1XKEA

Solution structure of the second ran-binding domain from human ranbp2
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
130
structure length
130
Chain Sequence
GSGEEDEKVLYSQRVKLFRFDAEVSQWKERGLGNLKILKNEVNGKLRMLMRREQVLKVCANHWITTTMNLKPLSGSDRAWMWLASDFSDGDAKLEQLAAKFKTPELAEEFKQKFEECQRLLLDIPLQTPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ran-binding protein 2
publication title Solution structure of the Ran-binding domain 2 of RanBP2 and its interaction with the C terminus of Ran.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 32
structure length 130
sequence length 130
ec nomenclature
pdb deposition date 2004-09-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1xkeA00
4HDOA 2G35A 4KVGB 4F7GA 3O96A 4MY6A 3RCPA 2M14A 5C79A 3D8EA 4H8SA 2GJYA 3DXCA 4GXBA 1TQZA 4MT7A 2ZPYA 3PVWA 4KHOA 1K5GB 1X1FA 2P0DA 1XODA 3PG7A 1OMWA 2QKMA 5C16A 2Z0PA 1V89A 1WJ1A 3MPXA 3GYPA 5J3QA 5D3VA 1B55A 5CLQB 2RLOA 2VKIA 2M38A 2ADZA 2Y8GA 3SYXA 2NMBA 3TW1A 2DHIA 5J3TA 1DDWA 1U2BA 4WVFB 4HAUB 5KQ1A 2YRYA 1MKEA 2K2UA 1ZSQA 1I2HA 1Y19B 3PSCA 3QBVB 3AU4A 2D9VA 1FHWA 2MDXA 4YL8A 4IOYX 2RVBB 1M7EA 3ZDTA 1XD4A 2DX1A 2QKLA 4HAWB 1GG3A 2Y7BA 2ROZB 4DBBA 1MK9B 4A6KA 1UPQA 2AL6A 1EVHA 1W1GA 2HTHB 4Z2NA 3CXBB 1U27A 5FI1A 1EAZA 2YS5A 4K17A 4EKUA 4GPTB 2I5FA 4C0AA 4Z2MB 1UNQA 2HE7A 3VOQA 2Q13A 1DROA 1NU2A 2DYNA 2W2XC 4MK0A 1FAOA 1NI2A 5L81A 5D3YA 1AWEA 4WJ7A 2I5CA 2YF0A 5KQ4A 1FHXA 5JHGA 1Q67A 4TKNA 1V88A 1V5MA 3F5RA 3ODWA 5HE3A 5DHFB 4B6HA 3ZVRA 4CYEA 2D11A 4D0NB 2CY4A 1Z87A 1UNPA 1RRPB 2IFSA 5D27A 1DDMA 1SGHA 2VSZA 4DXAB 5J3YA 2D9ZA 2UZRA 1P6SA 2ELAA 5JHHA 4L6EA 5LONB 4HB3B 4CHJA 4A5KA 2AEHA 4HAZB 1BAKA 1PFJA 1OY2A 2JP2A 2R09A 2YSZA 2IYBA 5DIFB 5CLLB 4A6HA 3IVFA 5D3WA 4HHVA 4KHBB 4HB4B 4KAXB 2YT0A 4DX90 2DFKA 4GZUA 1U5GA 3LJUX 1Y5OA 1WJMA 3U8ZA 1X86A 2CY5A 2RNRB 3BINA 4YONA 1W1DA 1DYNA 3MDBC 4EMOA 1DBHA 1BTNA 2J0JA 1MPHA 4A6FA 2OTXA 2KUPA 1LB1A 1FGZA 4IAPA 4P7IA 3KRXA 3SV1A 3N7CA 3TFMA 1J0WA 2RGNB 3A8PA 2LKOA 2DA0A 1P3RA 2COAA 1ISNA 2MWNB 1U5FA 1ZC4B 3AJ4A 1FOEA 4ZRKA 3BJIA 2N23A 2L1CA 3KRWA 4GMVA 3QWMA 1MIZB 2EC1A 1MK7B 5DHAB 2ELBA 3KY9A 3V5WA 2OQBA 1XX0A 2D2QA 5JP4A 1U5EA 2YVCA 3X23A 4XWXA 1X05A 1WVHA 3QIJA 2DHKA 2LOXA 2P8VA 3DXDA 3UZTA 3WA0A 1WI1A 1FB8A 1KZ7A 3ODXA 2MFQA 1V5UA 4HATB 3ULBA 1V61A 2DTCA 3G9WA 4HB2B 4CHMA 1U29A 4HAXB 1NTVA 4ZRIA 1GC7A 2UVMA 4EJNA 1TJ6A 5HE0A 3GYOA 5KCVA 2L2IA 1OQNA 3PVUA 2I1JA 1QC6A 2VRWB 3AU5A 3NSUA 3U7DA 5FI0A 2UZSA 3HQCA 4IFSA 1AQCA 2NZ8B 5DH9B 2LOZA 1UEFA 1WGUA 5C6RA 3WYFB 5C5BA 2CRFA 2YS1A 2DLWA 1N3HA 2Y8FA 3D8FA 1EGXA 3ODOA 3ULCA 4HDQA 5GOWB 3CIKA 4DX8A 1GC6A 4Y94A 3KZ1A 4GMXB 1KI1B 2FJLA 2E2XA 2RSGA 2LULA 4TYZA 2COFA 1UNRA 4HAVB 4NSWA 3TCAA 2XQNM 3M1IB 2GCLA 2DYQA 2DKPA 2V76A 4K2PA 4K81A 2DHJA 2H7DA 1IRSA 1MIXA 2K2JA 2KCJA 2W2XD 1TXDA 4F7HA 3ML4A 4PNKA 3SUZA 3TO1A 2LYDA 1ZC3B 1K5DB 3VIAA 2EJ8A 1V5PA 1H10A 2YT1A 3TVVA 3PZDA 3A98B 3PVLA 