3ULCA

Crystal structure of the pleckstrin homology domain of saccharomyces cerevisiae avo1, a torc2 subunit, in the p3121 crystal form
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
110
structure length
100
Chain Sequence
AYHKYKVWRRQQMSFINKHERTLAIDGDYIYIVPPENVKTKSLHISQVVLVKKSKRVPEHFKIFVRRDDIKRYYFEAVSGQECTEIVTRLQNLLSAYRMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Target of rapamycin complex 2 subunit AVO1
publication title Structures of the pleckstrin homology domain of Saccharomyces cerevisiae Avo1 and its human orthologue Sin1, an essential subunit of TOR complex 2
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Membrane protein
total genus 19
structure length 100
sequence length 110
ec nomenclature
pdb deposition date 2011-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16979 SIN1_PH SAPK-interacting protein 1 (Sin1), Pleckstrin-homology
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3ulcA01
1U5EA 3IVFA 3VOQA 2P0DA 3PVWA 5HE3A 1WGUA 3P6AA 1XD4A 4A6FA 4HAWB 2NZ8B 2HE7A 2KUPA 3SYXA 1WI1A 5D27A 5JLJB 1Z87A 2EMTA 2HTHB 3SUZA 4GXBA 3HQCA 3TVVA 2EMSA 1W1DA 4H8SA 1PLSA 1UNRA 5CLQB 4ZRKA 5DHFB 4BBKA 5HE2A 3KY9A 4EJNA 2M14A 3X23A 1SGHA 4WSFA 4A5KA 4F7HA 4KHAA 4IOYX 1W1GA 4ZRJA 1DDWA 3DXDA 2I5FA 3ODWA 1LB1A 3A8QA 1UPRA 1ZVRA 2D9XA 3O96A 5C6RA 1W1HA 4HAZB 2P8VA 4MT7A 4C0AA 2CODA 4IAPA 2EJ8A 2DYQA 4NSWA 5J3QA 3V5WA 2D2QA 4K81A 3TO1A 2D4QA 2D9YA 2YT1A 1P3RA 4DXAB 1QC6A 3PSCA 5DH9B 2MDXA 5FI0A 5LONB 3MDBC 3VIAA 2N23A 5D3YA 2R0DA 3PEGA 3PG7A 2M38A 2G35A 2W2XC 4KHOA 1WVHA 1X11A 2IYBA 5JHHA 3CIKA 4DX8A 4ZRIA 3ULBA 3RCPA 3KRWA 4F7UP 1GC7A 1FAOA 1KZGA 2LG1A 1EF1A 2J0JA 2P0HA 2UVMA 1K5DB 1EGXA 1XX0A 5J3TA 3AJ4A 2VRWB 2Q13A 4YL8A 4K2OA 5D3WA 5C5BB 4F7GA 5KQ1A 2K2JA 3OANA 2Z0OA 1K5GB 2VKIA 2YSZA 2YF0A 1Q67A 3FM8C 2YS1A 3HW2B 2MWNB 1XODA 1U5GA 2Y7BA 2D9ZA 4HDQA 1FHXA 3GYOA 4GMXB 1QQGA 4HB2B 4Y94A 3DXEA 4HB4B 2OQBA 1RJ2A 1PFJA 2D10A 4KVGB 4HAYB 3ZVRA 2ADZA 3G9WA 2LOXA 2Y8FA 2CAYA 3T06A 1V61A 1M7EA 1X1FA 2YRYA 2DKPA 2ZPYA 3D8DA 4KHBB 4HATB 2X18A 4A6HA 4P7IA 4HB0B 4MK0A 3SO6A 3TW1A 1ISNA 1U29A 4YONA 5EFXA 1H4RA 2COCA 2E2XA 1UNQA 2DHKA 4CHJA 2LYDA 1DDVA 1V5MA 2CY5A 3UZTA 2D9VA 5D3VA 1E5WA 2RGNB 2YVCA 1XR0B 1UEFA 2RLOA 1KI1B 4Z2MB 2H7DA 1I7AA 3U8ZA 2DN6A 1H10A 