1XKEA

Solution structure of the second ran-binding domain from human ranbp2
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
130
structure length
130
Chain Sequence
GSGEEDEKVLYSQRVKLFRFDAEVSQWKERGLGNLKILKNEVNGKLRMLMRREQVLKVCANHWITTTMNLKPLSGSDRAWMWLASDFSDGDAKLEQLAAKFKTPELAEEFKQKFEECQRLLLDIPLQTPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport
molecule keywords Ran-binding protein 2
publication title Solution structure of the Ran-binding domain 2 of RanBP2 and its interaction with the C terminus of Ran.
pubmed doi rcsb
source organism Homo sapiens
total genus 32
structure length 130
sequence length 130
ec nomenclature
pdb deposition date 2004-09-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1xkeA00
3KSYA 1MAIA 5HE2A 5FI1A 1ZM0A 2EMTA 2Z0OA 1U5GA 1MK9B 5JP4A 3VOQA 1MK7B 2YT1A 1MKEA 5J3TA 1BAKA 3PP2A 1ZVRA 2CY5A 2P0HA 4GZUA 1FGYA 2COAA 1U5EA 4HHVA 3PZDA 2UVMA 1M7EA 2EJ8A 3D8EA 3DXCA 1LW3A 1TJ6A 5JHHA 5CLLB 1MPHA 2DTCA 5HE0A 4F7HA 1MIXA 1WVHA 2YVCA 3A98B 4YONA 1GC6A 2Q13A 1KI1B 2HE7A 2IFSA 1WG7A 1U2BA 1DBHA 1FHXA 2NMBA 2VRWB 2K00A 2CODA 1OY2A 2IYBA 1XR0B 1DDVA 1AQCA 2LULA 2YF0A 1I7AA 1P6SA 1SGHA 2X18A 1ZSQA 4MY6A 2COCA 3ZVRA 2D9ZA 3D8DA 3GYPA 3DXEA 1FOEA 1V5UA 2Y7BA 2W2XC 3SNHA 3AU5A 1V61A 2YSZA 2ROZB 1X11A 2I5CA 3AJ4A 4CYEA 4WVFB 1QQGA 4GN1A 4HAYB 4GPTB 2VKIA 5DHFB 3AU4A 2D9YA 4GMVA 4HAVB 1U5FA 1V88A 2NZ8B 1K5GB 2YS1A 1FAOA 3O96A 1EVHA 2GCLA 1BWNA 4WSFA 3P6AA 2D9XA 2ZPYA 4D0NB 4Z2MB 3PG7A 3ULCA 2DHKA 2AL6A 1U5DA 2EC1A 2JP2A 4HB4B 2CAYA 3PSCA 3U8ZA 4DX90 4H8SA 4F7GA 2MKRA 4C0AA 4KHBB 3F0WA 3HQCA 4XWXA 2ELAA 2AEHA 2YS5A 5J3QA 1DROA 2QKMA 2N0YA 3IVFA 3ODOA 1FGZA 1XCGA 3TCAA 2DN6A 1OMWA 1W1HA 2GJYA 2P8VA 3SUZA 3X23A 2LOXA 2HTHB 1TQZA 2DKPA 4NSWA 1FHWA 1FHOA 1UPQA 1SHCA 4BBKA 4EJNA 3ODXA 2H7DA 2I5FA 1GG3A 1BTKA 2Y8FA 4HB0B 3FEHA 4A6KA 1W1DA 2DX5A 5LONB 2CRFA 4DX8A 2Z0QA 1DDMA 4HAWB 4DBBA 5EFXA 3V5WA 3T06A 2J0JA 5KQ1A 1EGXA 2RNRB 1X1GA 2ROVA 1I2HA 5C16A 1P3RA 4PQ0A 1EAZA 2V76A 3WYFB 4CHJA 5KQ4A 2DX1A 3KZ1A 4K17A 4YL8A 1FB8A 1B55A 4HAZB 4EMOA 3D8FA 1PMSA 1XODA 2UZRA 4MT7A 3SO6A 2LG1A 1J19A 3OANA 1GC7A 2DA0A 5C6RA 5C5BA 2UZSA 2LOZA 1NI2A 3F5RA 2P0DA 1Y19B 4P7IA 3KY9A 1Q67A 3BINA 5HE1A 1BTNA 4IFSA 2Y8GA 3PVLA 2K2JA 1E5WA 1NTVA 4KHOA 1QC6A 2COFA 3TW1A 1X05A 1WJ1A 2K2UA 3KRXA 1XKEA 5DHAB 1M7RA 4L6EA 4Z2NA 2DHIA 5C5BB 4GMXB 1P5TA 4K2PA 5D3WA 3PEGA 5J3YA 1PLSA 4KAXB 4TKNA 5C79A 2VSZA 3MDBC 1IRSA 3LJUX 1V89A 4A6FA 3BJIA 4HAUB 3TO1A 2ADZA 2DLWA 3G9WA 5DH9B 4MK0A 4HB2B 1DDWA 1EF1A 1U29A 2EMSA 2FJLA 2YRYA 2OQBA 1Y5OA 2YT0A 2J0MA 5HE3A 3P7ZA 1DYNA 4A6FB 1H4RA 3N7CA 2H7EA 3SYXA 4B6HA 2MWNB 2J0KA 2DYQA 2XQNM 3FM8C 3A8QA 3HW2B 4ZRKA 2D10A 4K2OA 4GXBA 2DHJA 1H10A 2ELBA 1AWEA 3CXBB 1WGUA 4EKUA 1XD4A 1ZC3B 2RLOA 1KZGA 2PZ1A 3KRWA 1U27A 5JHGA 2GCJA 2M14A 4TYZA 3UZTA 5FI0A 2N23A 3TVVA 1PFJA 5KCVA 2D9VA 1V5PA 2KCJA 2L1CA 1RJ2A 2W2WA 2D4QA 2MDXA 5L81A 3HK0A 4HB3B 1J0WA 