2CAYA 4F7UP 1W1HA 1J19A 5D3XA 2J0KA 1I7AA 4NY0A 1LW3A 2KGXB 4HB0B 3SNHA 1M7RA 4K2OA 2D9YA 5C5BB 2RUKB 3FSSA 2W2WA 3FM8C 2P0HA 2Z0OA 2BCJA 3FEHA 2DKQA 1U5DA 1RJ2A 2Z0QA 4HAYB 4GN1A 2YS3A 4KHAA 1BWNA 2D9WA 1MAIA 1WG7A 1XCGA 1E5WA 1NTYA 2GCJA 2CODA 1SHCA 1BTKA 2N0YA 4BBKA 4PQ0A 4WSFA 2LG1A 5EFXA 1H4RA 2ROVA 3HW2B 1KZGA 3F0WA 2D10A 3DXEA 1P5TA 3P6AA 5LOPB 2COCA 5HE2A 1ZVRA 4A6FB 3T06A 1WGQA 2K00A 2J0MA 1FGYA 2I1KA 2H7EA 1DDVA 4ZRJA 3P7ZA 2EMTA 3OANA 5DI9B 1X1GA 2R0DA 1X11A 5JLJB 2GS0A 1XR0B 3PP2A 2J59M 2EMSA 2MKRA 1EF1A 1ZM0A 2D4QA 2DN6A 1FHOA 2PZ1A 2DX5A 1PLSA 3A8QA 2P0FA 3KSYA 3PEGA 3HK0A 1PMSA 3SO6A 2D9XA 2X18A 1UPRA 5HE1A 1QQGA 3D8DA 1XKEA
chains in the Genus database with same CATH superfamily
4HDOA 2G35A 4KVGB 4F7GA 3HSAA 3O96A 2Z59A 4MY6A 3RCPA 2M14A 5C79A 3D8EA 4H8SA 2GJYA 3DXCA 4GXBA 1TQZA 4MT7A 2ZPYA 3PVWA 4KHOA 1K5GB 1X1FA 4CSQA 2P0DA 1XODA 3PG7A 1OMWA 2QKMA 5C16A 2NBVA 2Z0PA 3U12A 2ZKMX 1V89A 1WJ1A 3MPXA 3GYPA 5J3QA 5D3VA 2KIEA 1B55A 5CLQB 2RLOA 2VKIA 2K8EA 2M38A 2ADZA 2Y8GA 3SYXA 2NMBA 3TW1A 2DHIA 5J3TA 1DDWA 1U2BA 4WVFB 4HAUB 5KQ1A 2YRYA 1MKEA 2K2UA 1ZSQA 1I2HA 1Y19B 3PSCA 3QBVB 3AU4A 2D9VA 1FHWA 2MDXA 4YL8A 4IOYX 2RVBB 1M7EA 3ZDTA 1XD4A 2DX1A 2QKLA 4HAWB 1GG3A 2Y7BA 2ROZB 4DBBA 1MK9B 4A6KA 1UPQA 2AL6A 1EVHA 1W1GA 2HTHB 4Z2NA 3CXBB 1U27A 5FI1A 1EAZA 2YS5A 4K17A 4EKUA 4GPTB 2I5FA 4C0AA 4Z2MB 4KHBA 2R2YA 1UNQA 2HE7A 3VOQA 2Q13A 5I2MA 1DROA 1NU2A 2DYNA 2W2XC 3A58A 4MK0A 1FAOA 1NI2A 5L81A 5D3YA 1AWEA 4WJ7A 2I5CA 2YF0A 5KQ4A 3OHMB 1FHXA 5JHGA 1Q67A 4TKNA 1V88A 1V5MA 3F5RA 2KUQA 3ODWA 5HE3A 5DHFB 4B6HA 3ZVRA 3HIEA 4CYEA 2D11A 4D0NB 2CY4A 1ZYIA 1Z87A 1UNPA 1RRPB 2IFSA 5D27A 1DDMA 1SGHA 2VSZA 4DXAB 5J3YA 2D9ZA 2UZRA 1P6SA 3B77A 2ELAA 5JHHA 4L6EA 5LONB 4HB3B 4CHJA 4A5KA 2AEHA 4HAZB 1BAKA 1PFJA 1OY2A 2JP2A 2R09A 2YSZA 2IYBA 5DIFB 5CLLB 3NWAA 4A6HA 3IVFA 5D3WA 4HHVA 4KHBB 4HB4B 4KAXB 2YT0A 4DX90 2DFKA 4GZUA 1U5GA 3LJUX 1Y5OA 1WJMA 3U8ZA 1X86A 2CY5A 2FJUB 2RNRB 3BINA 4YONA 1W1DA 1DYNA 3MDBC 4EMOA 1DBHA 1BTNA 2J0JA 1MPHA 4A6FA 2OTXA 2KUPA 1LB1A 1FGZA 4IAPA 4P7IA 4QJ4B 3KRXA 3SV1A 3N7CA 3TFMA 1J0WA 2RGNB 3A8PA 2K49A 2LKOA 2DA0A 1P3RA 2COAA 1ISNA 2MWNB 1U5FA 3AJ4A 1ZC4B 1FOEA 3NWFA 4ZRKA 3BJIA 2N23A 4D6WA 2L1CA 3KRWA 4GMVA 3QWMA 1MIZB 2EC1A 1MK7B 5DHAB 2ELBA 3KY9A 3V5WA 2OQBA 1XX0A 2D2QA 5JP4A 1U5EA 2YVCA 4DIXA 3X23A 4XWXA 2GUMA 1X05A 1WVHA 3QIJA 2DHKA 2LOXA 2P8VA 4HSIA 3DXDA 4QJ5B 3UZTA 2Z4DA 3WA0A 1WI1A 1FB8A 1KZ7A 3ODXA 2MFQA 2KR0A 1V5UA 3NW8A 4HATB 3ULBA 1V61A 2DTCA 3G9WA 4HB2B 4CHMA 1U29A 4HAXB 1NTVA 4ZRIA 1GC7A 2UVMA 4EJNA 1TJ6A 5HE0A 2Z13A 3GYOA 5KCVA 2L2IA 4GNKB 1OQNA 3PVUA 2I1JA 1QC6A 2VRWB 1MI1A 3AU5A 3NSUA 3U7DA 5FI0A 2UZSA 3HQCA 4IFSA 1AQCA 2NZ8B 5DH9B 2LOZA 1UEFA 1WGUA 5C6RA 3WYFB 5C5BA 2CRFA 2YS1A 2DLWA 1N3HA 2Y8FA 3D8FA 3NWDA 3ODOA 3ULCA 1EGXA 4OSNA 4HDQA 5GOWB 3CIKA 1T77A 4DX8A 1GC6A 4Y94A 3KZ1A 4GMXB 5M4YB 1KI1B 2FJLA 2E2XA 2RSGA 2LULA 4TYZA 