3D8EA 5JP4A 1U5DA 2Y8GA 3AU4A 3QIJA 3BJIA 2FJLA 4HAXB 1X86A 2JP2A 1FGZA 1WJ1A 4HDOA 1WGQA 2DA0A 2UZSA 2COAA 4A6KA 3SNHA 2KCJA 2GCJA 2RNRB 5J3YA 1NTYA 1WG7A 2PZ1A 2MFQA 3KZ1A 1Y19B 3QWMA 3AU5A 2EC1A 2MKRA 2ELAA 3A98B 2YS3A 5C16A 1P5TA 2XQNM 2Z0PA 4CYEA 4A6FB 5LOPB 4B6HA 5D3XA 4GZUA 3M1IB 2DX5A 4EKUA 1DROA 2AEHA 2D11A 1BTKA 3ULCA 1TJ6A 4WVFB 1N3HA 1XKEA 1MIZB 2YT0A 4DX90 1X05A 5DIFB 1V89A 4MY6A 2DHIA 1BAKA 3SV1A 2K2UA 2I5CA 3ML4A 4K17A 1XCGA 3F5RA 2GCLA 1OMWA 2CRFA 3A8PA 1MPHA 5JHGA 1V5PA 2GS0A 1AQCA 2BCJA 3HK0A 4WJ7A 1FOEA 4L6EA 2J0KA 2NMBA 2DKQA 2J0MA 1V5UA 1Y5OA 4GN1A 1AWEA 4XWXA 2DFKA 3KSYA 4EMOA 2RSGA 1LW3A 3D8FA 2DLWA 2DX1A 1ZM0A 5HE1A 5C5BA 3U7DA 3MPXA 2YS5A 2P0FA 3PVUA 2COFA 1ZC3B 2CY4A 2GJYA 2ROZB 1MK7B 3PP2A 1BWNA 3CXBB 4D0NB 2W2XD 3KRXA 4GMVA 4PNKA 4PQ0A 2QKLA 1TXDA 3WYFB 4IFSA 2DTCA 2IFSA 2D9WA 3TFMA 1OY2A 3WA0A 1M7RA 1V88A 1EAZA 1B55A 3BINA 1MAIA 4HAVB 5CLLB 1J0WA 3FEHA 2I1KA 1MKEA 5FI1A 1RRPB 1NTVA 1DDMA 2LOZA 5C79A 1UPQA 1MIXA 3QBVB 3PVLA 5L81A 1FGYA 3FSSA 1NI2A 1U5FA 2ELBA 1IRSA 3ODXA 2L1CA 3P7ZA 4HHVA 4Z2NA 2RUKB 5KCVA 3TCAA 2KGXB 1U2BA 4K2PA 1I2HA 4GPTB 1GC6A 1EVHA 1MK9B 4TKNA 2K00A 5KQ4A 3ODOA 4HAUB 2N0YA 2L2IA 2AL6A 4KAXB 1TQZA 3PZDA 1DBHA 1X1GA 1GG3A 1P6SA 2H7EA 1DYNA 1FB8A 2UZRA 5DI9B 1SHCA 2V76A 1NU2A 1WJMA 2DHJA 2DYNA 1UNPA 2RVBB 3NSUA 3LJUX 2VSZA 1J19A 1ZC4B 2QKMA 5DHAB 5GOWB 2Z0QA 3N7CA 1PMSA 1U27A 2I1JA 4DBBA 2W2WA 1FHOA 2LKOA 3DXCA 4HB3B 2J59M 1KZ7A 1OQNA 5HE0A 4NY0A 3GYPA 2R09A 3ZDTA 1FHWA 1ZSQA 2LULA 2OTXA 1BTNA 4CHMA 3F0WA 2ROVA 4TYZA
chains in the Genus database with same CATH superfamily
1U5EA 3IVFA 3VOQA 2P0DA 3PVWA 5HE3A 1WGUA 3P6AA 1XD4A 4A6FA 4HAWB 2NZ8B 2HE7A 2KUPA 3SYXA 1WI1A 5D27A 5JLJB 1Z87A 4QJ4B 2EMTA 2HTHB 1T77A 3SUZA 4GXBA 3HQCA 3TVVA 2EMSA 1W1DA 4H8SA 1PLSA 1UNRA 5CLQB 4ZRKA 5DHFB 4QJ3B 4BBKA 5HE2A 3KY9A 4EJNA 2FJUB 2M14A 3X23A 1SGHA 4WSFA 2YT2A 4A5KA 4F7HA 4KHAA 4IOYX 1W1GA 4D6WA 4ZRJA 1DDWA 3U12A 3DXDA 2I5FA 3ODWA 2K49A 1LB1A 3A8QA 1UPRA 4HSIA 1ZVRA 2D9XA 3O96A 5C6RA 1W1HA 4HAZB 4OT1A 2P8VA 4MT7A 4C0AA 2CODA 4IAPA 2EJ8A 2DYQA 4NSWA 5J3QA 3V5WA 2D2QA 4K81A 3TO1A 2D4QA 2D9YA 2YT1A 4GOUA 1P3RA 2ZKMX 4DXAB 1QC6A 3PSCA 5DH9B 2MDXA 5FI0A 5LONB 3MDBC 3VIAA 2N23A 5D3YA 2R0DA 3PEGA 3PG7A 2M38A 2G35A 2W2XC 4KHOA 1WVHA 1X11A 2IYBA 