4A6HA 1RRPB 4HDOA 2BCJA 4ZRJA 3ULBA 3RCPA 4HATB 2DKQA 2CY4A 3A8PA 3U7DA 3NSUA 4HAXB 4KVGB 3ML4A 2W2XD 1N3HA 5JLJB 2RGNB 2R0DA 1V5MA 1ZC4B 2G35A 4IOYX 2MFQA 3TFMA 2OTXA 5LOPB 1OQNA 1UEFA 1UNRA 1X86A 1UNPA 1X1FA 3FSSA 3ODWA 5D3VA 3CIKA 4ZRIA 3VIAA 4IAPA 4F7UP 3SV1A 1NU2A 1Z87A 2M38A 2LKOA 2DFKA 1K5DB 1KZ7A 3MPXA 1TXDA 1WI1A 4K81A 3WA0A 3GYOA 3PVUA 5D3XA 1LB1A 4KHAA 2L2IA 2P0FA 5DIFB 2D9WA 2J59M 2QKLA 1W1GA 4HDQA 4A5KA 2DYNA 1MIZB 3DXDA 3QIJA 1UNQA 2LYDA 3QBVB 1WGQA 1UPRA 4Y94A 1ISNA 2I1KA 1WJMA 1XX0A 4WJ7A 4PNKA 1NTYA 2RUKB 2Z0PA 3QWMA 2I1JA 3ZDTA 5DI9B 2KUPA 2YS3A 2RSGA 2RVBB 5GOWB 5D27A 2KGXB 5CLQB 5D3YA 2D11A 2E2XA 4CHMA 2D2QA 3PVWA 3M1IB 2GS0A 4DXAB 4NY0A 2R09A
chains in the Genus database with same CATH superfamily
3KSYA 1MAIA 5HE2A 5FI1A 1ZM0A 2EMTA 2Z0OA 1U5GA 1MK9B 5JP4A 3VOQA 1MK7B 2YT1A 1MKEA 5J3TA 1BAKA 3PP2A 1ZVRA 2CY5A 2P0HA 3NWFA 4GZUA 2ZKMX 1FGYA 2COAA 1U5EA 3HSAA 4HHVA 3D8EA 2UVMA 1M7EA 2EJ8A 3DXCA 3PZDA 1LW3A 2NBVA 1TJ6A 5JHHA 5CLLB 1MPHA 2DTCA 5HE0A 4F7HA 1MIXA 1WVHA 2YVCA 3A98B 4YONA 1GC6A 2Q13A 1KI1B 2HE7A 2IFSA 1WG7A 1U2BA 1DBHA 4D6WA 1FHXA 2NMBA 5M4YB 2VRWB 2K00A 2CODA 1OY2A 2IYBA 1XR0B 1DDVA 1AQCA 2LULA 2YF0A 4QJ4B 1I7AA 1P6SA 1SGHA 4QXAB 2X18A 1ZSQA 4MY6A 2COCA 3ZVRA 2D9ZA 2RRFA 3D8DA 2KIEA 3GYPA 3DXEA 1FOEA 1V5UA 2Y7BA 2W2XC 2K8EA 3SNHA 3AU5A 1V61A 2YSZA 2ROZB 1X11A 2I5CA 3AJ4A 2Z14A 4CYEA 4WVFB 2Z4DA 1QQGA 4GN1A 4HAYB 4GPTB 2VKIA 4KHBA 5DHFB 3AU4A 2D9YA 4GMVA 2K49A 4HAVB 1U5FA 1V88A 2NZ8B 3FVCA 1K5GB 2YS1A 1FAOA 3O96A 1EVHA 2GCLA 1BWNA 4WSFA 5LG4B 3P6AA 2D9XA 2ZPYA 4D0NB 4Z2MB 3PG7A 3ULCA 2DHKA 2AL6A 1U5DA 2EC1A 2JP2A 4HB4B 4HSIA 2CAYA 3PSCA 3NWAA 3U8ZA 4DX90 4H8SA 4F7GA 2MKRA 4C0AA 4KHBB 3F0WA 3HQCA 4XWXA 1T77A 2ELAA 3DCXA 5IRSA 3B77A 2AEHA 2YS5A 5J3QA 4QJ3B 1DROA 2QKMA 2N0YA 3IVFA 3ODOA 1FGZA 1XCGA 3TCAA 2DN6A 1OMWA 1W1HA 2GJYA 2P8VA 3SUZA 3X23A 2LOXA 2HTHB 1TQZA 2DKPA 4NSWA 1FHWA 2KUQA 1FHOA 2KIGA 1UPQA 1SHCA 4BBKA 4EJNA 3ODXA 2H7DA 2I5FA 1GG3A 1BTKA 2Y8FA 4HB0B 3FEHA 4A6KA 1W1DA 2DX5A 5LONB 2CRFA 4DX8A 3HIEA 2Z0QA 3NWDA 4HAWB 4DBBA 1DDMA 5EFXA 3V5WA 2KR0A 3T06A 2J0JA 2R2YA 5KQ1A 1EGXA 2RNRB 1X1GA 3OHMB 2ROVA 1I2HA 5C16A 1P3RA 4PQ0A 1EAZA 2V76A 3NW8A 3WYFB 4CHJA 5KQ4A 2DX1A 3KZ1A 4K17A 4YL8A 1FB8A 1B55A 4HAZB 4EMOA 3D8FA 1PMSA 1XODA 2UZRA 4MT7A 3SO6A 2LG1A 1J19A 2Z13A 3OANA 1GC7A 4CSQA 2DA0A 5C6RA 1ZYIA 5C5BA 2UZSA 3A58A 2LOZA 1NI2A 3F5RA 2P0DA 1Y19B 4P7IA 3KY9A 1Q67A 3BINA 5HE1A 1BTNA 4IFSA 2Y8GA 3PVLA 2K2JA 5I2SA 1E5WA 1NTVA 4KHOA 1QC6A 2COFA 3TW1A 1X05A 1WJ1A 2K2UA 3KRXA 1XKEA 5DHAB 1M7RA 4L6EA 4Z2NA 2DHIA 5C5BB 4GMXB 1P5TA 3U12A 4K2PA 4L1RA 5D3WA 3PEGA 5J3YA 1PLSA 4KAXB 4TKNA 5C79A 2VSZA 3MDBC 1IRSA 3LJUX 1V89A 4A6FA 3BJIA 4HAUB 4DIXA 3TO1A 2ADZA 2DLWA 3G9WA 5DH9B 4MK0A 4HB2B 1DDWA 1EF1A 1U29A 2EMSA 2FJLA 2YRYA 2OQBA 1Y5OA 2YT0A 2J0MA 5HE3A 3P7ZA 1DYNA 2Z59A 4A6FB 1H4RA 3N7CA 2H7EA 3SYXA 4B6HA 2MWNB 2J0KA 2DYQA 2XQNM 3FM8C 3A8QA 