2COFA 1UNRA 4HAVB 4NSWA 3TCAA 2XQNM 3M1IB 4GOUA 2Z14A 2GCLA 2DYQA 2DKPA 2V76A 4K2PA 4K81A 2DHJA 2H7DA 1IRSA 1MIXA 2K2JA 2KCJA 2W2XD 1TXDA 4F7HA 3ML4A 4PNKA 3SUZA 3TO1A 2LYDA 1ZC3B 1K5DB 2YT2A 3VIAA 2EJ8A 1V5PA 1H10A 2YT1A 3TVVA 3PZDA 3A98B 3PVLA 2CAYA 4F7UP 1W1HA 2KIGA 1J19A 5D3XA 2J0KA 1I7AA 5I2SA 3DCXA 4NY0A 1LW3A 2KGXB 4HB0B 3SNHA 1M7RA 4K2OA 2D9YA 5C5BB 2RUKB 3FSSA 2W2WA 3FM8C 2P0HA 2Z0OA 2BCJA 3FEHA 2DKQA 1U5DA 1RJ2A 2Z0QA 4HAYB 4GN1A 2YS3A 4KHAA 1BWNA 2D9WA 1MAIA 1WG7A 1XCGA 1E5WA 1NTYA 2GCJA 2CODA 1SHCA 1BTKA 2N0YA 4BBKA 4PQ0A 3FVCA 2LG1A 4WSFA 5EFXA 1H4RA 5IRSA 2ROVA 3HW2B 1KZGA 3F0WA 2D10A 3DXEA 1P5TA 4L1RA 3P6AA 4QJ3B 5LOPB 2COCA 5HE2A 1ZVRA 2RRFA 4OT1A 4A6FB 3T06A 1WGQA 2K00A 2J0MA 1FGYA 2I1KA 2H7EA 1DDVA 4ZRJA 3P7ZA 2EMTA 3OANA 5LG4B 5DI9B 1X1GA 2R0DA 1X11A 5JLJB 2GS0A 1XR0B 3PP2A 2J59M 2EMSA 2MKRA 1EF1A 1ZM0A 2D4QA 2DN6A 1FHOA 2PZ1A 2DX5A 1PLSA 3A8QA 2P0FA 3KSYA 3PEGA 3HK0A 4QXAB 1PMSA 3SO6A 2D9XA 2X18A 1UPRA 5HE1A 1QQGA 3D8DA 1XKEA
chains in the Genus database with same CATH topology
4HDOA 2G35A 4KVGB 4F7GA 3O96A 4MY6A 3RCPA 2M14A 5C79A 3D8EA 4H8SA 2GJYA 3DXCA 4GXBA 1TQZA 4MT7A 2ZPYA 3PVWA 4KHOA 1K5GB 1X1FA 2P0DA 1XODA 3PG7A 1OMWA 2QKMA 5C16A 2Z0PA 1V89A 1WJ1A 3MPXA 3GYPA 5J3QA 5D3VA 1B55A 5CLQB 2RLOA 2VKIA 2M38A 2ADZA 2Y8GA 3SYXA 2NMBA 3TW1A 2DHIA 5J3TA 1DDWA 1U2BA 4WVFB 4HAUB 5KQ1A 2YRYA 1MKEA 2K2UA 1ZSQA 1I2HA 1Y19B 3PSCA 3QBVB 3AU4A 2D9VA 1FHWA 2MDXA 4YL8A 4IOYX 2RVBB 1M7EA 3ZDTA 1XD4A 2DX1A 2QKLA 4HAWB 1GG3A 2Y7BA 2ROZB 4DBBA 1MK9B 4A6KA 1UPQA 2AL6A 1EVHA 1W1GA 2HTHB 4Z2NA 3CXBB 1U27A 5FI1A 1EAZA 2YS5A 4K17A 4EKUA 4GPTB 2I5FA 4C0AA 4Z2MB 1UNQA 2HE7A 3VOQA 2Q13A 1DROA 1NU2A 2DYNA 2W2XC 4MK0A 1FAOA 1NI2A 5L81A 5D3YA 1AWEA 4WJ7A 2I5CA 2YF0A 5KQ4A 1FHXA 5JHGA 1Q67A 4TKNA 1V88A 1V5MA 3F5RA 3ODWA 5HE3A 5DHFB 4B6HA 3ZVRA 4CYEA 2D11A 4D0NB 2CY4A 1Z87A 1UNPA 1RRPB 2IFSA 5D27A 1DDMA 1SGHA 2VSZA 4DXAB 5J3YA 2D9ZA 2UZRA 1P6SA 2ELAA 5JHHA 4L6EA 5LONB 4HB3B 4CHJA 4A5KA 2AEHA 4HAZB 1BAKA 1PFJA 1OY2A 2JP2A 2R09A 2YSZA 2IYBA 5DIFB 5CLLB 4A6HA 3IVFA 5D3WA 4HHVA 4KHBB 4HB4B 4KAXB 2YT0A 4DX90 2DFKA 4GZUA 1U5GA 3LJUX 1Y5OA 1WJMA 3U8ZA 1X86A 2CY5A 2RNRB 3BINA 4YONA 1W1DA 1DYNA 3MDBC 4EMOA 1DBHA 1BTNA 2J0JA 1MPHA 4A6FA 2OTXA 2KUPA 1LB1A 1FGZA 4IAPA 4P7IA 3KRXA 3SV1A 3N7CA 3TFMA 1J0WA 2RGNB 3A8PA 2LKOA 2DA0A 1P3RA 2COAA 1ISNA 2MWNB 1U5FA 1ZC4B 3AJ4A 1FOEA 4ZRKA 3BJIA 2N23A 2L1CA 3KRWA 4GMVA 3QWMA 1MIZB 2EC1A 1MK7B 5DHAB 2ELBA 3KY9A 3V5WA 2OQBA 1XX0A 2D2QA 5JP4A 1U5EA 2YVCA 3X23A 4XWXA 1X05A 1WVHA 3QIJA 2DHKA 2LOXA 2P8VA 3DXDA 3UZTA 3WA0A 1WI1A 1FB8A 1KZ7A 3ODXA 2MFQA 1V5UA 4HATB 3ULBA 1V61A 2DTCA 3G9WA 4HB2B 4CHMA 1U29A 4HAXB 1NTVA 4ZRIA 1GC7A 2UVMA 4EJNA 1TJ6A 5HE0A 3GYOA 5KCVA 2L2IA 1OQNA 3PVUA 2I1JA 1QC6A 2VRWB 3AU5A 3NSUA 3U7DA 5FI0A 2UZSA 3HQCA 4IFSA 1AQCA 2NZ8B 5DH9B 2LOZA 1UEFA 1WGUA 5C6RA 3WYFB 5C5BA 2CRFA 2YS1A 2DLWA 1N3HA 2Y8FA 3D8FA 1EGXA 3ODOA 3ULCA 