5JHHA 3CIKA 4DX8A 4ZRIA 3ULBA 3RCPA 3KRWA 4F7UP 1GC7A 3OHMB 5M4YB 1FAOA 1KZGA 2LG1A 1EF1A 2J0JA 2P0HA 2UVMA 1K5DB 1EGXA 1XX0A 5J3TA 3AJ4A 2VRWB 2Q13A 4YL8A 4K2OA 2KR0A 5D3WA 5C5BB 4F7GA 5KQ1A 2K2JA 3OANA 2Z0OA 1K5GB 2VKIA 2YSZA 2YF0A 1Q67A 3FM8C 2YS1A 3HW2B 2MWNB 1XODA 1U5GA 2KUQA 2Y7BA 3HIEA 2D9ZA 4HDQA 1FHXA 3GYOA 4GMXB 2R2YA 1QQGA 4HB2B 3NWFA 4Y94A 3DXEA 4HB4B 2OQBA 1RJ2A 1PFJA 2K8EA 2D10A 4KVGB 4HAYB 3ZVRA 2ADZA 3G9WA 2LOXA 2Y8FA 2CAYA 3T06A 1V61A 1M7EA 1X1FA 2YRYA 2DKPA 2RRFA 2ZPYA 3D8DA 4KHBB 4HATB 2X18A 4A6HA 4P7IA 4HB0B 4MK0A 3SO6A 3TW1A 1ISNA 1U29A 3NWDA 4YONA 5EFXA 4QXAB 1H4RA 2COCA 2E2XA 1UNQA 2DHKA 4CHJA 2LYDA 1DDVA 1V5MA 2CY5A 3UZTA 2D9VA 5I2SA 5D3VA 1E5WA 2RGNB 2YVCA 1XR0B 1UEFA 2RLOA 1KI1B 4Z2MB 2H7DA 1I7AA 2KIEA 3U8ZA 2DN6A 1H10A 3D8EA 5JP4A 1U5DA 2Y8GA 3AU4A 3QIJA 4CSQA 3BJIA 2FJLA 4HAXB 1X86A 2JP2A 1FGZA 1WJ1A 4HDOA 1WGQA 2DA0A 5LG4B 2UZSA 2COAA 4A6KA 3SNHA 2KCJA 2GCJA 2RNRB 1MI1A 5J3YA 1NTYA 1WG7A 2PZ1A 2MFQA 3KZ1A 1Y19B 3QWMA 3AU5A 2EC1A 2MKRA 2ELAA 3A98B 2YS3A 2Z4DA 5C16A 1P5TA 2XQNM 2Z0PA 4CYEA 4A6FB 5LOPB 4B6HA 2NBVA 5D3XA 4GZUA 3M1IB 2DX5A 4EKUA 1DROA 2AEHA 2D11A 1BTKA 3ULCA 1TJ6A 4WVFB 1N3HA 1XKEA 3NW8A 3A58A 1MIZB 2YT0A 4DX90 1X05A 5DIFB 1V89A 4MY6A 2DHIA 1BAKA 3NWAA 3SV1A 2K2UA 2I5CA 3ML4A 4K17A 1XCGA 3F5RA 2GCLA 1OMWA 2CRFA 3A8PA 1MPHA 5JHGA 1V5PA 2GS0A 1AQCA 2BCJA 3HK0A 4WJ7A 1FOEA 4L6EA 2J0KA 2NMBA 2DKQA 2J0MA 1V5UA 1Y5OA 4GN1A 1AWEA 4XWXA 2DFKA 3KSYA 4OSNA 4EMOA 2RSGA 1LW3A 3D8FA 2DLWA 2DX1A 1ZM0A 5HE1A 5C5BA 2Z59A 3MPXA 3U7DA 2YS5A 2P0FA 3PVUA 2COFA 1ZC3B 2CY4A 2GJYA 2ROZB 1MK7B 3PP2A 1BWNA 3CXBB 4D0NB 2GUMA 2W2XD 3KRXA 4GMVA 4PNKA 5I2MA 4DIXA 3B77A 4PQ0A 2QKLA 1TXDA 3WYFB 4IFSA 2DTCA 2IFSA 2D9WA 3TFMA 1OY2A 3WA0A 1M7RA 1V88A 3DCXA 1EAZA 1B55A 3BINA 1MAIA 4HAVB 5CLLB 1J0WA 3FEHA 2I1KA 1MKEA 5FI1A 1RRPB 1NTVA 4GNKB 1DDMA 2LOZA 5C79A 1UPQA 1MIXA 3QBVB 3PVLA 5L81A 1FGYA 3FSSA 3FVCA 1NI2A 4KHBA 1U5FA 2Z13A 2KIGA 2ELBA 1IRSA 3ODXA 2L1CA 3P7ZA 4HHVA 4Z2NA 2RUKB 5KCVA 3TCAA 2KGXB 1U2BA 4K2PA 1I2HA 4GPTB 1GC6A 1EVHA 1MK9B 4TKNA 2K00A 5KQ4A 3ODOA 4HAUB 1ZYIA 2N0YA 2L2IA 2AL6A 3HSAA 4KAXB 5IRSA 4L1RA 1TQZA 3PZDA 1DBHA 1X1GA 1GG3A 1P6SA 2H7EA 2Z14A 1DYNA 1FB8A 2UZRA 5DI9B 1SHCA 2V76A 1NU2A 1WJMA 2DHJA 2DYNA 4QJ5B 1UNPA 2RVBB 3NSUA 3LJUX 2VSZA 1J19A 1ZC4B 2QKMA 5DHAB 5GOWB 2Z0QA 3N7CA 1PMSA 1U27A 2I1JA 4DBBA 2W2WA 1FHOA 2LKOA 3DXCA 4HB3B 2J59M 1KZ7A 1OQNA 5HE0A 4NY0A 3GYPA 2R09A 3ZDTA 1FHWA 1ZSQA 2LULA 2OTXA 1BTNA 4CHMA 3F0WA 2ROVA 4TYZA