3HW2B 4ZRKA 2D10A 4K2OA 4GXBA 2DHJA 1H10A 2ELBA 1AWEA 3CXBB 1WGUA 4EKUA 1XD4A 1ZC3B 2RLOA 1KZGA 2PZ1A 1U27A 3KRWA 5JHGA 2GCJA 2M14A 2YT2A 4TYZA 3UZTA 5FI0A 2N23A 3TVVA 1PFJA 5KCVA 2D9VA 1V5PA 2KCJA 2L1CA 1RJ2A 2W2WA 2D4QA 2MDXA 5L81A 3HK0A 4HB3B 1J0WA 4A6HA 1RRPB 4HDOA 2BCJA 4OT1A 4ZRJA 4QJ5B 3ULBA 3RCPA 4HATB 2DKQA 2CY4A 3A8PA 3U7DA 3NSUA 4HAXB 4KVGB 3ML4A 1MI1A 2W2XD 1N3HA 5JLJB 2RGNB 2R0DA 1V5MA 1ZC4B 2G35A 4IOYX 2MFQA 3TFMA 2OTXA 5LOPB 1OQNA 1UEFA 4GOUA 1UNRA 1X86A 1UNPA 1X1FA 2GUMA 3FSSA 3ODWA 5D3VA 3CIKA 4ZRIA 3VIAA 4IAPA 4F7UP 3SV1A 1NU2A 1Z87A 2M38A 2LKOA 2DFKA 1K5DB 1KZ7A 3MPXA 1TXDA 1WI1A 4K81A 3WA0A 3GYOA 3PVUA 5D3XA 1LB1A 4KHAA 2L2IA 2P0FA 5DIFB 2D9WA 2J59M 2QKLA 1W1GA 4HDQA 4A5KA 2DYNA 1MIZB 3DXDA 3QIJA 1UNQA 2LYDA 3QBVB 1WGQA 1UPRA 4Y94A 1ISNA 2I1KA 1WJMA 1XX0A 4WJ7A 4PNKA 1NTYA 2RUKB 5I2MA 2Z0PA 3QWMA 2I1JA 3ZDTA 5DI9B 2KUPA 2YS3A 2RSGA 2RVBB 5GOWB 4GNKB 5D27A 4OSNA 2KGXB 5CLQB 5D3YA 2D11A 2E2XA 4CHMA 2D2QA 3PVWA 3M1IB 2GS0A 2FJUB 4DXAB 4NY0A 2R09A
chains in the Genus database with same CATH topology
3KSYA 1MAIA 5HE2A 5FI1A 1ZM0A 2EMTA 2Z0OA 1U5GA 1MK9B 5JP4A 3VOQA 1MK7B 2YT1A 1MKEA 5J3TA 1BAKA 3PP2A 1ZVRA 2CY5A 2P0HA 4GZUA 1FGYA 2COAA 1U5EA 4HHVA 3PZDA 2UVMA 1M7EA 2EJ8A 3D8EA 3DXCA 1LW3A 1TJ6A 5JHHA 5CLLB 1MPHA 2DTCA 5HE0A 4F7HA 1MIXA 1WVHA 2YVCA 3A98B 4YONA 1GC6A 2Q13A 1KI1B 2HE7A 2IFSA 1WG7A 1U2BA 1DBHA 1FHXA 2NMBA 2VRWB 2K00A 2CODA 1OY2A 2IYBA 1XR0B 1DDVA 1AQCA 2LULA 2YF0A 1I7AA 1P6SA 1SGHA 2X18A 1ZSQA 4MY6A 2COCA 3ZVRA 2D9ZA 3D8DA 3GYPA 3DXEA 1FOEA 1V5UA 2Y7BA 2W2XC 3SNHA 3AU5A 1V61A 2YSZA 2ROZB 1X11A 2I5CA 3AJ4A 4CYEA 4WVFB 1QQGA 4GN1A 4HAYB 4GPTB 2VKIA 5DHFB 3AU4A 2D9YA 4GMVA 4HAVB 1U5FA 1V88A 2NZ8B 1K5GB 2YS1A 1FAOA 3O96A 1EVHA 2GCLA 1BWNA 4WSFA 3P6AA 2D9XA 2ZPYA 4D0NB 4Z2MB 3PG7A 3ULCA 2DHKA 2AL6A 1U5DA 2EC1A 2JP2A 4HB4B 2CAYA 3PSCA 3U8ZA 4DX90 4H8SA 4F7GA 2MKRA 4C0AA 4KHBB 3F0WA 3HQCA 4XWXA 2ELAA 2AEHA 2YS5A 5J3QA 1DROA 2QKMA 2N0YA 3IVFA 3ODOA 1FGZA 1XCGA 3TCAA 2DN6A 1OMWA 1W1HA 2GJYA 2P8VA 3SUZA 3X23A 2LOXA 2HTHB 1TQZA 2DKPA 4NSWA 1FHWA 1FHOA 1UPQA 1SHCA 4BBKA 4EJNA 3ODXA 2H7DA 2I5FA 1GG3A 1BTKA 2Y8FA 4HB0B 3FEHA 4A6KA 1W1DA 2DX5A 5LONB 2CRFA 4DX8A 2Z0QA 1DDMA 4HAWB 4DBBA 5EFXA 3V5WA 3T06A 2J0JA 5KQ1A 1EGXA 2RNRB 1X1GA 2ROVA 1I2HA 5C16A 1P3RA 4PQ0A 1EAZA 2V76A 3WYFB 4CHJA 5KQ4A 2DX1A 3KZ1A 4K17A 4YL8A 1FB8A 1B55A 4HAZB 4EMOA 3D8FA 1PMSA 1XODA 2UZRA 4MT7A 3SO6A 2LG1A 1J19A 3OANA 1GC7A 2DA0A 5C6RA 5C5BA 2UZSA 2LOZA 1NI2A 3F5RA 2P0DA 1Y19B 4P7IA 3KY9A 1Q67A 3BINA 5HE1A 1BTNA 4IFSA 2Y8GA 3PVLA 2K2JA 1E5WA 1NTVA 4KHOA 1QC6A 2COFA 3TW1A 1X05A 1WJ1A 2K2UA 3KRXA 1XKEA 5DHAB 1M7RA 4L6EA 4Z2NA 2DHIA 5C5BB 4GMXB 1P5TA 4K2PA 5D3WA 3PEGA 5J3YA 1PLSA 4KAXB 4TKNA 5C79A 2VSZA 3MDBC 1IRSA 3LJUX 1V89A 4A6FA 3BJIA 4HAUB 3TO1A 2ADZA 2DLWA 3G9WA 5DH9B 4MK0A 4HB2B 1DDWA 1EF1A 1U29A 2EMSA 2FJLA 2YRYA 2OQBA 1Y5OA 2YT0A 2J0MA 5HE3A 3P7ZA 1DYNA 4A6FB 1H4RA 