1V88A

Solution structure of the pleckstrin homology domain of oxysterol-binding protein-related protein 8 (kiaa1451 protein)
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
130
structure length
130
Chain Sequence
GSSGSSGIVMADWLKIRGTLKSWTKLWCVLKPGVLLIYKTQKNGQWVGTVLLNACEIIERPSKKDGFCFKLFHPLEQSIWAVKGPKGEAVGSITQPLPSSYLIIRATSESDGRCWMDALELALKSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution Structure of the Pleckstrin Homology Domain of Oxysterol-Binding Protein-Related Protein 8 (KIAA1451 Protein)
rcsb
source organism Homo sapiens
molecule tags Lipid transport
molecule keywords Oxysterol binding protein-related protein 8
total genus 16
structure length 130
sequence length 130
ec nomenclature
pdb deposition date 2003-12-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1v88A00
1OMWA 1ZC3B 2RGNB 3PVLA 1MAIA 2E2XA 4IOYX 5C5BA 2KGXB 1PFJA 3FSSA 4L6EA 4WVFB 1UNQA 1M7EA 1ZC4B 5C79A 4PNKA 2D9YA 2YS1A 2DFKA 3D8FA 4A5KA 2IYBA 2CAYA 1U2BA 1PMSA 1XR0B 2DKPA 1MPHA 2QKLA 3MPXA 1KI1B 1Y19B 3TFMA 3CXBB 1EAZA 3PZDA 1FHXA 2Q13A 5HE2A 3ODOA 1U27A 3FM8C 2YT1A 2HE7A 3A98B 1FHWA 2KUPA 3DXCA 3LJUX 5DIFB 5HE3A 1FB8A 1ZSQA 1V5PA 5JHHA 2Z0PA 4K2PA 3X23A 2EMTA 2XQNM 3PVUA 1X86A 1ISNA 2IFSA 1WVHA 4HHVA 4NSWA 1BTNA 1NTYA 4DX90 1ZM0A 2DHIA 5DH9B 3MDBC 5KQ1A 2OQBA 3QBVB 2W2XC 2YF0A 1SHCA 4HB0B 2W2XD 3PG7A 3KZ1A 4KHAA 1U29A 3PSCA 1W1HA 2LOXA 1QC6A 4D0NB 5DHFB 4NY0A 2YRYA 1WI1A 4C0AA 1FAOA 2D9WA 1W1GA 4XWXA 4EKUA 3U8ZA 1KZ7A 2ADZA 1DROA 4HAXB 2RVBB 2P0DA 2LKOA 1V5MA 3A8QA 2V76A 3PVWA 1I2HA 2D4QA 1H4RA 3HK0A 1RRPB 2L2IA 5DI9B 5J3QA 4GMVA 2J59M 2GS0A 2J0MA 4KVGB 4BBKA 5D3XA 3SYXA 3WYFB 2LOZA 2D9XA 3KRWA 1BAKA 4HAUB 4A6KA 1H10A 2DHJA 1SGHA 2UZRA 1P3RA 1J0WA 1XKEA 1UPQA 3ODXA 2K00A 2L1CA 1V61A 1XD4A 2ELBA 3TVVA 3NSUA 3ULBA 2CY4A 5J3TA 4HB4B 4GN1A 1UPRA 4HAZB 2H7EA 3V5WA 2RUKB 2D2QA 3VIAA 2VKIA 1DDWA 3M1IB 4YL8A 2OTXA 3PP2A 4EJNA 3SO6A 2N0YA 3BJIA 2Z0QA 1X11A 1XCGA 3UZTA 1GC6A 3P6AA 1Q67A 4MK0A 4Y94A 5CLQB 5J3YA 3KY9A 1XX0A 2DHKA 4K81A 1Z87A 2COAA 3GYPA 1XODA 5CLLB 1DBHA 4F7GA 2AL6A 1FOEA 2YS5A 4A6HA 4HAVB 1NU2A 2HTHB 2DYQA 2N23A 3HQCA 4YONA 1MIXA 3KSYA 4F7UP 2RNRB 5GOWB 3AU5A 4HAWB 4IFSA 2DYNA 5D3YA 2P8VA 2Z0OA 1U5GA 5JLJB 3ZDTA 4K2OA 2RSGA 3ML4A 2Y7BA 2YT0A 3HW2B 1K5GB 4EMOA 1P5TA 2K2JA 2ELAA 2GCJA 4CHJA 2D11A 3F5RA 2D9ZA 3OANA 3BINA 1DYNA 3ULCA 4HB2B 1IRSA 2CRFA 2KCJA 3TO1A 3TCAA 2NZ8B 4P7IA 4K17A 5D27A 2NMBA 4A6FB 4F7HA 2GCLA 5C16A 2PZ1A 5FI0A 2D10A 5JHGA 2MKRA 4GXBA 4WJ7A 3ZVRA 3O96A 2P0HA 2UZSA 1P6SA 2RLOA 1KZGA 2EC1A 2FJLA 5LOPB 4CHMA 1B55A 4B6HA 3IVFA 1GG3A 1UNRA 4KAXB 2YSZA 1V88A 1WJ1A 2J0JA 2ROZB 2UVMA 5C6RA 2JP2A 2LULA 1U5DA 1UEFA 4HDOA 5HE0A 4Z2MB 3WA0A 2VSZA 1DDMA 1EGXA 4DXAB 1U5FA 2LG1A 2I5CA 3KRXA 1M7RA 1FGZA 1WGQA 3AU4A 3N7CA 2YS3A 2G35A 3QWMA 5LONB 2D9VA 1AWEA 2DX1A 2ROVA 3SNHA 4CYEA 4MY6A 1BWNA 1GC7A 1MK7B 1X05A 3G9WA 1NI2A 2CY5A 5D3VA 4TKNA 2H7DA 1WGUA 1X1GA 1W1DA 4KHOA 