4HDQA 5GOWB 3CIKA 4DX8A 1GC6A 4Y94A 3KZ1A 4GMXB 1KI1B 2FJLA 2E2XA 2RSGA 2LULA 4TYZA 2COFA 1UNRA 4HAVB 4NSWA 3TCAA 2XQNM 3M1IB 2GCLA 2DYQA 2DKPA 2V76A 4K2PA 4K81A 2DHJA 2H7DA 1IRSA 1MIXA 2K2JA 2KCJA 2W2XD 1TXDA 4F7HA 3ML4A 4PNKA 3SUZA 3TO1A 2LYDA 1ZC3B 1K5DB 3VIAA 2EJ8A 1V5PA 1H10A 2YT1A 3TVVA 3PZDA 3A98B 3PVLA 2CAYA 4F7UP 1W1HA 1J19A 5D3XA 2J0KA 1I7AA 4NY0A 1LW3A 2KGXB 4HB0B 3SNHA 1M7RA 4K2OA 2D9YA 5C5BB 2RUKB 3FSSA 2W2WA 3FM8C 2P0HA 2Z0OA 2BCJA 3FEHA 2DKQA 1U5DA 1RJ2A 2Z0QA 4HAYB 4GN1A 2YS3A 4KHAA 1BWNA 2D9WA 1MAIA 1WG7A 1XCGA 1E5WA 1NTYA 2GCJA 2CODA 1SHCA 1BTKA 2N0YA 4BBKA 4PQ0A 4WSFA 2LG1A 5EFXA 1H4RA 2ROVA 3HW2B 1KZGA 3F0WA 2D10A 3DXEA 1P5TA 3P6AA 5LOPB 2COCA 5HE2A 1ZVRA 4A6FB 3T06A 1WGQA 2K00A 2J0MA 1FGYA 2I1KA 2H7EA 1DDVA 4ZRJA 3P7ZA 2EMTA 3OANA 5DI9B 1X1GA 2R0DA 1X11A 5JLJB 2GS0A 1XR0B 3PP2A 2J59M 2EMSA 2MKRA 1EF1A 1ZM0A 2D4QA 2DN6A 1FHOA 2PZ1A 2DX5A 1PLSA 3A8QA 2P0FA 3KSYA 3PEGA 3HK0A 1PMSA 3SO6A 2D9XA 2X18A 1UPRA 5HE1A 1QQGA 3D8DA 1XKEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HDO A;  2G35 A;  4KVG B;  4F7G A;  3O96 A;  4MY6 A;  3RCP A;  2M14 A;  5C79 A;  3D8E A;  4H8S A;  2GJY A;  3DXC A;  4GXB A;  1TQZ A;  4MT7 A;  2ZPY A;  3PVW A;  4KHO A;  1K5G B;  1X1F A;  2P0D A;  1XOD A;  3PG7 A;  1OMW A;  2QKM A;  5C16 A;  2Z0P A;  1V89 A;  1WJ1 A;  3MPX A;  3GYP A;  5J3Q A;  5D3V A;  1B55 A;  5CLQ B;  2RLO A;  2VKI A;  2M38 A;  2ADZ A;  2Y8G A;  3SYX A;  2NMB A;  3TW1 A;  2DHI A;  5J3T A;  1DDW A;  1U2B A;  4WVF B;  4HAU B;  5KQ1 A;  2YRY A;  1MKE A;  2K2U A;  1ZSQ A;  1I2H A;  1Y19 B;  3PSC A;  3QBV B;  3AU4 A;  2D9V A;  1FHW A;  2MDX A;  4YL8 A;  4IOY X;  2RVB B;  1M7E A;  3ZDT A;  1XD4 A;  2DX1 A;  2QKL A;  4HAW B;  1GG3 A;  2Y7B A;  2ROZ B;  4DBB A;  1MK9 B;  4A6K A;  1UPQ A;  2AL6 A;  1EVH A;  1W1G A;  2HTH B;  4Z2N A;  3CXB B;  1U27 A;  5FI1 A;  1EAZ A;  2YS5 A;  4K17 A;  4EKU A;  4GPT B;  2I5F A;  4C0A A;  4Z2M B;  1UNQ A;  2HE7 A;  3VOQ A;  2Q13 A;  1DRO A;  1NU2 A;  2DYN A;  2W2X C;  4MK0 A;  1FAO A;  1NI2 A;  5L81 A;  5D3Y A;  1AWE A;  4WJ7 A;  2I5C A;  2YF0 A;  5KQ4 A;  1FHX A;  5JHG A;  1Q67 A;  4TKN A;  1V88 A;  1V5M A;  3F5R A;  3ODW A;  5HE3 A;  5DHF B;  4B6H A;  3ZVR A;  4CYE A;  2D11 A;  4D0N B;  2CY4 A;  1Z87 A;  1UNP A;  1RRP B;  2IFS A;  5D27 A;  1DDM A;  1SGH A;  2VSZ A;  4DXA B;  5J3Y A;  2D9Z A;  2UZR A;  1P6S A;  2ELA A;  5JHH A;  4L6E A;  5LON B;  4HB3 B;  4CHJ A;  4A5K A;  2AEH A;  4HAZ B;  1BAK A;  1PFJ A;  1OY2 A;  2JP2 A;  2R09 A;  2YSZ A;  2IYB A;  5DIF B;  5CLL B;  4A6H A;  3IVF A;  5D3W A;  4HHV A;  4KHB B;  4HB4 B;  4KAX B;  2YT0 A;  4DX9 0;  2DFK A;  4GZU A;  1U5G A;  3LJU X;  1Y5O A;  1WJM A;  3U8Z A;  1X86 A;  2CY5 A;  2RNR B;  3BIN A;  4YON A;  1W1D A;  1DYN A;  3MDB C;  4EMO A;  1DBH A;  1BTN A;  2J0J A;  1MPH A;  4A6F A;  2OTX A;  2KUP A;  1LB1 A;  1FGZ A;  4IAP A;  4P7I A;  3KRX A;  3SV1 A;  3N7C A;  