3N7CA 2H7EA 3SYXA 4B6HA 2MWNB 2J0KA 2DYQA 2XQNM 3FM8C 3A8QA 3HW2B 4ZRKA 2D10A 4K2OA 4GXBA 2DHJA 1H10A 2ELBA 1AWEA 3CXBB 1WGUA 4EKUA 1XD4A 1ZC3B 2RLOA 1KZGA 2PZ1A 3KRWA 1U27A 5JHGA 2GCJA 2M14A 4TYZA 3UZTA 5FI0A 2N23A 3TVVA 1PFJA 5KCVA 2D9VA 1V5PA 2KCJA 2L1CA 1RJ2A 2W2WA 2D4QA 2MDXA 5L81A 3HK0A 4HB3B 1J0WA 4A6HA 1RRPB 4HDOA 2BCJA 4ZRJA 3ULBA 3RCPA 4HATB 2DKQA 2CY4A 3A8PA 3U7DA 3NSUA 4HAXB 4KVGB 3ML4A 2W2XD 1N3HA 5JLJB 2RGNB 2R0DA 1V5MA 1ZC4B 2G35A 4IOYX 2MFQA 3TFMA 2OTXA 5LOPB 1OQNA 1UEFA 1UNRA 1X86A 1UNPA 1X1FA 3FSSA 3ODWA 5D3VA 3CIKA 4ZRIA 3VIAA 4IAPA 4F7UP 3SV1A 1NU2A 1Z87A 2M38A 2LKOA 2DFKA 1K5DB 1KZ7A 3MPXA 1TXDA 1WI1A 4K81A 3WA0A 3GYOA 3PVUA 5D3XA 1LB1A 4KHAA 2L2IA 2P0FA 5DIFB 2D9WA 2J59M 2QKLA 1W1GA 4HDQA 4A5KA 2DYNA 1MIZB 3DXDA 3QIJA 1UNQA 2LYDA 3QBVB 1WGQA 1UPRA 4Y94A 1ISNA 2I1KA 1WJMA 1XX0A 4WJ7A 4PNKA 1NTYA 2RUKB 2Z0PA 3QWMA 2I1JA 3ZDTA 5DI9B 2KUPA 2YS3A 2RSGA 2RVBB 5GOWB 5D27A 2KGXB 5CLQB 5D3YA 2D11A 2E2XA 4CHMA 2D2QA 3PVWA 3M1IB 2GS0A 4DXAB 4NY0A 2R09A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KSY A;  1MAI A;  5HE2 A;  5FI1 A;  1ZM0 A;  2EMT A;  2Z0O A;  1U5G A;  1MK9 B;  5JP4 A;  3VOQ A;  1MK7 B;  2YT1 A;  1MKE A;  5J3T A;  1BAK A;  3PP2 A;  1ZVR A;  2CY5 A;  2P0H A;  4GZU A;  1FGY A;  2COA A;  1U5E A;  4HHV A;  3PZD A;  2UVM A;  1M7E A;  2EJ8 A;  3D8E A;  3DXC A;  1LW3 A;  1TJ6 A;  5JHH A;  5CLL B;  1MPH A;  2DTC A;  5HE0 A;  4F7H A;  1MIX A;  1WVH A;  2YVC A;  3A98 B;  4YON A;  1GC6 A;  2Q13 A;  1KI1 B;  2HE7 A;  2IFS A;  1WG7 A;  1U2B A;  1DBH A;  1FHX A;  2NMB A;  2VRW B;  2K00 A;  2COD A;  1OY2 A;  2IYB A;  1XR0 B;  1DDV A;  1AQC A;  2LUL A;  2YF0 A;  1I7A A;  1P6S A;  1SGH A;  2X18 A;  1ZSQ A;  4MY6 A;  2COC A;  3ZVR A;  2D9Z A;  3D8D A;  3GYP A;  3DXE A;  1FOE A;  1V5U A;  2Y7B A;  2W2X C;  3SNH A;  3AU5 A;  1V61 A;  2YSZ A;  2ROZ B;  1X11 A;  2I5C A;  3AJ4 A;  4CYE A;  4WVF B;  1QQG A;  4GN1 A;  4HAY B;  4GPT B;  2VKI A;  5DHF B;  3AU4 A;  2D9Y A;  4GMV A;  4HAV B;  1U5F A;  1V88 A;  2NZ8 B;  1K5G B;  2YS1 A;  1FAO A;  3O96 A;  1EVH A;  2GCL A;  1BWN A;  4WSF A;  3P6A A;  2D9X A;  2ZPY A;  4D0N B;  4Z2M B;  3PG7 A;  3ULC A;  2DHK A;  2AL6 A;  1U5D A;  2EC1 A;  2JP2 A;  4HB4 B;  2CAY A;  3PSC A;  3U8Z A;  4DX9 0;  4H8S A;  4F7G A;  2MKR A;  4C0A A;  4KHB B;  3F0W A;  3HQC A;  4XWX A;  2ELA A;  2AEH A;  2YS5 A;  5J3Q A;  1DRO A;  2QKM A;  2N0Y A;  3IVF A;  3ODO A;  1FGZ A;  1XCG A;  3TCA A;  2DN6 A;  1OMW A;  1W1H A;  2GJY A;  2P8V A;  3SUZ A;  3X23 A;  2LOX A;  2HTH B;  1TQZ A;  2DKP A;  4NSW A;  1FHW A;  1FHO A;  1UPQ A;  1SHC A;  4BBK A;  4EJN A;  3ODX A;  2H7D A;  2I5F A;  1GG3 A;  1BTK A;  2Y8F A;  4HB0 B;  3FEH A;  4A6K A;  1W1D A;  2DX5 A;  5LON B;  2CRF A;  4DX8 A;  2Z0Q A;  1DDM A;  4HAW B;  4DBB A;  5EFX A;  3V5W A;  3T06 A;  2J0J A;  5KQ1 A;  1EGX A;  2RNR B;  1X1G A;  2ROV A;  1I2H A;  5C16 A;  1P3R A;  4PQ0 A;  1EAZ A;  2V76 A;  3WYF B;  4CHJ A;  5KQ4 A;  2DX1 A;  3KZ1 A;  4K17 A;  4YL8 A;  1FB8 A;  1B55 A;  4HAZ B;  4EMO A;  3D8F A;  1PMS A;  1XOD A;  2UZR A;  4MT7 A;  3SO6 A;  2LG1 A;  1J19 A;  3OAN A;  1GC7 A;  2DA0 A;  5C6R A;  5C5B A;  2UZS A;  2LOZ A;  1NI2 A;  3F5R A;  2P0D A;  1Y19 B;  4P7I A;  3KY9 A;  1Q67 A;  3BIN A;  5HE1 A;  1BTN A;  4IFS A;  2Y8G A;  3PVL A;  2K2J A;  1E5W A;  1NTV A;  4KHO A;  1QC6 A;  2COF A;  3TW1 A;  1X05 A;  1WJ1 A;  2K2U A;  3KRX A;  1XKE A;  5DHA B;  1M7R A;  4L6E A;  4Z2N A;  2DHI A;  5C5B B;  4GMX B;  1P5T A;  4K2P A;  5D3W A;  3PEG A;  5J3Y A;  1PLS A;  4KAX B;  4TKN A;  5C79 A;  2VSZ A;  3MDB C;  1IRS A;  3LJU X;  1V89 A;  4A6F A;  3BJI A;  4HAU B;  3TO1 A;  2ADZ A;  2DLW A;  3G9W A;  5DH9 B;  4MK0 A;  4HB2 B;  1DDW A;  1EF1 A;  1U29 A;  2EMS A;  2FJL A;  2YRY A;  2OQB A;  1Y5O A;  2YT0 A;  2J0M A;  5HE3 A;  3P7Z A;  1DYN A;  4A6F B;  1H4R A;  3N7C A;  2H7E A;  3SYX A;  4B6H A;  2MWN B;  2J0K A;  2DYQ A;  2XQN M;  3FM8 C;  3A8Q A;  3HW2 B;  4ZRK A;  2D10 A;  4K2O A;  4GXB A;  2DHJ A;  1H10 A;  2ELB A;  1AWE A;  3CXB B;  1WGU A;  4EKU A;  1XD4 A;  1ZC3 B;  2RLO A;  1KZG A;  2PZ1 A;  3KRW A;  1U27 A;  5JHG A;  2GCJ A;  2M14 A;  4TYZ A;  3UZT A;  5FI0 A;  2N23 A;  3TVV A;  1PFJ A;  5KCV A;  2D9V A;  1V5P A;  2KCJ A;  2L1C A;  1RJ2 A;  2W2W A;  2D4Q A;  2MDX A;  5L81 A;  3HK0 A;  4HB3 B;  1J0W A;  4A6H A;  1RRP B;  4HDO A;  2BCJ A;  4ZRJ A;  3ULB A;  3RCP A;  4HAT B;  2DKQ A;  2CY4 A;  3A8P A;  3U7D A;  3NSU A;  4HAX B;  4KVG B;  3ML4 A;  2W2X D;  1N3H A;  5JLJ B;  2RGN B;  2R0D A;  1V5M A;  1ZC4 B;  2G35 A;  4IOY X;  2MFQ A;  3TFM A;  2OTX A;  5LOP B;  1OQN A;  1UEF A;  1UNR A;  1X86 A;  1UNP A;  1X1F A;  3FSS A;  3ODW A;  5D3V A;  3CIK A;  4ZRI A;  3VIA A;  4IAP A;  4F7U P;  3SV1 A;  1NU2 A;  1Z87 A;  2M38 A;  2LKO A;  2DFK A;  1K5D B;  1KZ7 A;  3MPX A;  1TXD A;  1WI1 A;  4K81 A;  3WA0 A;  3GYO A;  3PVU A;  5D3X A;  1LB1 A;  4KHA A;  2L2I A;  2P0F A;  5DIF B;  2D9W A;  2J59 M;  2QKL A;  1W1G A;  4HDQ A;  4A5K A;  2DYN A;  1MIZ B;  3DXD A;  3QIJ A;  1UNQ A;  2LYD A;  3QBV B;  1WGQ A;  1UPR A;  4Y94 A;  1ISN A;  2I1K A;  1WJM A;  1XX0 A;  4WJ7 A;  4PNK A;  1NTY A;  2RUK B;  2Z0P A;  3QWM A;  2I1J A;  3ZDT A;  5DI9 B;  2KUP A;  2YS3 A;  2RSG A;  2RVB B;  5GOW B;  5D27 A;  2KGX B;  5CLQ B;  5D3Y A;  2D11 A;  2E2X A;  4CHM A;  2D2Q A;  3PVW A;  3M1I B;  2GS0 A;  4DXA B;  4NY0 A;  2R09 A; 
#chains in the Genus database with same CATH topology