5C5BB 2EMSA 4GMXB 2EJ8A 1MK9B 5JP4A 5FI1A 1OY2A 1MKEA 3CIKA 3T06A 2I5FA 1BTKA 4ZRKA 2M38A 5EFXA 4IAPA 2GJYA 1WG7A 1UNPA 2DTCA 2QKMA 3D8DA 2ZPYA 1E5WA 1WJMA 4ZRJA 1ZVRA 1U5EA 5D3WA 1EF1A 1FHOA 1LW3A 2DN6A 3GYOA 3A8PA 3D8EA 2Y8GA 1Y5OA 3AJ4A 4DX8A 3SUZA 2BCJA 2LYDA 1NTVA 2VRWB 2R0DA 1LB1A 2J0KA 1PLSA 2M14A 4DBBA 2MWNB 4GZUA 1V5UA 3SV1A 3F0WA 3RCPA 4Z2NA 1FGYA 4ZRIA 5KQ4A 2DKQA 5KCVA 5L81A 1K5DB 2DLWA 4MT7A 2CODA 4WSFA 1TJ6A 4A6FA 4HB3B 2DA0A 1EVHA 2YVCA 4HDQA 1TXDA 2MDXA 1J19A 1AQCA 4HATB 2W2WA 1QQGA 4TYZA 3DXDA 2COCA 5DHAB 3VOQA 2DX5A 5HE1A 3P7ZA 1V89A 2K2UA 3FEHA 1RJ2A 2R09A 3U7DA 4HAYB 3QIJA 1DDVA 3TW1A 1MIZB 4H8SA 2I1KA 4GPTB 1X1FA 1I7AA 4PQ0A 2P0FA 2Y8FA 3PEGA 2COFA 1TQZA 2I1JA 3DXEA 2AEHA 3ODWA 4KHBB 2X18A 1OQNA 1N3HA 2MFQA
chains in the Genus database with same CATH superfamily
1OMWA 1ZC3B 2RGNB 3PVLA 1MAIA 2E2XA 4IOYX 5C5BA 2KGXB 1PFJA 3FSSA 4L6EA 4GOUA 1UNQA 1M7EA 1ZC4B 4WVFB 5C79A 4PNKA 2D9YA 2YS1A 2DFKA 3D8FA 4A5KA 2IYBA 2CAYA 1U2BA 1PMSA 1XR0B 2DKPA 1MPHA 3U12A 2QKLA 3MPXA 1KI1B 2Z4DA 1Y19B 3TFMA 3CXBB 1EAZA 3PZDA 1FHXA 2Q13A 5HE2A 3ODOA 1U27A 3FM8C 2YT1A 2HE7A 3A98B 1FHWA 2KUPA 3DXCA 3LJUX 5DIFB 5HE3A 1FB8A 3B77A 1ZSQA 1V5PA 5JHHA 1ZYIA 2Z0PA 4K2PA 3X23A 2EMTA 2XQNM 3PVUA 1X86A 4OT1A 1ISNA 2IFSA 1WVHA 2KIGA 4HHVA 4NSWA 1BTNA 1NTYA 4DX90 1ZM0A 2DHIA 5DH9B 3MDBC 5KQ1A 2OQBA 2ZKMX 3QBVB 2W2XC 2YF0A 2Z13A 1SHCA 4HB0B 2W2XD 3PG7A 3KZ1A 4KHAA 1U29A 3PSCA 1W1HA 2LOXA 2K49A 1QC6A 4D0NB 5DHFB 4NY0A 2YRYA 1WI1A 4C0AA 1FAOA 2D9WA 3DCXA 1W1GA 4XWXA 4EKUA 3U8ZA 1KZ7A 2ADZA 1DROA 4HAXB 2RVBB 2P0DA 2LKOA 1V5MA 3A8QA 2V76A 1T77A 3PVWA 1I2HA 2D4QA 1H4RA 3HK0A 1RRPB 2L2IA 5DI9B 5J3QA 4GMVA 5I2MA 2J59M 2GS0A 2J0MA 4KVGB 4BBKA 5D3XA 3SYXA 3WYFB 2LOZA 2RRFA 2D9XA 3KRWA 1BAKA 4HAUB 4A6KA 1H10A 2DHJA 1SGHA 2UZRA 1P3RA 1J0WA 1XKEA 1UPQA 3ODXA 2K00A 2L1CA 1V61A 1XD4A 2ELBA 3TVVA 3NSUA 3ULBA 2CY4A 5J3TA 4HB4B 4GN1A 1UPRA 4GNKB 4HAZB 2H7EA 3V5WA 2RUKB 2D2QA 3VIAA 2VKIA 2R2YA 1DDWA 3M1IB 4YL8A 2NBVA 2OTXA 3PP2A 3SO6A 2N0YA 3BJIA 4EJNA 2Z0QA 1X11A 1XCGA 3UZTA 1GC6A 3P6AA 1Q67A 4MK0A 4Y94A 5CLQB 5J3YA 3KY9A 1XX0A 2DHKA 4K81A 4D6WA 1Z87A 2COAA 3GYPA 5I2SA 1XODA 5CLLB 1DBHA 4F7GA 2AL6A 1FOEA 2YS5A 4A6HA 2Z14A 4HAVB 1NU2A 2KR0A 2HTHB 4CSQA 2DYQA 3FVCA 2N23A 3HQCA 4YONA 1MIXA 3KSYA 4F7UP 2RNRB 5GOWB 3AU5A 4HAWB 4IFSA 2DYNA 5D3YA 2P8VA 2Z0OA 3OHMB 1U5GA 5JLJB 3ZDTA 4K2OA 2RSGA 3ML4A 2Y7BA 2YT0A 3HW2B 1K5GB 4EMOA 1P5TA 2K2JA 2ELAA 2GCJA 4CHJA 4DIXA 2KIEA 2D11A 3F5RA 2D9ZA 3OANA 3BINA 1DYNA 3ULCA 4HB2B 1IRSA 2CRFA 2KCJA 3TO1A 3TCAA 3HSAA 2NZ8B 4P7IA 4K17A 5D27A 2NMBA 4A6FB 4F7HA 2GCLA 5C16A 2PZ1A 5FI0A 2D10A 5JHGA 2MKRA 4GXBA 4WJ7A 3ZVRA 3O96A 2P0HA 2UZSA 1P6SA 2RLOA 1KZGA 2EC1A 2FJLA 5LOPB 4CHMA 1B55A 4B6HA 3IVFA 1GG3A 1UNRA 4KAXB 2YSZA 1V88A 4KHBA 1WJ1A 2J0JA 2ROZB 2UVMA 3NW8A 5C6RA 2JP2A 2LULA 4HSIA 1U5DA 1UEFA 4HDOA 5HE0A 4Z2MB 3WA0A 5IRSA 3NWDA 2VSZA 1DDMA 1EGXA 4DXAB 1U5FA 2LG1A 2I5CA 