chains in the Genus database with same CATH topology
1U5EA 3IVFA 3VOQA 2P0DA 3PVWA 5HE3A 1WGUA 3P6AA 1XD4A 4A6FA 4HAWB 2NZ8B 2HE7A 2KUPA 3SYXA 1WI1A 5D27A 5JLJB 1Z87A 2EMTA 2HTHB 3SUZA 4GXBA 3HQCA 3TVVA 2EMSA 1W1DA 4H8SA 1PLSA 1UNRA 5CLQB 4ZRKA 5DHFB 4BBKA 5HE2A 3KY9A 4EJNA 2M14A 3X23A 1SGHA 4WSFA 4A5KA 4F7HA 4KHAA 4IOYX 1W1GA 4ZRJA 1DDWA 3DXDA 2I5FA 3ODWA 1LB1A 3A8QA 1UPRA 1ZVRA 2D9XA 3O96A 5C6RA 1W1HA 4HAZB 2P8VA 4MT7A 4C0AA 2CODA 4IAPA 2EJ8A 2DYQA 4NSWA 5J3QA 3V5WA 2D2QA 4K81A 3TO1A 2D4QA 2D9YA 2YT1A 1P3RA 4DXAB 1QC6A 3PSCA 5DH9B 2MDXA 5FI0A 5LONB 3MDBC 3VIAA 2N23A 5D3YA 2R0DA 3PEGA 3PG7A 2M38A 2G35A 2W2XC 4KHOA 1WVHA 1X11A 2IYBA 5JHHA 3CIKA 4DX8A 4ZRIA 3ULBA 3RCPA 3KRWA 4F7UP 1GC7A 1FAOA 1KZGA 2LG1A 1EF1A 2J0JA 2P0HA 2UVMA 1K5DB 1EGXA 1XX0A 5J3TA 3AJ4A 2VRWB 2Q13A 4YL8A 4K2OA 5D3WA 5C5BB 4F7GA 5KQ1A 2K2JA 3OANA 2Z0OA 1K5GB 2VKIA 2YSZA 2YF0A 1Q67A 3FM8C 2YS1A 3HW2B 2MWNB 1XODA 1U5GA 2Y7BA 2D9ZA 4HDQA 1FHXA 3GYOA 4GMXB 1QQGA 4HB2B 4Y94A 3DXEA 4HB4B 2OQBA 1RJ2A 1PFJA 2D10A 4KVGB 4HAYB 3ZVRA 2ADZA 3G9WA 2LOXA 2Y8FA 2CAYA 3T06A 1V61A 1M7EA 1X1FA 2YRYA 2DKPA 2ZPYA 3D8DA 4KHBB 4HATB 2X18A 4A6HA 4P7IA 4HB0B 4MK0A 3SO6A 3TW1A 1ISNA 1U29A 4YONA 5EFXA 1H4RA 2COCA 2E2XA 1UNQA 2DHKA 4CHJA 2LYDA 1DDVA 1V5MA 2CY5A 3UZTA 2D9VA 5D3VA 1E5WA 2RGNB 2YVCA 1XR0B 1UEFA 2RLOA 1KI1B 4Z2MB 2H7DA 1I7AA 3U8ZA 2DN6A 1H10A 3D8EA 5JP4A 1U5DA 2Y8GA 3AU4A 3QIJA 3BJIA 2FJLA 4HAXB 1X86A 2JP2A 1FGZA 1WJ1A 4HDOA 1WGQA 2DA0A 2UZSA 2COAA 4A6KA 3SNHA 2KCJA 2GCJA 2RNRB 5J3YA 1NTYA 1WG7A 2PZ1A 2MFQA 3KZ1A 1Y19B 3QWMA 3AU5A 2EC1A 2MKRA 2ELAA 3A98B 2YS3A 5C16A 1P5TA 2XQNM 2Z0PA 4CYEA 4A6FB 5LOPB 4B6HA 5D3XA 4GZUA 3M1IB 2DX5A 4EKUA 1DROA 2AEHA 2D11A 1BTKA 3ULCA 1TJ6A 4WVFB 1N3HA 1XKEA 1MIZB 2YT0A 4DX90 1X05A 5DIFB 1V89A 4MY6A 2DHIA 1BAKA 3SV1A 2K2UA 2I5CA 3ML4A 4K17A 1XCGA 3F5RA 2GCLA 1OMWA 2CRFA 3A8PA 1MPHA 5JHGA 1V5PA 2GS0A 1AQCA 2BCJA 3HK0A 4WJ7A 1FOEA 4L6EA 2J0KA 2NMBA 2DKQA 2J0MA 1V5UA 1Y5OA 4GN1A 1AWEA 4XWXA 2DFKA 3KSYA 4EMOA 2RSGA 1LW3A 3D8FA 2DLWA 2DX1A 1ZM0A 5HE1A 5C5BA 3U7DA 3MPXA 2YS5A 2P0FA 3PVUA 2COFA 