3TFM A;  1J0W A;  2RGN B;  3A8P A;  2LKO A;  2DA0 A;  1P3R A;  2COA A;  1ISN A;  2MWN B;  1U5F A;  1ZC4 B;  3AJ4 A;  1FOE A;  4ZRK A;  3BJI A;  2N23 A;  2L1C A;  3KRW A;  4GMV A;  3QWM A;  1MIZ B;  2EC1 A;  1MK7 B;  5DHA B;  2ELB A;  3KY9 A;  3V5W A;  2OQB A;  1XX0 A;  2D2Q A;  5JP4 A;  1U5E A;  2YVC A;  3X23 A;  4XWX A;  1X05 A;  1WVH A;  3QIJ A;  2DHK A;  2LOX A;  2P8V A;  3DXD A;  3UZT A;  3WA0 A;  1WI1 A;  1FB8 A;  1KZ7 A;  3ODX A;  2MFQ A;  1V5U A;  4HAT B;  3ULB A;  1V61 A;  2DTC A;  3G9W A;  4HB2 B;  4CHM A;  1U29 A;  4HAX B;  1NTV A;  4ZRI A;  1GC7 A;  2UVM A;  4EJN A;  1TJ6 A;  5HE0 A;  3GYO A;  5KCV A;  2L2I A;  1OQN A;  3PVU A;  2I1J A;  1QC6 A;  2VRW B;  3AU5 A;  3NSU A;  3U7D A;  5FI0 A;  2UZS A;  3HQC A;  4IFS A;  1AQC A;  2NZ8 B;  5DH9 B;  2LOZ A;  1UEF A;  1WGU A;  5C6R A;  3WYF B;  5C5B A;  2CRF A;  2YS1 A;  2DLW A;  1N3H A;  2Y8F A;  3D8F A;  1EGX A;  3ODO A;  3ULC A;  4HDQ A;  5GOW B;  3CIK A;  4DX8 A;  1GC6 A;  4Y94 A;  3KZ1 A;  4GMX B;  1KI1 B;  2FJL A;  2E2X A;  2RSG A;  2LUL A;  4TYZ A;  2COF A;  1UNR A;  4HAV B;  4NSW A;  3TCA A;  2XQN M;  3M1I B;  2GCL A;  2DYQ A;  2DKP A;  2V76 A;  4K2P A;  4K81 A;  2DHJ A;  2H7D A;  1IRS A;  1MIX A;  2K2J A;  2KCJ A;  2W2X D;  1TXD A;  4F7H A;  3ML4 A;  4PNK A;  3SUZ A;  3TO1 A;  2LYD A;  1ZC3 B;  1K5D B;  3VIA A;  2EJ8 A;  1V5P A;  1H10 A;  2YT1 A;  3TVV A;  3PZD A;  3A98 B;  3PVL A;  2CAY A;  4F7U P;  1W1H A;  1J19 A;  5D3X A;  2J0K A;  1I7A A;  4NY0 A;  1LW3 A;  2KGX B;  4HB0 B;  3SNH A;  1M7R A;  4K2O A;  2D9Y A;  5C5B B;  2RUK B;  3FSS A;  2W2W A;  3FM8 C;  2P0H A;  2Z0O A;  2BCJ A;  3FEH A;  2DKQ A;  1U5D A;  1RJ2 A;  2Z0Q A;  4HAY B;  4GN1 A;  2YS3 A;  4KHA A;  1BWN A;  2D9W A;  1MAI A;  1WG7 A;  1XCG A;  1E5W A;  1NTY A;  2GCJ A;  2COD A;  1SHC A;  1BTK A;  2N0Y A;  4BBK A;  4PQ0 A;  4WSF A;  2LG1 A;  5EFX A;  1H4R A;  2ROV A;  3HW2 B;  1KZG A;  3F0W A;  2D10 A;  3DXE A;  1P5T A;  3P6A A;  5LOP B;  2COC A;  5HE2 A;  1ZVR A;  4A6F B;  3T06 A;  1WGQ A;  2K00 A;  2J0M A;  1FGY A;  2I1K A;  2H7E A;  1DDV A;  4ZRJ A;  3P7Z A;  2EMT A;  3OAN A;  5DI9 B;  1X1G A;  2R0D A;  1X11 A;  5JLJ B;  2GS0 A;  1XR0 B;  3PP2 A;  2J59 M;  2EMS A;  2MKR A;  1EF1 A;  1ZM0 A;  2D4Q A;  2DN6 A;  1FHO A;  2PZ1 A;  2DX5 A;  1PLS A;  3A8Q A;  2P0F A;  3KSY A;  3PEG A;  3HK0 A;  1PMS A;  3SO6 A;  2D9X A;  2X18 A;  1UPR A;  5HE1 A;  1QQG A;  3D8D A;  1XKE A; 
#chains in the Genus database with same CATH topology