3KRXA 1M7RA 1FGZA 1WGQA 3AU4A 3N7CA 2YS3A 2G35A 3QWMA 5LONB 3HIEA 2D9VA 1AWEA 2DX1A 2GUMA 2ROVA 3SNHA 4CYEA 4MY6A 4QXAB 1BWNA 1GC7A 1MK7B 1X05A 3G9WA 1NI2A 2CY5A 4L1RA 5D3VA 4TKNA 2H7DA 1WGUA 1X1GA 1W1DA 4KHOA 2FJUB 5C5BB 2EMSA 4GMXB 2EJ8A 1MK9B 5JP4A 5FI1A 1OY2A 1MKEA 3CIKA 3T06A 1MI1A 2I5FA 3NWFA 1BTKA 4ZRKA 2M38A 5EFXA 4IAPA 2GJYA 1WG7A 1UNPA 2DTCA 2QKMA 2Z59A 3D8DA 2ZPYA 2KUQA 1E5WA 2YT2A 1WJMA 4ZRJA 1ZVRA 1U5EA 5D3WA 1EF1A 4QJ5B 1FHOA 1LW3A 2DN6A 3GYOA 3A8PA 3D8EA 2Y8GA 1Y5OA 3AJ4A 4DX8A 3A58A 2BCJA 2LYDA 3SUZA 1NTVA 2VRWB 2R0DA 2K8EA 1LB1A 2J0KA 1PLSA 2M14A 4DBBA 2MWNB 4GZUA 1V5UA 3SV1A 3F0WA 3RCPA 4Z2NA 1FGYA 4ZRIA 5KQ4A 2DKQA 5KCVA 5L81A 1K5DB 2DLWA 4MT7A 2CODA 4WSFA 1TJ6A 4A6FA 4HB3B 2DA0A 1EVHA 2YVCA 4HDQA 1TXDA 2MDXA 1J19A 1AQCA 5LG4B 5M4YB 4HATB 2W2WA 1QQGA 4TYZA 3DXDA 2COCA 4OSNA 5DHAB 3VOQA 2DX5A 4QJ4B 5HE1A 3P7ZA 1V89A 2K2UA 3FEHA 1RJ2A 3NWAA 2R09A 3U7DA 4HAYB 3QIJA 1DDVA 3TW1A 1MIZB 4H8SA 2I1KA 4GPTB 1X1FA 4QJ3B 1I7AA 4PQ0A 2P0FA 2Y8FA 3PEGA 2COFA 1TQZA 2I1JA 3DXEA 2AEHA 3ODWA 4KHBB 2X18A 1OQNA 1N3HA 2MFQA
chains in the Genus database with same CATH topology
1OMWA 1ZC3B 2RGNB 3PVLA 1MAIA 2E2XA 4IOYX 5C5BA 2KGXB 1PFJA 3FSSA 4L6EA 4WVFB 1UNQA 1M7EA 1ZC4B 5C79A 4PNKA 2D9YA 2YS1A 2DFKA 3D8FA 4A5KA 2IYBA 2CAYA 1U2BA 1PMSA 1XR0B 2DKPA 1MPHA 2QKLA 3MPXA 1KI1B 1Y19B 3TFMA 3CXBB 1EAZA 3PZDA 1FHXA 2Q13A 5HE2A 3ODOA 1U27A 3FM8C 2YT1A 2HE7A 3A98B 1FHWA 2KUPA 3DXCA 3LJUX 5DIFB 5HE3A 1FB8A 1ZSQA 1V5PA 5JHHA 2Z0PA 4K2PA 3X23A 2EMTA 2XQNM 3PVUA 1X86A 1ISNA 2IFSA 1WVHA 4HHVA 4NSWA 1BTNA 1NTYA 4DX90 1ZM0A 2DHIA 5DH9B 3MDBC 5KQ1A 2OQBA 3QBVB 2W2XC 2YF0A 1SHCA 4HB0B 2W2XD 3PG7A 3KZ1A 4KHAA 1U29A 3PSCA 1W1HA 2LOXA 1QC6A 4D0NB 5DHFB 4NY0A 2YRYA 1WI1A 4C0AA 1FAOA 2D9WA 1W1GA 4XWXA 4EKUA 3U8ZA 1KZ7A 2ADZA 1DROA 4HAXB 2RVBB 2P0DA 2LKOA 1V5MA 3A8QA 2V76A 3PVWA 1I2HA 2D4QA 1H4RA 3HK0A 1RRPB 2L2IA 5DI9B 5J3QA 4GMVA 2J59M 2GS0A 2J0MA 4KVGB 4BBKA 5D3XA 3SYXA 3WYFB 2LOZA 2D9XA 3KRWA 1BAKA 4HAUB 4A6KA 1H10A 2DHJA 1SGHA 2UZRA 1P3RA 1J0WA 1XKEA 1UPQA 3ODXA 2K00A 2L1CA 1V61A 1XD4A 2ELBA 3TVVA 3NSUA 3ULBA 2CY4A 5J3TA 4HB4B 4GN1A 1UPRA 4HAZB 2H7EA 3V5WA 2RUKB 2D2QA 3VIAA 2VKIA 1DDWA 3M1IB 4YL8A 2OTXA 3PP2A 4EJNA 3SO6A 2N0YA 3BJIA 2Z0QA 1X11A 1XCGA 3UZTA 1GC6A 3P6AA 1Q67A 4MK0A 4Y94A 5CLQB 5J3YA 3KY9A 1XX0A 2DHKA 4K81A 1Z87A 2COAA 3GYPA 1XODA 5CLLB 1DBHA 4F7GA 2AL6A 1FOEA 2YS5A 4A6HA 4HAVB 1NU2A 2HTHB 2DYQA 2N23A 3HQCA 4YONA 1MIXA 3KSYA 4F7UP 2RNRB 5GOWB 3AU5A 4HAWB 4IFSA 2DYNA 5D3YA 2P8VA 2Z0OA 1U5GA 5JLJB 3ZDTA 4K2OA 2RSGA 3ML4A 2Y7BA 2YT0A 3HW2B 1K5GB 4EMOA 1P5TA 2K2JA 2ELAA 2GCJA 4CHJA 2D11A 3F5RA 2D9ZA 3OANA 3BINA 1DYNA 3ULCA 4HB2B 1IRSA 2CRFA 2KCJA 3TO1A 3TCAA 2NZ8B 4P7IA 4K17A 5D27A 2NMBA 4A6FB 4F7HA 2GCLA 5C16A 2PZ1A 5FI0A 2D10A 5JHGA 2MKRA 4GXBA 4WJ7A 3ZVRA 3O96A 2P0HA 2UZSA 1P6SA 2RLOA 1KZGA 2EC1A 2FJLA 5LOPB 4CHMA 1B55A 4B6HA 3IVFA 1GG3A 1UNRA 4KAXB 2YSZA 1V88A 1WJ1A 2J0JA 2ROZB 2UVMA 5C6RA 2JP2A 2LULA 1U5DA 1UEFA 4HDOA 5HE0A 4Z2MB 3WA0A 2VSZA 1DDMA 1EGXA 4DXAB 1U5FA 2LG1A 2I5CA 3KRXA 1M7RA 1FGZA 1WGQA 3AU4A 3N7CA 2YS3A 2G35A 3QWMA 5LONB 2D9VA 1AWEA 2DX1A 2ROVA 3SNHA 4CYEA 4MY6A 1BWNA 1GC7A 1MK7B 1X05A 3G9WA 1NI2A 2CY5A 5D3VA 4TKNA 2H7DA 1WGUA 1X1GA 1W1DA 4KHOA 5C5BB 2EMSA 4GMXB 2EJ8A 1MK9B 5JP4A 5FI1A 1OY2A 1MKEA 3CIKA 3T06A 2I5FA 1BTKA 4ZRKA 2M38A 5EFXA 4IAPA 2GJYA 1WG7A 1UNPA 2DTCA 2QKMA 3D8DA 2ZPYA 1E5WA 1WJMA 4ZRJA 1ZVRA 1U5EA 5D3WA 1EF1A 1FHOA 1LW3A 2DN6A 3GYOA 3A8PA 3D8EA 2Y8GA 1Y5OA 3AJ4A 4DX8A 3SUZA 2BCJA 2LYDA 1NTVA 2VRWB 2R0DA 1LB1A 2J0KA 1PLSA 2M14A 4DBBA 2MWNB 4GZUA 1V5UA 3SV1A 3F0WA 3RCPA 4Z2NA 1FGYA 4ZRIA 5KQ4A 2DKQA 5KCVA 5L81A 1K5DB 2DLWA 4MT7A 2CODA 4WSFA 1TJ6A 4A6FA 4HB3B 2DA0A 1EVHA 2YVCA 4HDQA 1TXDA 2MDXA 1J19A 1AQCA 4HATB 2W2WA 1QQGA 4TYZA 3DXDA 2COCA 5DHAB 3VOQA 2DX5A 5HE1A 3P7ZA 1V89A 2K2UA 3FEHA 1RJ2A 2R09A 3U7DA 4HAYB 3QIJA 1DDVA 3TW1A 1MIZB 4H8SA 2I1KA 4GPTB 1X1FA 1I7AA 4PQ0A 2P0FA 2Y8FA 3PEGA 2COFA 1TQZA 2I1JA 3DXEA 2AEHA 3ODWA 4KHBB 2X18A 1OQNA 1N3HA 2MFQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OMW A;  1ZC3 B;  2RGN B;  3PVL A;  1MAI A;  2E2X A;  4IOY X;  5C5B A;  2KGX B;  1PFJ A;  3FSS A;  4L6E A;  4WVF B;  1UNQ A;  1M7E A;  1ZC4 B;  5C79 A;  4PNK A;  2D9Y A;  2YS1 A;  2DFK A;  3D8F A;  4A5K A;  2IYB A;  2CAY A;  1U2B A;  1PMS A;  1XR0 B;  2DKP A;  1MPH A;  2QKL A;  3MPX A;  1KI1 B;  1Y19 B;  3TFM A;  3CXB B;  1EAZ A;  3PZD A;  1FHX A;  2Q13 A;  5HE2 A;  3ODO A;  1U27 A;  3FM8 C;  2YT1 A;  2HE7 A;  3A98 B;  1FHW A;  2KUP A;  3DXC A;  3LJU X;  5DIF B;  5HE3 A;  1FB8 A;  1ZSQ A;  1V5P A;  5JHH A;  2Z0P A;  4K2P A;  3X23 A;  2EMT A;  2XQN M;  3PVU A;  1X86 A;  1ISN A;  2IFS A;  1WVH A;  4HHV A;  4NSW A;  1BTN A;  1NTY A;  4DX9 0;  1ZM0 A;  2DHI A;  5DH9 B;  3MDB C;  5KQ1 A;  2OQB A;  3QBV B;  2W2X C;  2YF0 A;  1SHC A;  4HB0 B;  2W2X D;  3PG7 A;  3KZ1 A;  4KHA A;  1U29 A;  3PSC A;  1W1H A;  2LOX A;  1QC6 A;  4D0N B;  5DHF B;  4NY0 A;  2YRY A;  1WI1 A;  4C0A A;  1FAO A;  2D9W A;  1W1G A;  4XWX A;  4EKU A;  3U8Z A;  1KZ7 A;  2ADZ A;  1DRO A;  4HAX B;  2RVB B;  2P0D A;  2LKO A;  1V5M A;  3A8Q A;  2V76 A;  3PVW A;  1I2H A;  2D4Q A;  1H4R A;  3HK0 A;  1RRP B;  2L2I A;  5DI9 B;  5J3Q A;  4GMV A;  2J59 M;  2GS0 A;  2J0M A;  4KVG B;  4BBK A;  5D3X A;  3SYX A;  3WYF B;  2LOZ A;  2D9X A;  3KRW A;  1BAK A;  4HAU B;  4A6K A;  1H10 A;  2DHJ A;  1SGH A;  2UZR A;  1P3R A;  1J0W A;  1XKE A;  1UPQ A;  3ODX A;  2K00 A;  2L1C A;  1V61 A;  1XD4 A;  2ELB A;  3TVV A;  3NSU A;  3ULB A;  2CY4 A;  5J3T A;  4HB4 B;  4GN1 A;  1UPR A;  4HAZ B;  2H7E A;  3V5W A;  2RUK B;  2D2Q A;  3VIA A;  2VKI A;  1DDW A;  3M1I B;  4YL8 A;  2OTX A;  3PP2 A;  4EJN A;  3SO6 A;  2N0Y A;  3BJI A;  2Z0Q A;  1X11 A;  1XCG A;  3UZT A;  1GC6 A;  3P6A A;  1Q67 A;  4MK0 A;  4Y94 A;  5CLQ B;  5J3Y A;  3KY9 A;  1XX0 A;  2DHK A;  4K81 A;  1Z87 A;  2COA A;  3GYP