1ZC3B 2CY4A 2GJYA 2ROZB 1MK7B 3PP2A 1BWNA 3CXBB 4D0NB 2W2XD 3KRXA 4GMVA 4PNKA 4PQ0A 2QKLA 1TXDA 3WYFB 4IFSA 2DTCA 2IFSA 2D9WA 3TFMA 1OY2A 3WA0A 1M7RA 1V88A 1EAZA 1B55A 3BINA 1MAIA 4HAVB 5CLLB 1J0WA 3FEHA 2I1KA 1MKEA 5FI1A 1RRPB 1NTVA 1DDMA 2LOZA 5C79A 1UPQA 1MIXA 3QBVB 3PVLA 5L81A 1FGYA 3FSSA 1NI2A 1U5FA 2ELBA 1IRSA 3ODXA 2L1CA 3P7ZA 4HHVA 4Z2NA 2RUKB 5KCVA 3TCAA 2KGXB 1U2BA 4K2PA 1I2HA 4GPTB 1GC6A 1EVHA 1MK9B 4TKNA 2K00A 5KQ4A 3ODOA 4HAUB 2N0YA 2L2IA 2AL6A 4KAXB 1TQZA 3PZDA 1DBHA 1X1GA 1GG3A 1P6SA 2H7EA 1DYNA 1FB8A 2UZRA 5DI9B 1SHCA 2V76A 1NU2A 1WJMA 2DHJA 2DYNA 1UNPA 2RVBB 3NSUA 3LJUX 2VSZA 1J19A 1ZC4B 2QKMA 5DHAB 5GOWB 2Z0QA 3N7CA 1PMSA 1U27A 2I1JA 4DBBA 2W2WA 1FHOA 2LKOA 3DXCA 4HB3B 2J59M 1KZ7A 1OQNA 5HE0A 4NY0A 3GYPA 2R09A 3ZDTA 1FHWA 1ZSQA 2LULA 2OTXA 1BTNA 4CHMA 3F0WA 2ROVA 4TYZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1U5E A;  3IVF A;  3VOQ A;  2P0D A;  3PVW A;  5HE3 A;  1WGU A;  3P6A A;  1XD4 A;  4A6F A;  4HAW B;  2NZ8 B;  2HE7 A;  2KUP A;  3SYX A;  1WI1 A;  5D27 A;  5JLJ B;  1Z87 A;  2EMT A;  2HTH B;  3SUZ A;  4GXB A;  3HQC A;  3TVV A;  2EMS A;  1W1D A;  4H8S A;  1PLS A;  1UNR A;  5CLQ B;  4ZRK A;  5DHF B;  4BBK A;  5HE2 A;  3KY9 A;  4EJN A;  2M14 A;  3X23 A;  1SGH A;  4WSF A;  4A5K A;  4F7H A;  4KHA A;  4IOY X;  1W1G A;  4ZRJ A;  1DDW A;  3DXD A;  2I5F A;  3ODW A;  1LB1 A;  3A8Q A;  1UPR A;  1ZVR A;  2D9X A;  3O96 A;  5C6R A;  1W1H A;  4HAZ B;  2P8V A;  4MT7 A;  4C0A A;  2COD A;  4IAP A;  2EJ8 A;  2DYQ A;  4NSW A;  5J3Q A;  3V5W A;  2D2Q A;  4K81 A;  3TO1 A;  2D4Q A;  2D9Y A;  2YT1 A;  1P3R A;  4DXA B;  1QC6 A;  3PSC A;  5DH9 B;  2MDX A;  5FI0 A;  5LON B;  3MDB C;  3VIA A;  2N23 A;  5D3Y A;  2R0D A;  3PEG A;  3PG7 A;  2M38 A;  2G35 A;  2W2X C;  4KHO A;  1WVH A;  1X11 A;  2IYB A;  5JHH A;  3CIK A;  4DX8 A;  4ZRI A;  3ULB A;  3RCP A;  3KRW A;  4F7U P;  1GC7 A;  1FAO A;  1KZG A;  2LG1 A;  1EF1 A;  2J0J A;  2P0H A;  2UVM A;  1K5D B;  1EGX A;  1XX0 A;  5J3T A;  3AJ4 A;  2VRW B;  2Q13 A;  4YL8 A;  4K2O A;  5D3W A;  5C5B B;  4F7G A;  5KQ1 A;  2K2J A;  3OAN A;  2Z0O A;  1K5G B;  2VKI A;  2YSZ A;  2YF0 A;  1Q67 A;  3FM8 C;  2YS1 A;  3HW2 B;  2MWN B;  1XOD A;  1U5G A;  2Y7B A;  2D9Z A;  4HDQ A;  1FHX A;  3GYO A;  4GMX B;  1QQG A;  4HB2 B;  4Y94 A;  3DXE