSZ A;  4A6H A;  2DYN A;  1WG7 A;  3KRX A;  4WJ7 A;  5J3Q A;  1SGH A;  2LG1 A;  1FAO A;  4KHA A;  2EJ8 A;  3CXB B;  2EC1 A;  1BTK A;  1NU2 A;  1M7E A;  1Y5O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...