A;  1XOD A;  5CLL B;  1DBH A;  4F7G A;  2AL6 A;  1FOE A;  2YS5 A;  4A6H A;  4HAV B;  1NU2 A;  2HTH B;  2DYQ A;  2N23 A;  3HQC A;  4YON A;  1MIX A;  3KSY A;  4F7U P;  2RNR B;  5GOW B;  3AU5 A;  4HAW B;  4IFS A;  2DYN A;  5D3Y A;  2P8V A;  2Z0O A;  1U5G A;  5JLJ B;  3ZDT A;  4K2O A;  2RSG A;  3ML4 A;  2Y7B A;  2YT0 A;  3HW2 B;  1K5G B;  4EMO A;  1P5T A;  2K2J A;  2ELA A;  2GCJ A;  4CHJ A;  2D11 A;  3F5R A;  2D9Z A;  3OAN A;  3BIN A;  1DYN A;  3ULC A;  4HB2 B;  1IRS A;  2CRF A;  2KCJ A;  3TO1 A;  3TCA A;  2NZ8 B;  4P7I A;  4K17 A;  5D27 A;  2NMB A;  4A6F B;  4F7H A;  2GCL A;  5C16 A;  2PZ1 A;  5FI0 A;  2D10 A;  5JHG A;  2MKR A;  4GXB A;  4WJ7 A;  3ZVR A;  3O96 A;  2P0H A;  2UZS A;  1P6S A;  2RLO A;  1KZG A;  2EC1 A;  2FJL A;  5LOP B;  4CHM A;  1B55 A;  4B6H A;  3IVF A;  1GG3 A;  1UNR A;  4KAX B;  2YSZ A;  1V88 A;  1WJ1 A;  2J0J A;  2ROZ B;  2UVM A;  5C6R A;  2JP2 A;  2LUL A;  1U5D A;  1UEF A;  4HDO A;  5HE0 A;  4Z2M B;  3WA0 A;  2VSZ A;  1DDM A;  1EGX A;  4DXA B;  1U5F A;  2LG1 A;  2I5C A;  3KRX A;  1M7R A;  1FGZ A;  1WGQ A;  3AU4 A;  3N7C A;  2YS3 A;  2G35 A;  3QWM A;  5LON B;  2D9V A;  1AWE A;  2DX1 A;  2ROV A;  3SNH A;  4CYE A;  4MY6 A;  1BWN A;  1GC7 A;  1MK7 B;  1X05 A;  3G9W A;  1NI2 A;  2CY5 A;  5D3V A;  4TKN A;  2H7D A;  1WGU A;  1X1G A;  1W1D A;  4KHO A;  5C5B B;  2EMS A;  4GMX B;  2EJ8 A;  1MK9 B;  5JP4 A;  5FI1 A;  1OY2 A;  1MKE A;  3CIK A;  3T06 A;  2I5F A;  1BTK A;  4ZRK A;  2M38 A;  5EFX A;  4IAP A;  2GJY A;  1WG7 A;  1UNP A;  2DTC A;  2QKM A;  3D8D A;  2ZPY A;  1E5W A;  1WJM A;  4ZRJ A;  1ZVR A;  1U5E A;  5D3W A;  1EF1 A;  1FHO A;  1LW3 A;  2DN6 A;  3GYO A;  3A8P A;  3D8E A;  2Y8G A;  1Y5O A;  3AJ4 A;  4DX8 A;  3SUZ A;  2BCJ A;  2LYD A;  1NTV A;  2VRW B;  2R0D A;  1LB1 A;  2J0K A;  1PLS A;  2M14 A;  4DBB A;  2MWN B;  4GZU A;  1V5U A;  3SV1 A;  3F0W A;  3RCP A;  4Z2N A;  1FGY A;  4ZRI A;  5KQ4 A;  2DKQ A;  5KCV A;  5L81 A;  1K5D B;  2DLW A;  4MT7 A;  2COD A;  4WSF A;  1TJ6 A;  4A6F A;  4HB3 B;  2DA0 A;  1EVH A;  2YVC A;  4HDQ A;  1TXD A;  2MDX A;  1J19 A;  1AQC A;  4HAT B;  2W2W A;  1QQG A;  4TYZ A;  3DXD A;  2COC A;  5DHA B;  3VOQ A;  2DX5 A;  5HE1 A;  3P7Z A;  1V89 A;  2K2U A;  3FEH A;  1RJ2 A;  2R09 A;  3U7D A;  4HAY B;  3QIJ A;  1DDV A;  3TW1 A;  1MIZ B;  4H8S A;  2I1K A;  4GPT B;  1X1F A;  1I7A A;  4PQ0 A;  2P0F A;  2Y8F A;  3PEG A;  2COF A;  1TQZ A;  2I1J A;  3DXE A;  2AEH A;  3ODW A;  4KHB B;  2X18 A;  1OQN A;  1N3H A;  2MFQ A; 
#chains in the Genus database with same CATH topology