A;  4HB4 B;  2OQB A;  1RJ2 A;  1PFJ A;  2D10 A;  4KVG B;  4HAY B;  3ZVR A;  2ADZ A;  3G9W A;  2LOX A;  2Y8F A;  2CAY A;  3T06 A;  1V61 A;  1M7E A;  1X1F A;  2YRY A;  2DKP A;  2ZPY A;  3D8D A;  4KHB B;  4HAT B;  2X18 A;  4A6H A;  4P7I A;  4HB0 B;  4MK0 A;  3SO6 A;  3TW1 A;  1ISN A;  1U29 A;  4YON A;  5EFX A;  1H4R A;  2COC A;  2E2X A;  1UNQ A;  2DHK A;  4CHJ A;  2LYD A;  1DDV A;  1V5M A;  2CY5 A;  3UZT A;  2D9V A;  5D3V A;  1E5W A;  2RGN B;  2YVC A;  1XR0 B;  1UEF A;  2RLO A;  1KI1 B;  4Z2M B;  2H7D A;  1I7A A;  3U8Z A;  2DN6 A;  1H10 A;  3D8E A;  5JP4 A;  1U5D A;  2Y8G A;  3AU4 A;  3QIJ A;  3BJI A;  2FJL A;  4HAX B;  1X86 A;  2JP2 A;  1FGZ A;  1WJ1 A;  4HDO A;  1WGQ A;  2DA0 A;  2UZS A;  2COA A;  4A6K A;  3SNH A;  2KCJ A;  2GCJ A;  2RNR B;  5J3Y A;  1NTY A;  1WG7 A;  2PZ1 A;  2MFQ A;  3KZ1 A;  1Y19 B;  3QWM A;  3AU5 A;  2EC1 A;  2MKR A;  2ELA A;  3A98 B;  2YS3 A;  5C16 A;  1P5T A;  2XQN M;  2Z0P A;  4CYE A;  4A6F B;  5LOP B;  4B6H A;  5D3X A;  4GZU A;  3M1I B;  2DX5 A;  4EKU A;  1DRO A;  2AEH A;  2D11 A;  1BTK A;  3ULC A;  1TJ6 A;  4WVF B;  1N3H A;  1XKE A;  1MIZ B;  2YT0 A;  4DX9 0;  1X05 A;  5DIF B;  1V89 A;  4MY6 A;  2DHI A;  1BAK A;  3SV1 A;  2K2U A;  2I5C A;  3ML4 A;  4K17 A;  1XCG A;  3F5R A;  2GCL A;  1OMW A;  2CRF A;  3A8P A;  1MPH A;  5JHG A;  1V5P A;  2GS0 A;  1AQC A;  2BCJ A;  3HK0 A;  4WJ7 A;  1FOE A;  4L6E A;  2J0K A;  2NMB A;  2DKQ A;  2J0M A;  1V5U A;  1Y5O A;  4GN1 A;  1AWE A;  4XWX A;  2DFK A;  3KSY A;  4EMO A;  2RSG A;  1LW3 A;  3D8F A;  2DLW A;  2DX1 A;  1ZM0 A;  5HE1 A;  5C5B A;  3U7D A;  3MPX A;  2YS5 A;  2P0F A;  3PVU A;  2COF A;  1ZC3 B;  2CY4 A;  2GJY A;  2ROZ B;  1MK7 B;  3PP2 A;  1BWN A;  3CXB B;  4D0N B;  2W2X D;  3KRX A;  4GMV A;  4PNK A;  4PQ0 A;  2QKL A;  1TXD A;  3WYF B;  4IFS A;  2DTC A;  2IFS A;  2D9W A;  3TFM A;  1OY2 A;  3WA0 A;  1M7R A;  1V88 A;  1EAZ A;  1B55 A;  3BIN A;  1MAI A;  4HAV B;  5CLL B;  1J0W A;  3FEH A;  2I1K A;  1MKE A;  5FI1 A;  1RRP B;  1NTV A;  1DDM A;  2LOZ A;  5C79 A;  1UPQ A;  1MIX A;  3QBV B;  3PVL A;  5L81 A;  1FGY A;  3FSS A;  1NI2 A;  1U5F A;  2ELB A;  1IRS A;  3ODX A;  2L1C A;  3P7Z A;  4HHV A;  4Z2N A;  2RUK B;  5KCV A;  3TCA A;  2KGX B;  1U2B A;  4K2P A;  1I2H A;  4GPT B;  1GC6 A;  1EVH A;  1MK9 B;  4TKN