 3KSY A;  1MAI A;  5HE2 A;  5FI1 A;  1ZM0 A;  2EMT A;  2Z0O A;  1U5G A;  1MK9 B;  5JP4 A;  3VOQ A;  1MK7 B;  2YT1 A;  1MKE A;  5J3T A;  1BAK A;  3PP2 A;  1ZVR A;  2CY5 A;  2P0H A;  3NWF A;  4GZU A;  2ZKM X;  1FGY A;  2COA A;  1U5E A;  3HSA A;  4HHV A;  3D8E A;  2UVM A;  1M7E A;  2EJ8 A;  3DXC A;  3PZD A;  1LW3 A;  2NBV A;  1TJ6 A;  5JHH A;  5CLL B;  1MPH A;  2DTC A;  5HE0 A;  4F7H A;  1MIX A;  1WVH A;  2YVC A;  3A98 B;  4YON A;  1GC6 A;  2Q13 A;  1KI1 B;  2HE7 A;  2IFS A;  1WG7 A;  1U2B A;  1DBH A;  4D6W A;  1FHX A;  2NMB A;  5M4Y B;  2VRW B;  2K00 A;  2COD A;  1OY2 A;  2IYB A;  1XR0 B;  1DDV A;  1AQC A;  2LUL A;  2YF0 A;  4QJ4 B;  1I7A A;  1P6S A;  1SGH A;  4QXA B;  2X18 A;  1ZSQ A;  4MY6 A;  2COC A;  3ZVR A;  2D9Z A;  2RRF A;  3D8D A;  2KIE A;  3GYP A;  3DXE A;  1FOE A;  1V5U A;  2Y7B A;  2W2X C;  2K8E A;  3SNH A;  3AU5 A;  1V61 A;  2YSZ A;  2ROZ B;  1X11 A;  2I5C A;  3AJ4 A;  2Z14 A;  4CYE A;  4WVF B;  2Z4D A;  1QQG A;  4GN1 A;  4HAY B;  4GPT B;  2VKI A;  4KHB A;  5DHF B;  3AU4 A;  2D9Y A;  4GMV A;  2K49 A;  4HAV B;  1U5F A;  1V88 A;  2NZ8 B;  3FVC A;  1K5G B;  2YS1 A;  1FAO A;  3O96 A;  1EVH A;  2GCL A;  1BWN A;  4WSF A;  5LG4 B;  3P6A A;  2D9X A;  2ZPY A;  4D0N B;  4Z2M B;  3PG7 A;  3ULC A;  2DHK A;  2AL6 A;  1U5D A;  2EC1 A;  2JP2 A;  4HB4 B;  4HSI A;  2CAY A;  3PSC A;  3NWA A;  3U8Z A;  4DX9 0;  4H8S A;  4F7G A;  2MKR A;  4C0A A;  4KHB B;  3F0W A;  3HQC A;  4XWX A;  1T77 A;  2ELA A;  3DCX A;  5IRS A;  3B77 A;  2AEH A;  2YS5 A;  5J3Q A;  4QJ3 B;  1DRO A;  2QKM A;  2N0Y A;  3IVF A;  3ODO A;  1FGZ A;  1XCG A;  3TCA A;  2DN6 A;  1OMW A;  1W1H A;  2GJY A;  2P8V A;  3SUZ A;  3X23 A;  2LOX A;  2HTH B;  1TQZ A;  2DKP A;  4NSW A;  1FHW A;  2KUQ A;  1FHO A;  2KIG A;  1UPQ A;  1SHC A;  4BBK A;  4EJN A;  3ODX A;  2H7D A;  2I5F A;  1GG3 A;  1BTK A;  2Y8F A;  4HB0 B;  3FEH A;  4A6K A;  1W1D A;  2DX5 A;  5LON B;  2CRF A;  4DX8 A;  3HIE A;  2Z0Q A;  3NWD A;  4HAW B;  4DBB A;  1DDM A;  5EFX A;  3V5W A;  2KR0 A;  3T06 A;  2J0J A;  2R2Y A;  5KQ1 A;  1EGX A;  2RNR B;  1X1G A;  3OHM B;  2ROV A;  1I2H A;  5C16 A;  1P3R A;  4PQ0 A;  1EAZ A;  2V76 A;  3NW8 A;  3WYF B;  4CHJ A;  5KQ4 A;  2DX1 A;  3KZ1 A;  4K17 A;  4YL8 A;  1FB8 A;  1B55 A;  4HAZ B;  4EMO A;  3D8F A;  1PMS A;  1XOD A;  2UZR A;  4MT7 A;  3SO6 A;  2LG1 A;  1J19 A;  2Z13 A;  3OAN A;  1GC7 A;  4CSQ A;  2DA0 A;  5C6R A;  1ZYI A;  5C5B A;  2UZS A;  3A58 A;  2LOZ A;  1NI2 A;  3F5R A;  2P0D A;  1Y19 B;  4P7I A;  3KY9 A;  1Q67 A;  3BIN A;  5HE1 A;  1BTN A;  4IFS A;  2Y8G A;  3PVL A;  2K2J A;  5I2S A;  1E5W A;  1NTV A;  4KHO A;  1QC6 A;  2COF A;  3TW1 A;  1X05 A;  1WJ1 A;  2K2U A;  3KRX A;  1XKE A;  5DHA B;  1M7R A;  4L6E A;  4Z2N A;  2DHI A;  5C5B B;  4GMX B;  1P5T A;  3U12 A;  4K2P A;  4L1R A;  5D3W A;  3PEG A;  5J3Y A;  1PLS A;  4KAX B;  4TKN A;  5C79 A;  2VSZ A;  3MDB C;  1IRS A;  3LJU X;  1V89 A;  4A6F A;  3BJI A;  4HAU B;  4DIX A;  3TO1 A;  2ADZ A;  2DLW A;  3G9W A;  5DH9 B;  4MK0 A;  4HB2 B;  1DDW A;  1EF1 A;  1U29 A;  2EMS A;  2FJL A;  2YRY A;  2OQB A;  1Y5O A;  2YT0 A;  2J0M A;  5HE3 A;  3P7Z A;  1DYN A;  2Z59 A;  4A6F B;  1H4R A;  3N7C A;  2H7E A;  3SYX A;  4B6H A;  2MWN B;  2J0K A;  2DYQ A;  2XQN M;  3FM8 C;  3A8Q A;  3HW2 B;  4ZRK A;  2D10 A;  4K2O A;  4GXB A;  2DHJ A;  1H10 A;  2ELB A;  1AWE A;  3CXB