 1OMW A;  1ZC3 B;  2RGN B;  3PVL A;  1MAI A;  2E2X A;  4IOY X;  5C5B A;  2KGX B;  1PFJ A;  3FSS A;  4L6E A;  4GOU A;  1UNQ A;  1M7E A;  1ZC4 B;  4WVF B;  5C79 A;  4PNK A;  2D9Y A;  2YS1 A;  2DFK A;  3D8F A;  4A5K A;  2IYB A;  2CAY A;  1U2B A;  1PMS A;  1XR0 B;  2DKP A;  1MPH A;  3U12 A;  2QKL A;  3MPX A;  1KI1 B;  2Z4D A;  1Y19 B;  3TFM A;  3CXB B;  1EAZ A;  3PZD A;  1FHX A;  2Q13 A;  5HE2 A;  3ODO A;  1U27 A;  3FM8 C;  2YT1 A;  2HE7 A;  3A98 B;  1FHW A;  2KUP A;  3DXC A;  3LJU X;  5DIF B;  5HE3 A;  1FB8 A;  3B77 A;  1ZSQ A;  1V5P A;  5JHH A;  1ZYI A;  2Z0P A;  4K2P A;  3X23 A;  2EMT A;  2XQN M;  3PVU A;  1X86 A;  4OT1 A;  1ISN A;  2IFS A;  1WVH A;  2KIG A;  4HHV A;  4NSW A;  1BTN A;  1NTY A;  4DX9 0;  1ZM0 A;  2DHI A;  5DH9 B;  3MDB C;  5KQ1 A;  2OQB A;  2ZKM X;  3QBV B;  2W2X C;  2YF0 A;  2Z13 A;  1SHC A;  4HB0 B;  2W2X D;  3PG7 A;  3KZ1 A;  4KHA A;  1U29 A;  3PSC A;  1W1H A;  2LOX A;  2K49 A;  1QC6 A;  4D0N B;  5DHF B;  4NY0 A;  2YRY A;  1WI1 A;  4C0A A;  1FAO A;  2D9W A;  3DCX A;  1W1G A;  4XWX A;  4EKU A;  3U8Z A;  1KZ7 A;  2ADZ A;  1DRO A;  4HAX B;  2RVB B;  2P0D A;  2LKO A;  1V5M A;  3A8Q A;  2V76 A;  1T77 A;  3PVW A;  1I2H A;  2D4Q A;  1H4R A;  3HK0 A;  1RRP B;  2L2I A;  5DI9 B;  5J3Q A;  4GMV A;  5I2M A;  2J59 M;  2GS0 A;  2J0M A;  4KVG B;  4BBK A;  5D3X A;  3SYX A;  3WYF B;  2LOZ A;  2RRF A;  2D9X A;  3KRW A;  1BAK A;  4HAU B;  4A6K A;  1H10 A;  2DHJ A;  1SGH A;  2UZR A;  1P3R A;  1J0W A;  1XKE A;  1UPQ A;  3ODX A;  2K00 A;  2L1C A;  1V61 A;  1XD4 A;  2ELB A;  3TVV A;  3NSU A;  3ULB A;  2CY4 A;  5J3T A;  4HB4 B;  4GN1 A;  1UPR A;  4GNK B;  4HAZ B;  2H7E A;  3V5W A;  2RUK B;  2D2Q A;  3VIA A;  2VKI A;  2R2Y A;  1DDW A;  3M1I B;  4YL8 A;  2NBV A;  2OTX A;  3PP2 A;  3SO6 A;  2N0Y A;  3BJI A;  4EJN A;  2Z0Q A;  1X11 A;  1XCG A;  3UZT A;  1GC6 A;  3P6A A;  1Q67 A;  4MK0 A;  4Y94 A;  5CLQ B;  5J3Y A;  3KY9 A;  1XX0 A;  2DHK A;  4K81 A;  4D6W A;  1Z87 A;  2COA A;  3GYP A;  5I2S A;  1XOD A;  5CLL B;  1DBH A;  4F7G A;  2AL6 A;  1FOE A;  2YS5 A;  4A6H A;  2Z14 A;  4HAV B;  1NU2 A;  2KR0 A;  2HTH B;  4CSQ A;  2DYQ A;  3FVC A;  2N23 A;  3HQC A;  4YON A;  1MIX A;  3KSY A;  4F7U P;  2RNR B;  5GOW B;  3AU5 A;  4HAW B;  4IFS A;  2DYN A;  5D3Y A;  2P8V A;  2Z0O A;  3OHM B;  1U5G A;  5JLJ B;  3ZDT A;  4K2O A;  2RSG A;  3ML4 A;  2Y7B A;  2YT0 A;  3HW2 B;  1K5G B;  4EMO A;  1P5T A;  2K2J A;  2ELA A;  2GCJ A;  4CHJ A;  4DIX A;  2KIE A;  2D11 A;  3F5R A;  2D9Z A;  3OAN A;  3BIN A;  1DYN A;  3ULC A;  4HB2 B;  1IRS A;  2CRF A;  2KCJ A;  3TO1 A;  3TCA A;  3HSA A;  2NZ8 B;  4P7I A;  4K17 A;  5D27 A;  2NMB A;  4A6F B;  4F7H A;  2GCL A;  5C16 A;  2PZ1 A;  5FI0 A;  2D10 A;  5JHG A;  2MKR A;  4GXB A;  4WJ7 A;  3ZVR A;  3O96 A;  2P0H A;  2UZS A;  1P6S A;  2RLO A;  1KZG A;  2EC1 A;  2FJL A;  5LOP B;  4CHM A;  1B55 A;  4B6H A;  3IVF A;  1GG3 A;  1UNR A;  4KAX B;  2YSZ A;  1V88 A;  4KHB A;  1WJ1 A;  2J0J A;  2ROZ B;  2UVM A;  3NW8 A;  5C6R A;  2JP2 A;  2LUL A;  4HSI A;  1U5D A;  1UEF A;  4HDO A;  5HE0 A;  4Z2M B;  3WA0 A;  5IRS A;  3NWD A;  2VSZ A;  1DDM A;  1EGX A;  4DXA B;  1U5F A;  2LG1 A;  2I5C A;  3KRX A;  1M7R A;  1FGZ A;  1WGQ A;  3AU4 A;  3N7C A;  2YS3 A;  2G35 A;  3QWM A;  5LON B;  3HIE A;  2D9V A;  1AWE A;  2DX1 A;  2GUM A;  2ROV A;  3SNH A;  4CYE