A;  2K00 A;  5KQ4 A;  3ODO A;  4HAU B;  2N0Y A;  2L2I A;  2AL6 A;  4KAX B;  1TQZ A;  3PZD A;  1DBH A;  1X1G A;  1GG3 A;  1P6S A;  2H7E A;  1DYN A;  1FB8 A;  2UZR A;  5DI9 B;  1SHC A;  2V76 A;  1NU2 A;  1WJM A;  2DHJ A;  2DYN A;  1UNP A;  2RVB B;  3NSU A;  3LJU X;  2VSZ A;  1J19 A;  1ZC4 B;  2QKM A;  5DHA B;  5GOW B;  2Z0Q A;  3N7C A;  1PMS A;  1U27 A;  2I1J A;  4DBB A;  2W2W A;  1FHO A;  2LKO A;  3DXC A;  4HB3 B;  2J59 M;  1KZ7 A;  1OQN A;  5HE0 A;  4NY0 A;  3GYP A;  2R09 A;  3ZDT A;  1FHW A;  1ZSQ A;  2LUL A;  2OTX A;  1BTN A;  4CHM A;  3F0W A;  2ROV A;  4TYZ A; 
#chains in the Genus database with same CATH topology
 1U5E A;  3IVF A;  3VOQ A;  2P0D A;  3PVW A;  5HE3 A;  1WGU A;  3P6A A;  1XD4 A;  4A6F A;  4HAW B;  2NZ8 B;  2HE7 A;  2KUP A;  3SYX A;  1WI1 A;  5D27 A;  5JLJ B;  1Z87 A;  4QJ4 B;  2EMT A;  2HTH B;  1T77 A;  3SUZ A;  4GXB A;  3HQC A;  3TVV A;  2EMS A;  1W1D A;  4H8S A;  1PLS A;  1UNR A;  5CLQ B;  4ZRK A;  5DHF B;  4QJ3 B;  4BBK A;  5HE2 A;  3KY9 A;  4EJN A;  2FJU B;  2M14 A;  3X23 A;  1SGH A;  4WSF A;  2YT2 A;  4A5K A;  4F7H A;  4KHA A;  4IOY X;  1W1G A;  4D6W A;  4ZRJ A;  1DDW A;  3U12 A;  3DXD A;  2I5F A;  3ODW A;  2K49 A;  1LB1 A;  3A8Q A;  1UPR A;  4HSI A;  1ZVR A;  2D9X A;  3O96 A;  5C6R A;  1W1H A;  4HAZ B;  4OT1 A;  2P8V A;  4MT7 A;  4C0A A;  2COD A;  4IAP A;  2EJ8 A;  2DYQ A;  4NSW A;  5J3Q A;  3V5W A;  2D2Q A;  4K81 A;  3TO1 A;  2D4Q A;  2D9Y A;  2YT1 A;  4GOU A;  1P3R A;  2ZKM X;  4DXA B;  1QC6 A;  3PSC A;  5DH9 B;  2MDX A;  5FI0 A;  5LON B;  3MDB C;  3VIA A;  2N23 A;  5D3Y A;  2R0D A;  3PEG A;  3PG7 A;  2M38 A;  2G35 A;  2W2X C;  4KHO A;  1WVH A;  1X11 A;  2IYB A;  5JHH A;  3CIK A;  4DX8 A;  4ZRI A;  3ULB A;  3RCP A;  3KRW A;  4F7U P;  1GC7 A;  3OHM B;  5M4Y B;  1FAO A;  1KZG A;  2LG1 A;  1EF1 A;  2J0J A;  2P0H A;  2UVM A;  1K5D B;  1EGX A;  1XX0 A;  5J3T A;  3AJ4 A;  2VRW B;  2Q13 A;  4YL8 A;  4K2O A;  2KR0 A;  5D3W A;  5C5B B;  4F7G A;  5KQ1 A;  2K2J A;  3OAN A;  2Z0O A;  1K5G B;  2VKI A;  2YSZ A;  2YF0 A;  1Q67 A;  3FM8 C;  2YS1 A;  3HW2 B;  2MWN B;  1XOD A;  1U5G A;  2KUQ A;  2Y7B A;  3HIE A;  2D9Z A;  4HDQ A;  1FHX A;  3GYO A;  4GMX B;  2R2Y A;  1QQG A;  4HB2 B;  3NWF A;  4Y94 A;  3DXE A;  4HB4 B;  2OQB A;  1RJ2 A;  1PFJ A;  2K8E A;  