B;  1WGU A;  4EKU A;  1XD4 A;  1ZC3 B;  2RLO A;  1KZG A;  2PZ1 A;  1U27 A;  3KRW A;  5JHG A;  2GCJ A;  2M14 A;  2YT2 A;  4TYZ A;  3UZT A;  5FI0 A;  2N23 A;  3TVV A;  1PFJ A;  5KCV A;  2D9V A;  1V5P A;  2KCJ A;  2L1C A;  1RJ2 A;  2W2W A;  2D4Q A;  2MDX A;  5L81 A;  3HK0 A;  4HB3 B;  1J0W A;  4A6H A;  1RRP B;  4HDO A;  2BCJ A;  4OT1 A;  4ZRJ A;  4QJ5 B;  3ULB A;  3RCP A;  4HAT B;  2DKQ A;  2CY4 A;  3A8P A;  3U7D A;  3NSU A;  4HAX B;  4KVG B;  3ML4 A;  1MI1 A;  2W2X D;  1N3H A;  5JLJ B;  2RGN B;  2R0D A;  1V5M A;  1ZC4 B;  2G35 A;  4IOY X;  2MFQ A;  3TFM A;  2OTX A;  5LOP B;  1OQN A;  1UEF A;  4GOU A;  1UNR A;  1X86 A;  1UNP A;  1X1F A;  2GUM A;  3FSS A;  3ODW A;  5D3V A;  3CIK A;  4ZRI A;  3VIA A;  4IAP A;  4F7U P;  3SV1 A;  1NU2 A;  1Z87 A;  2M38 A;  2LKO A;  2DFK A;  1K5D B;  1KZ7 A;  3MPX A;  1TXD A;  1WI1 A;  4K81 A;  3WA0 A;  3GYO A;  3PVU A;  5D3X A;  1LB1 A;  4KHA A;  2L2I A;  2P0F A;  5DIF B;  2D9W A;  2J59 M;  2QKL A;  1W1G A;  4HDQ A;  4A5K A;  2DYN A;  1MIZ B;  3DXD A;  3QIJ A;  1UNQ A;  2LYD A;  3QBV B;  1WGQ A;  1UPR A;  4Y94 A;  1ISN A;  2I1K A;  1WJM A;  1XX0 A;  4WJ7 A;  4PNK A;  1NTY A;  2RUK B;  5I2M A;  2Z0P A;  3QWM A;  2I1J A;  3ZDT A;  5DI9 B;  2KUP A;  2YS3 A;  2RSG A;  2RVB B;  5GOW B;  4GNK B;  5D27 A;  4OSN A;  2KGX B;  5CLQ B;  5D3Y A;  2D11 A;  2E2X A;  4CHM A;  2D2Q A;  3PVW A;  3M1I B;  2GS0 A;  2FJU B;  4DXA B;  4NY0 A;  2R09 A; 
#chains in the Genus database with same CATH homology
 3KSY A;  1MAI A;  5HE2 A;  5FI1 A;  1ZM0 A;  2EMT A;  2Z0O A;  1U5G A;  1MK9 B;  5JP4 A;  3VOQ A;  1MK7 B;  2YT1 A;  1MKE A;  5J3T A;  1BAK A;  3PP2 A;  1ZVR A;  2CY5 A;  2P0H A;  4GZU A;  1FGY A;  2COA A;  1U5E A;  4HHV A;  3PZD A;  2UVM A;  1M7E A;  2EJ8 A;  3D8E A;  3DXC A;  1LW3 A;  1TJ6 A;  5JHH A;  5CLL B;  1MPH A;  2DTC A;  5HE0 A;  4F7H A;  1MIX A;  1WVH A;  2YVC A;  3A98 B;  4YON A;  1GC6 A;  2Q13 A;  1KI1 B;  2HE7 A;  2IFS A;  1WG7 A;  1U2B A;  1DBH A;  1FHX A;  2NMB A;  2VRW B;  2K00 A;  2COD A;  1OY2 A;  2IYB A;  1XR0 B;  1DDV A;  1AQC A;  2LUL A;  2YF0 A;  1I7A A;  1P6S A;  1SGH A;  2X18 A;  1ZSQ A;  4MY6 A;  2COC A;  3ZVR A;  2D9Z A;  3D8D A;  3GYP A;  3DXE A;  1FOE A;  1V5U A;  2Y7B A;  2W2X C;  3SNH A;  3AU5 A;  1V61 A;  2YSZ A;  2ROZ B;  1X11 A;  2I5C A;  3AJ4 A;  4CYE A;  4WVF B;  1QQG A;  4GN1 A;  4HAY B;  4GPT B;  2VKI A;  5DHF B;  3AU4 A;  2D9Y A;  4GMV A;  4HAV B;  1U5F A;  1V88 A;  2NZ8 B;  1K5G B;  2YS1 A;  1FAO A;  3O96 A;  1EVH A;  2GCL A;  1BWN A;  4WSF A;  3P6A A;  2D9X A;  2ZPY A;  4D0N B;  4Z2M B;  3PG7 A;  3ULC A;  2DHK A;  2AL6 A;  1U5D A;  2EC1 A;  2JP2 A;  4HB4 B;  2CAY A;  3PSC A;  3U8Z A;  4DX9 0;  4H8S A;  4F7G A;  2MKR A;  4C0A A;  4KHB B;  3F0W A;  3HQC A;  4XWX A;  2ELA A;  2AEH A;  2YS5 A;  5J3Q A;  1DRO A;  2QKM A;  2N0Y A;  3IVF A;  3ODO A;  1FGZ A;  1XCG A;  3TCA A;  2DN6 A;  1OMW A;  1W1H A;  2GJY A;  2P8V