A;  4MY6 A;  4QXA B;  1BWN A;  1GC7 A;  1MK7 B;  1X05 A;  3G9W A;  1NI2 A;  2CY5 A;  4L1R A;  5D3V A;  4TKN A;  2H7D A;  1WGU A;  1X1G A;  1W1D A;  4KHO A;  2FJU B;  5C5B B;  2EMS A;  4GMX B;  2EJ8 A;  1MK9 B;  5JP4 A;  5FI1 A;  1OY2 A;  1MKE A;  3CIK A;  3T06 A;  1MI1 A;  2I5F A;  3NWF A;  1BTK A;  4ZRK A;  2M38 A;  5EFX A;  4IAP A;  2GJY A;  1WG7 A;  1UNP A;  2DTC A;  2QKM A;  2Z59 A;  3D8D A;  2ZPY A;  2KUQ A;  1E5W A;  2YT2 A;  1WJM A;  4ZRJ A;  1ZVR A;  1U5E A;  5D3W A;  1EF1 A;  4QJ5 B;  1FHO A;  1LW3 A;  2DN6 A;  3GYO A;  3A8P A;  3D8E A;  2Y8G A;  1Y5O A;  3AJ4 A;  4DX8 A;  3A58 A;  2BCJ A;  2LYD A;  3SUZ A;  1NTV A;  2VRW B;  2R0D A;  2K8E A;  1LB1 A;  2J0K A;  1PLS A;  2M14 A;  4DBB A;  2MWN B;  4GZU A;  1V5U A;  3SV1 A;  3F0W A;  3RCP A;  4Z2N A;  1FGY A;  4ZRI A;  5KQ4 A;  2DKQ A;  5KCV A;  5L81 A;  1K5D B;  2DLW A;  4MT7 A;  2COD A;  4WSF A;  1TJ6 A;  4A6F A;  4HB3 B;  2DA0 A;  1EVH A;  2YVC A;  4HDQ A;  1TXD A;  2MDX A;  1J19 A;  1AQC A;  5LG4 B;  5M4Y B;  4HAT B;  2W2W A;  1QQG A;  4TYZ A;  3DXD A;  2COC A;  4OSN A;  5DHA B;  3VOQ A;  2DX5 A;  4QJ4 B;  5HE1 A;  3P7Z A;  1V89 A;  2K2U A;  3FEH A;  1RJ2 A;  3NWA A;  2R09 A;  3U7D A;  4HAY B;  3QIJ A;  1DDV A;  3TW1 A;  1MIZ B;  4H8S A;  2I1K A;  4GPT B;  1X1F A;  4QJ3 B;  1I7A A;  4PQ0 A;  2P0F A;  2Y8F A;  3PEG A;  2COF A;  1TQZ A;  2I1J A;  3DXE A;  2AEH A;  3ODW A;  4KHB B;  2X18 A;  1OQN A;  1N3H A;  2MFQ A; 
#chains in the Genus database with same CATH homology
 1OMW A;  1ZC3 B;  2RGN B;  3PVL A;  1MAI A;  2E2X A;  4IOY X;  5C5B A;  2KGX B;  1PFJ A;  3FSS A;  4L6E A;  4WVF B;  1UNQ A;  1M7E A;  1ZC4 B;  5C79 A;  4PNK A;  2D9Y A;  2YS1 A;  2DFK A;  3D8F A;  4A5K A;  2IYB A;  2CAY A;  1U2B A;  1PMS A;  1XR0 B;  2DKP A;  1MPH A;  2QKL A;  3MPX A;  1KI1 B;  1Y19 B;  3TFM A;  3CXB B;  1EAZ A;  3PZD A;  1FHX A;  2Q13 A;  5HE2 A;  3ODO A;  1U27 A;  3FM8 C;  2YT1 A;  2HE7 A;  3A98 B;  1FHW A;  2KUP A;  3DXC A;  3LJU X;  5DIF B;  5HE3 A;  1FB8 A;  1ZSQ A;  1V5P A;  5JHH A;  2Z0P A;  4K2P A;  3X23 A;  2EMT A;  2XQN M;  3PVU A;  1X86 A;  1ISN A;  2IFS A;  1WVH A;  4HHV A;  4NSW A;  1BTN A;  1NTY A;  4DX9 0;  1ZM0 A;  2DHI A;  5DH9 B;  3MDB C;  5KQ1 A;  2OQB A;  3QBV B;  2W2X C;  2YF0 A;  1SHC A;  4HB0 B;  2W2X D;  3PG7 A;  3KZ1 A;  4KHA A;  1U29 A;  3PSC A;  1W1H A;  2LOX A;  1QC6 A;  4D0N B;  5DHF B;  4NY0 A;  2YRY A;  1WI1 A;  4C0A A;  1FAO A;  2D9W A;  1W1G A;  4XWX A;  4EKU A;  3U8Z A;  1KZ7 A;  2ADZ A;  1DRO A;  4HAX B;  2RVB B;  2P0D A;  2LKO A;  1V5M A;  3A8Q A;  2V76 A;  3PVW A;  1I2H A;  2D4Q A;  1H4R A;  3HK0 A;  1RRP B;  2L2I A;  5DI9 B;  5J3Q A;  4GMV A;  2J59 M;  2GS0 A;  2J0M A;  4KVG B;  4BBK A;  5D3X A;  3SYX A;  3WYF B;  2LOZ A;  2D9X A;  3KRW A;  1BAK A;  4HAU B;  4A6K A;  1H10 A;  2DHJ A;  1SGH A;  2UZR A;  1P3R A;  1J0W A;  1XKE A;  1UPQ A;  3ODX A;  2K00 A;  2L1C A;  1V61 A;  1XD4 A;  2ELB