 4HDO A;  2G35 A;  4KVG B;  4F7G A;  3HSA A;  3O96 A;  2Z59 A;  4MY6 A;  3RCP A;  2M14 A;  5C79 A;  3D8E A;  4H8S A;  2GJY A;  3DXC A;  4GXB A;  1TQZ A;  4MT7 A;  2ZPY A;  3PVW A;  4KHO A;  1K5G B;  1X1F A;  4CSQ A;  2P0D A;  1XOD A;  3PG7 A;  1OMW A;  2QKM A;  5C16 A;  2NBV A;  2Z0P A;  3U12 A;  2ZKM X;  1V89 A;  1WJ1 A;  3MPX A;  3GYP A;  5J3Q A;  5D3V A;  2KIE A;  1B55 A;  5CLQ B;  2RLO A;  2VKI A;  2K8E A;  2M38 A;  2ADZ A;  2Y8G A;  3SYX A;  2NMB A;  3TW1 A;  2DHI A;  5J3T A;  1DDW A;  1U2B A;  4WVF B;  4HAU B;  5KQ1 A;  2YRY A;  1MKE A;  2K2U A;  1ZSQ A;  1I2H A;  1Y19 B;  3PSC A;  3QBV B;  3AU4 A;  2D9V A;  1FHW A;  2MDX A;  4YL8 A;  4IOY X;  2RVB B;  1M7E A;  3ZDT A;  1XD4 A;  2DX1 A;  2QKL A;  4HAW B;  1GG3 A;  2Y7B A;  2ROZ B;  4DBB A;  1MK9 B;  4A6K A;  1UPQ A;  2AL6 A;  1EVH A;  1W1G A;  2HTH B;  4Z2N A;  3CXB B;  1U27 A;  5FI1 A;  1EAZ A;  2YS5 A;  4K17 A;  4EKU A;  4GPT B;  2I5F A;  4C0A A;  4Z2M B;  4KHB A;  2R2Y A;  1UNQ A;  2HE7 A;  3VOQ A;  2Q13 A;  5I2M A;  1DRO A;  1NU2 A;  2DYN A;  2W2X C;  3A58 A;  4MK0 A;  1FAO A;  1NI2 A;  5L81 A;  5D3Y A;  1AWE A;  4WJ7 A;  2I5C A;  2YF0 A;  5KQ4 A;  3OHM B;  1FHX A;  5JHG A;  1Q67 A;  4TKN A;  1V88 A;  1V5M A;  3F5R A;  2KUQ A;  3ODW A;  5HE3 A;  5DHF B;  4B6H A;  3ZVR A;  3HIE A;  4CYE A;  2D11 A;  4D0N B;  2CY4 A;  1ZYI A;  1Z87 A;  1UNP A;  1RRP B;  2IFS A;  5D27 A;  1DDM A;  1SGH A;  2VSZ A;  4DXA B;  5J3Y A;  2D9Z A;  2UZR A;  1P6S A;  3B77 A;  2ELA A;  5JHH A;  4L6E A;  5LON B;  4HB3 B;  4CHJ A;  4A5K A;  2AEH A;  4HAZ B;  1BAK A;  1PFJ A;  1OY2 A;  2JP2 A;  2R09 A;  2YSZ A;  2IYB A;  5DIF B;  5CLL B;  3NWA A;  4A6H A;  3IVF A;  5D3W A;  4HHV A;  4KHB B;  4HB4 B;  4KAX B;  2YT0 A;  4DX9 0;  2DFK A;  4GZU A;  1U5G A;  3LJU X;  1Y5O A;  1WJM A;  3U8Z A;  1X86 A;  2CY5 A;  2FJU B;  2RNR B;  3BIN A;  4YON A;  1W1D A;  1DYN A;  3MDB C;  4EMO A;  1DBH A;  1BTN A;  2J0J A;  1MPH A;  4A6F A;  2OTX A;  2KUP A;  1LB1 A;  1FGZ A;  4IAP A;  4P7I A;  4QJ4 B;  3KRX A;  3SV1 A;  3N7C A;  3TFM A;  1J0W A;  2RGN B;  3A8P A;  2K49 A;  2LKO A;  2DA0 A;  1P3R A;  2COA A;  1ISN A;  2MWN B;  1U5F A;  3AJ4 A;  1ZC4 B;  1FOE A;  3NWF A;  4ZRK A;  3BJI A;  2N23 A;  4D6W A;  2L1C A;  3KRW A;  4GMV A;  3QWM A;  1MIZ B;  2EC1 A;  1MK7 B;  5DHA B;  2ELB A;  3KY9 A;  3V5W A;  2OQB A;  1XX0 A;  2D2Q A;  5JP4 A;  1U5E A;  2YVC A;  4DIX A;  3X23 A;  4XWX A;  2GUM A;  1X05 A;  1WVH A;  3QIJ A;  2DHK A;  2LOX A;  2P8V A;  4HSI A;  3DXD A;  4QJ5 B;  3UZT A;  2Z4D A;  3WA0 A;  1WI1 A;  1FB8 A;  1KZ7 A;  3ODX A;  2MFQ A;  2KR0 A;  1V5U A;  3NW8 A;  4HAT B;  3ULB A;  1V61 A;  2DTC A;  3G9W A;  4HB2 B;  4CHM A;  1U29 A;  4HAX B;  1NTV A;  4ZRI A;  1GC7 A;  2UVM A;  4EJN A;  1TJ6 A;  5HE0 A;  2Z13 A;  3GYO A;  5KCV A;  2L2I A;  4GNK B;  1OQN A;  3PVU A;  2I1J A;  1QC6 A;  2VRW B;  1MI1 A;  3AU5 A;  3NSU A;  3U7D A;  5FI0 A;  2UZS A;  3HQC A;  4IFS A;  1AQC A;  2NZ8 B;  5DH9 B;  2LOZ A;  1UEF A;  1WGU A;  5C6R A;  3WYF B;  5C5B A;  2CRF A;  2YS1 A;  2DLW A;  1N3H A;  2Y8F A;  3D8F A;  3NWD A;  3ODO A;  3ULC A;  1EGX A;  4OSN A;  4HDQ A;  5GOW B;  3CIK A;  1T77 A;  4DX8 A;  1GC6 A;  4Y94 A;  3KZ1 A;  4GMX B;  5M4Y B;  1KI1 B;  2FJL A;  2E2X A;  2RSG A;  2LUL A;  4TYZ A;  2COF A;  1UNR A;  4HAV B;  4NSW A;  3TCA A;  2XQN M;  3M1I B;  4GOU