A;  3SUZ A;  3X23 A;  2LOX A;  2HTH B;  1TQZ A;  2DKP A;  4NSW A;  1FHW A;  1FHO A;  1UPQ A;  1SHC A;  4BBK A;  4EJN A;  3ODX A;  2H7D A;  2I5F A;  1GG3 A;  1BTK A;  2Y8F A;  4HB0 B;  3FEH A;  4A6K A;  1W1D A;  2DX5 A;  5LON B;  2CRF A;  4DX8 A;  2Z0Q A;  1DDM A;  4HAW B;  4DBB A;  5EFX A;  3V5W A;  3T06 A;  2J0J A;  5KQ1 A;  1EGX A;  2RNR B;  1X1G A;  2ROV A;  1I2H A;  5C16 A;  1P3R A;  4PQ0 A;  1EAZ A;  2V76 A;  3WYF B;  4CHJ A;  5KQ4 A;  2DX1 A;  3KZ1 A;  4K17 A;  4YL8 A;  1FB8 A;  1B55 A;  4HAZ B;  4EMO A;  3D8F A;  1PMS A;  1XOD A;  2UZR A;  4MT7 A;  3SO6 A;  2LG1 A;  1J19 A;  3OAN A;  1GC7 A;  2DA0 A;  5C6R A;  5C5B A;  2UZS A;  2LOZ A;  1NI2 A;  3F5R A;  2P0D A;  1Y19 B;  4P7I A;  3KY9 A;  1Q67 A;  3BIN A;  5HE1 A;  1BTN A;  4IFS A;  2Y8G A;  3PVL A;  2K2J A;  1E5W A;  1NTV A;  4KHO A;  1QC6 A;  2COF A;  3TW1 A;  1X05 A;  1WJ1 A;  2K2U A;  3KRX A;  1XKE A;  5DHA B;  1M7R A;  4L6E A;  4Z2N A;  2DHI A;  5C5B B;  4GMX B;  1P5T A;  4K2P A;  5D3W A;  3PEG A;  5J3Y A;  1PLS A;  4KAX B;  4TKN A;  5C79 A;  2VSZ A;  3MDB C;  1IRS A;  3LJU X;  1V89 A;  4A6F A;  3BJI A;  4HAU B;  3TO1 A;  2ADZ A;  2DLW A;  3G9W A;  5DH9 B;  4MK0 A;  4HB2 B;  1DDW A;  1EF1 A;  1U29 A;  2EMS A;  2FJL A;  2YRY A;  2OQB A;  1Y5O A;  2YT0 A;  2J0M A;  5HE3 A;  3P7Z A;  1DYN A;  4A6F B;  1H4R A;  3N7C A;  2H7E A;  3SYX A;  4B6H A;  2MWN B;  2J0K A;  2DYQ A;  2XQN M;  3FM8 C;  3A8Q A;  3HW2 B;  4ZRK A;  2D10 A;  4K2O A;  4GXB A;  2DHJ A;  1H10 A;  2ELB A;  1AWE A;  3CXB B;  1WGU A;  4EKU A;  1XD4 A;  1ZC3 B;  2RLO A;  1KZG A;  2PZ1 A;  3KRW A;  1U27 A;  5JHG A;  2GCJ A;  2M14 A;  4TYZ A;  3UZT A;  5FI0 A;  2N23 A;  3TVV A;  1PFJ A;  5KCV A;  2D9V A;  1V5P A;  2KCJ A;  2L1C A;  1RJ2 A;  2W2W A;  2D4Q A;  2MDX A;  5L81 A;  3HK0 A;  4HB3 B;  1J0W A;  4A6H A;  1RRP B;  4HDO A;  2BCJ A;  4ZRJ A;  3ULB A;  3RCP A;  4HAT B;  2DKQ A;  2CY4 A;  3A8P A;  3U7D A;  3NSU A;  4HAX B;  4KVG B;  3ML4 A;  2W2X D;  1N3H A;  5JLJ B;  2RGN B;  2R0D A;  1V5M A;  1ZC4 B;  2G35 A;  4IOY X;  2MFQ A;  3TFM A;  2OTX A;  5LOP B;  1OQN A;  1UEF A;  1UNR A;  1X86 A;  1UNP A;  1X1F A;  3FSS A;  3ODW A;  5D3V A;  3CIK A;  4ZRI A;  3VIA A;  4IAP A;  4F7U P;  3SV1 A;  1NU2 A;  1Z87 A;  2M38 A;  2LKO A;  2DFK A;  1K5D B;  1KZ7 A;  3MPX A;  1TXD A;  1WI1 A;  4K81 A;  3WA0 A;  3GYO A;  3PVU A;  5D3X A;  1LB1 A;  4KHA A;  2L2I A;  2P0F A;  5DIF B;  2D9W A;  2J59 M;  2QKL A;  1W1G A;  4HDQ A;  4A5K A;  2DYN A;  1MIZ B;  3DXD A;  3QIJ A;  1UNQ A;  2LYD A;  3QBV B;  1WGQ A;  1UPR A;  4Y94 A;  1ISN A;  2I1K A;  1WJM A;  1XX0 A;  4WJ7 A;  4PNK A;  1NTY A;  2RUK B;  2Z0P A;  3QWM A;  2I1J A;  3ZDT A;  5DI9 B;  2KUP A;  2YS3 A;  2RSG A;  2RVB B;  5GOW B;  5D27 A;  2KGX B;  5CLQ B;  5D3Y A;  2D11 A;  2E2X A;  4CHM A;  2D2Q A;  3PVW A;  3M1I B;  2GS0 A;  4DXA B;  4NY0 A;  2R09 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...