A;  3TVV A;  3NSU A;  3ULB A;  2CY4 A;  5J3T A;  4HB4 B;  4GN1 A;  1UPR A;  4HAZ B;  2H7E A;  3V5W A;  2RUK B;  2D2Q A;  3VIA A;  2VKI A;  1DDW A;  3M1I B;  4YL8 A;  2OTX A;  3PP2 A;  4EJN A;  3SO6 A;  2N0Y A;  3BJI A;  2Z0Q A;  1X11 A;  1XCG A;  3UZT A;  1GC6 A;  3P6A A;  1Q67 A;  4MK0 A;  4Y94 A;  5CLQ B;  5J3Y A;  3KY9 A;  1XX0 A;  2DHK A;  4K81 A;  1Z87 A;  2COA A;  3GYP A;  1XOD A;  5CLL B;  1DBH A;  4F7G A;  2AL6 A;  1FOE A;  2YS5 A;  4A6H A;  4HAV B;  1NU2 A;  2HTH B;  2DYQ A;  2N23 A;  3HQC A;  4YON A;  1MIX A;  3KSY A;  4F7U P;  2RNR B;  5GOW B;  3AU5 A;  4HAW B;  4IFS A;  2DYN A;  5D3Y A;  2P8V A;  2Z0O A;  1U5G A;  5JLJ B;  3ZDT A;  4K2O A;  2RSG A;  3ML4 A;  2Y7B A;  2YT0 A;  3HW2 B;  1K5G B;  4EMO A;  1P5T A;  2K2J A;  2ELA A;  2GCJ A;  4CHJ A;  2D11 A;  3F5R A;  2D9Z A;  3OAN A;  3BIN A;  1DYN A;  3ULC A;  4HB2 B;  1IRS A;  2CRF A;  2KCJ A;  3TO1 A;  3TCA A;  2NZ8 B;  4P7I A;  4K17 A;  5D27 A;  2NMB A;  4A6F B;  4F7H A;  2GCL A;  5C16 A;  2PZ1 A;  5FI0 A;  2D10 A;  5JHG A;  2MKR A;  4GXB A;  4WJ7 A;  3ZVR A;  3O96 A;  2P0H A;  2UZS A;  1P6S A;  2RLO A;  1KZG A;  2EC1 A;  2FJL A;  5LOP B;  4CHM A;  1B55 A;  4B6H A;  3IVF A;  1GG3 A;  1UNR A;  4KAX B;  2YSZ A;  1V88 A;  1WJ1 A;  2J0J A;  2ROZ B;  2UVM A;  5C6R A;  2JP2 A;  2LUL A;  1U5D A;  1UEF A;  4HDO A;  5HE0 A;  4Z2M B;  3WA0 A;  2VSZ A;  1DDM A;  1EGX A;  4DXA B;  1U5F A;  2LG1 A;  2I5C A;  3KRX A;  1M7R A;  1FGZ A;  1WGQ A;  3AU4 A;  3N7C A;  2YS3 A;  2G35 A;  3QWM A;  5LON B;  2D9V A;  1AWE A;  2DX1 A;  2ROV A;  3SNH A;  4CYE A;  4MY6 A;  1BWN A;  1GC7 A;  1MK7 B;  1X05 A;  3G9W A;  1NI2 A;  2CY5 A;  5D3V A;  4TKN A;  2H7D A;  1WGU A;  1X1G A;  1W1D A;  4KHO A;  5C5B B;  2EMS A;  4GMX B;  2EJ8 A;  1MK9 B;  5JP4 A;  5FI1 A;  1OY2 A;  1MKE A;  3CIK A;  3T06 A;  2I5F A;  1BTK A;  4ZRK A;  2M38 A;  5EFX A;  4IAP A;  2GJY A;  1WG7 A;  1UNP A;  2DTC A;  2QKM A;  3D8D A;  2ZPY A;  1E5W A;  1WJM A;  4ZRJ A;  1ZVR A;  1U5E A;  5D3W A;  1EF1 A;  1FHO A;  1LW3 A;  2DN6 A;  3GYO A;  3A8P A;  3D8E A;  2Y8G A;  1Y5O A;  3AJ4 A;  4DX8 A;  3SUZ A;  2BCJ A;  2LYD A;  1NTV A;  2VRW B;  2R0D A;  1LB1 A;  2J0K A;  1PLS A;  2M14 A;  4DBB A;  2MWN B;  4GZU A;  1V5U A;  3SV1 A;  3F0W A;  3RCP A;  4Z2N A;  1FGY A;  4ZRI A;  5KQ4 A;  2DKQ A;  5KCV A;  5L81 A;  1K5D B;  2DLW A;  4MT7 A;  2COD A;  4WSF A;  1TJ6 A;  4A6F A;  4HB3 B;  2DA0 A;  1EVH A;  2YVC A;  4HDQ A;  1TXD A;  2MDX A;  1J19 A;  1AQC A;  4HAT B;  2W2W A;  1QQG A;  4TYZ A;  3DXD A;  2COC A;  5DHA B;  3VOQ A;  2DX5 A;  5HE1 A;  3P7Z A;  1V89 A;  2K2U A;  3FEH A;  1RJ2 A;  2R09 A;  3U7D A;  4HAY B;  3QIJ A;  1DDV A;  3TW1 A;  1MIZ B;  4H8S A;  2I1K A;  4GPT B;  1X1F A;  1I7A A;  4PQ0 A;  2P0F A;  2Y8F A;  3PEG A;  2COF A;  1TQZ A;  2I1J A;  3DXE A;  2AEH A;  3ODW A;  4KHB B;  2X18 A;  1OQN A;  1N3H A;  2MFQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...