A;  2Z14 A;  2GCL A;  2DYQ A;  2DKP A;  2V76 A;  4K2P A;  4K81 A;  2DHJ A;  2H7D A;  1IRS A;  1MIX A;  2K2J A;  2KCJ A;  2W2X D;  1TXD A;  4F7H A;  3ML4 A;  4PNK A;  3SUZ A;  3TO1 A;  2LYD A;  1ZC3 B;  1K5D B;  2YT2 A;  3VIA A;  2EJ8 A;  1V5P A;  1H10 A;  2YT1 A;  3TVV A;  3PZD A;  3A98 B;  3PVL A;  2CAY A;  4F7U P;  1W1H A;  2KIG A;  1J19 A;  5D3X A;  2J0K A;  1I7A A;  5I2S A;  3DCX A;  4NY0 A;  1LW3 A;  2KGX B;  4HB0 B;  3SNH A;  1M7R A;  4K2O A;  2D9Y A;  5C5B B;  2RUK B;  3FSS A;  2W2W A;  3FM8 C;  2P0H A;  2Z0O A;  2BCJ A;  3FEH A;  2DKQ A;  1U5D A;  1RJ2 A;  2Z0Q A;  4HAY B;  4GN1 A;  2YS3 A;  4KHA A;  1BWN A;  2D9W A;  1MAI A;  1WG7 A;  1XCG A;  1E5W A;  1NTY A;  2GCJ A;  2COD A;  1SHC A;  1BTK A;  2N0Y A;  4BBK A;  4PQ0 A;  3FVC A;  2LG1 A;  4WSF A;  5EFX A;  1H4R A;  5IRS A;  2ROV A;  3HW2 B;  1KZG A;  3F0W A;  2D10 A;  3DXE A;  1P5T A;  4L1R A;  3P6A A;  4QJ3 B;  5LOP B;  2COC A;  5HE2 A;  1ZVR A;  2RRF A;  4OT1 A;  4A6F B;  3T06 A;  1WGQ A;  2K00 A;  2J0M A;  1FGY A;  2I1K A;  2H7E A;  1DDV A;  4ZRJ A;  3P7Z A;  2EMT A;  3OAN A;  5LG4 B;  5DI9 B;  1X1G A;  2R0D A;  1X11 A;  5JLJ B;  2GS0 A;  1XR0 B;  3PP2 A;  2J59 M;  2EMS A;  2MKR A;  1EF1 A;  1ZM0 A;  2D4Q A;  2DN6 A;  1FHO A;  2PZ1 A;  2DX5 A;  1PLS A;  3A8Q A;  2P0F A;  3KSY A;  3PEG A;  3HK0 A;  4QXA B;  1PMS A;  3SO6 A;  2D9X A;  2X18 A;  1UPR A;  5HE1 A;  1QQG A;  3D8D A;  1XKE A; 
#chains in the Genus database with same CATH homology
 4HDO A;  2G35 A;  4KVG B;  4F7G A;  3O96 A;  4MY6 A;  3RCP A;  2M14 A;  5C79 A;  3D8E A;  4H8S A;  2GJY A;  3DXC A;  4GXB A;  1TQZ A;  4MT7 A;  2ZPY A;  3PVW A;  4KHO A;  1K5G B;  1X1F A;  2P0D A;  1XOD A;  3PG7 A;  1OMW A;  2QKM A;  5C16 A;  2Z0P A;  1V89 A;  1WJ1 A;  3MPX A;  3GYP A;  5J3Q A;  5D3V A;  1B55 A;  5CLQ B;  2RLO A;  2VKI A;  2M38 A;  2ADZ A;  2Y8G A;  3SYX A;  2NMB A;  3TW1 A;  2DHI A;  5J3T A;  1DDW A;  1U2B A;  4WVF B;  4HAU B;  5KQ1 A;  2YRY A;  1MKE A;  2K2U A;  1ZSQ A;  1I2H A;  1Y19 B;  3PSC A;  3QBV B;  3AU4 A;  2D9V A;  1FHW A;  2MDX A;  4YL8 A;  4IOY X;  2RVB B;  1M7E A;  3ZDT A;  1XD4 A;  2DX1 A;  2QKL A;  4HAW B;  1GG3 A;  2Y7B A;  2ROZ B;  4DBB A;  1MK9 B;  4A6K A;  1UPQ A;  2AL6 A;  1EVH A;  1W1G A;  2HTH B;  4Z2N A;  3CXB B;  1U27 A;  5FI1 A;  1EAZ A;  2YS5 A;  4K17 A;  4EKU A;  4GPT B;  2I5F A;  4C0A A;  4Z2M B;  1UNQ A;  2HE7 A;  3VOQ A;  2Q13 A;  1DRO A;  1NU2 A;  2DYN A;  2W2X C;  4MK0 A;  1FAO A;  1NI2 A;  5L81 A;  5D3Y A;  1AWE A;  4WJ7 A;  2I5C A;  2YF0 A;  5KQ4 A;  1FHX A;  5JHG A;  1Q67 A;  4TKN A;  1V88 A;  1V5M A;  3F5R A;  3ODW A;  5HE3 A;  5DHF B;  4B6H A;  3ZVR A;  4CYE A;  2D11 A;  4D0N B;  2CY4 A;  1Z87 A;  1UNP A;  1RRP B;  2IFS A;  5D27 A;  1DDM A;  1SGH A;  2VSZ A;  4DXA B;  5J3Y A;  2D9Z A;  2UZR A;  1P6S A;  2ELA A;  5JHH A;  4L6E A;  5LON B;  4HB3 B;  4CHJ A;  4A5K A;  2AEH A;  4HAZ B;  1BAK A;  1PFJ A;  1OY2 A;  2JP2 A;  2R09 A;  2YSZ A;  2IYB A;  5DIF B;  5CLL B;  4A6H A;  3IVF A;  5D3W A;  4HHV A;  4KHB B;  4HB4 B;  4KAX B;  2YT0 A;  4DX9 0;  2DFK A;  4GZU A;  1U5G A;  3LJU X;  1Y5O A;  1WJM A;  3U8Z A;  1X86 A;  2CY5 A;  2RNR B;  3BIN A;  4YON A;  1W1D A;  1DYN A;  3MDB C;  4EMO A;  1DBH A;  1BTN A;  2J0J A;  1MPH A;  4A6F A;  2OTX A;  2KUP A;  1LB1 A;  1FGZ A;  4IAP A;  4P7I A;  3KRX A;  3SV1 A;  3N7C A;  3TFM A;  1J0W A;  2RGN B;  3A8P A;  2LKO A;  2DA0 A;  1P3R A;  2COA A;  1ISN A;  2MWN B;  1U5F A;  1ZC4 B;  3AJ4 A;  1FOE A;  4ZRK A;  3BJI A;  2N23 A;  2L1C A;  3KRW A;  4GMV A;  3QWM A;  1MIZ B;  2EC1 A;  1MK7 B;  5DHA B;  2ELB A;  3KY9 A;  3V5W A;  2OQB A;  1XX0 A;  2D2Q A;  5JP4 A;  1U5E A;  2YVC A;  3X23 A;  4XWX A;  1X05 A;  1WVH A;  3QIJ A;  2DHK A;  2LOX A;  2P8V A;  3DXD A;  3UZT A;  3WA0 A;  1WI1 A;  1FB8 A;  1KZ7 A;  3ODX A;  2MFQ A;  1V5U A;  4HAT B;  3ULB A;  1V61 A;  2DTC A;  3G9W A;  4HB2 B;  4CHM A;  1U29 A;  4HAX B;  1NTV A;  4ZRI A;  1GC7 A;  2UVM A;  4EJN A;  1TJ6 A;  5HE0 A;  3GYO A;  5KCV A;  2L2I A;  1OQN A;  3PVU A;  2I1J A;  1QC6 A;  2VRW B;  3AU5 A;  3NSU A;  3U7D A;  5FI0 A;  2UZS A;  3HQC A;  4IFS A;  1AQC A;  2NZ8 B;  5DH9 B;  2LOZ A;  1UEF A;  1WGU A;  5C6R A;  3WYF B;  5C5B A;  2CRF A;  2YS1 A;  2DLW A;  1N3H A;  2Y8F A;  3D8F A;  1EGX A;  3ODO A;  3ULC A;  4HDQ A;  5GOW B;  3CIK A;  4DX8 A;  1GC6 A;  4Y94 A;  3KZ1 A;  4GMX B;  1KI1 B;  2FJL A;  2E2X A;  2RSG A;  2LUL A;  4TYZ A;  2COF A;  1UNR A;  4HAV B;  4NSW A;  3TCA A;  2XQN M;  3M1I B;  2GCL A;  2DYQ A;  2DKP A;  2V76 A;  4K2P A;  4K81 A;  2DHJ A;  2H7D A;  1IRS A;  1MIX A;  2K2J A;  2KCJ A;  2W2X D;  1TXD A;  4F7H A;  3ML4 A;  4PNK A;  3SUZ A;  3TO1 A;  2LYD A;  1ZC3 B;  1K5D B;  3VIA A;  2EJ8 A;  1V5P A;  1H10 A;  2YT1 A;  3TVV A;  3PZD A;  3A98 B;  3PVL A;  2CAY A;  4F7U P;  1W1H A;  1J19 A;  5D3X A;  2J0K A;  1I7A A;  4NY0 A;  1LW3 A;  2KGX B;  4HB0 B;  3SNH A;  1M7R A;  4K2O A;  2D9Y A;  5C5B B;  2RUK B;  3FSS A;  2W2W A;  3FM8 C;  2P0H A;  2Z0O A;  2BCJ A;  3FEH A;  2DKQ A;  1U5D A;  1RJ2 A;  2Z0Q A;  4HAY B;  4GN1 A;  2YS3 A;  4KHA A;  1BWN A;  2D9W A;  1MAI A;  1WG7 A;  1XCG A;  1E5W A;  1NTY A;  2GCJ A;  2COD A;  1SHC A;  1BTK A;  2N0Y A;  4BBK A;  4PQ0 A;  4WSF A;  2LG1 A;  5EFX A;  1H4R A;  2ROV A;  3HW2 B;  1KZG A;  3F0W A;  2D10 A;  3DXE A;  1P5T A;  3P6A A;  5LOP B;  2COC A;  5HE2 A;  1ZVR A;  4A6F B;  3T06 A;  1WGQ A;  2K00 A;  2J0M A;  1FGY A;  2I1K A;  2H7E A;  1DDV A;  4ZRJ A;  3P7Z A;  2EMT A;  3OAN A;  5DI9 B;  1X1G A;  2R0D A;  1X11 A;  5JLJ B;  2GS0 A;  1XR0 B;  3PP2 A;  2J59 M;  2EMS A;  2MKR A;  1EF1 A;  1ZM0 A;  2D4Q A;  2DN6 A;  1FHO A;  2PZ1 A;  2DX5 A;  1PLS A;  3A8Q A;  2P0F A;  3KSY A;  3PEG A;  3HK0 A;  1PMS A;  3SO6 A;  2D9X A;  2X18 A;  1UPR A;  5HE1 A;  1QQG A;  3D8D A;  1XKE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...