2D10 A;  4KVG B;  4HAY B;  3ZVR A;  2ADZ A;  3G9W A;  2LOX A;  2Y8F A;  2CAY A;  3T06 A;  1V61 A;  1M7E A;  1X1F A;  2YRY A;  2DKP A;  2RRF A;  2ZPY A;  3D8D A;  4KHB B;  4HAT B;  2X18 A;  4A6H A;  4P7I A;  4HB0 B;  4MK0 A;  3SO6 A;  3TW1 A;  1ISN A;  1U29 A;  3NWD A;  4YON A;  5EFX A;  4QXA B;  1H4R A;  2COC A;  2E2X A;  1UNQ A;  2DHK A;  4CHJ A;  2LYD A;  1DDV A;  1V5M A;  2CY5 A;  3UZT A;  2D9V A;  5I2S A;  5D3V A;  1E5W A;  2RGN B;  2YVC A;  1XR0 B;  1UEF A;  2RLO A;  1KI1 B;  4Z2M B;  2H7D A;  1I7A A;  2KIE A;  3U8Z A;  2DN6 A;  1H10 A;  3D8E A;  5JP4 A;  1U5D A;  2Y8G A;  3AU4 A;  3QIJ A;  4CSQ A;  3BJI A;  2FJL A;  4HAX B;  1X86 A;  2JP2 A;  1FGZ A;  1WJ1 A;  4HDO A;  1WGQ A;  2DA0 A;  5LG4 B;  2UZS A;  2COA A;  4A6K A;  3SNH A;  2KCJ A;  2GCJ A;  2RNR B;  1MI1 A;  5J3Y A;  1NTY A;  1WG7 A;  2PZ1 A;  2MFQ A;  3KZ1 A;  1Y19 B;  3QWM A;  3AU5 A;  2EC1 A;  2MKR A;  2ELA A;  3A98 B;  2YS3 A;  2Z4D A;  5C16 A;  1P5T A;  2XQN M;  2Z0P A;  4CYE A;  4A6F B;  5LOP B;  4B6H A;  2NBV A;  5D3X A;  4GZU A;  3M1I B;  2DX5 A;  4EKU A;  1DRO A;  2AEH A;  2D11 A;  1BTK A;  3ULC A;  1TJ6 A;  4WVF B;  1N3H A;  1XKE A;  3NW8 A;  3A58 A;  1MIZ B;  2YT0 A;  4DX9 0;  1X05 A;  5DIF B;  1V89 A;  4MY6 A;  2DHI A;  1BAK A;  3NWA A;  3SV1 A;  2K2U A;  2I5C A;  3ML4 A;  4K17 A;  1XCG A;  3F5R A;  2GCL A;  1OMW A;  2CRF A;  3A8P A;  1MPH A;  5JHG A;  1V5P A;  2GS0 A;  1AQC A;  2BCJ A;  3HK0 A;  4WJ7 A;  1FOE A;  4L6E A;  2J0K A;  2NMB A;  2DKQ A;  2J0M A;  1V5U A;  1Y5O A;  4GN1 A;  1AWE A;  4XWX A;  2DFK A;  3KSY A;  4OSN A;  4EMO A;  2RSG A;  1LW3 A;  3D8F A;  2DLW A;  2DX1 A;  1ZM0 A;  5HE1 A;  5C5B A;  2Z59 A;  3MPX A;  3U7D A;  2YS5 A;  2P0F A;  3PVU A;  2COF A;  1ZC3 B;  2CY4 A;  2GJY A;  2ROZ B;  1MK7 B;  3PP2 A;  1BWN A;  3CXB B;  4D0N B;  2GUM A;  2W2X D;  3KRX A;  4GMV A;  4PNK A;  5I2M A;  4DIX A;  3B77 A;  4PQ0 A;  2QKL A;  1TXD A;  3WYF B;  4IFS A;  2DTC A;  2IFS A;  2D9W A;  3TFM A;  1OY2 A;  3WA0 A;  1M7R A;  1V88 A;  3DCX A;  1EAZ A;  1B55 A;  3BIN A;  1MAI A;  4HAV B;  5CLL B;  1J0W A;  3FEH A;  2I1K A;  1MKE A;  5FI1 A;  1RRP B;  1NTV A;  4GNK B;  1DDM A;  2LOZ A;  5C79 A;  1UPQ A;  1MIX A;  3QBV B;  3PVL A;  5L81 A;  1FGY A;  3FSS A;  3FVC A;  1NI2 A;  4KHB A;  1U5F A;  2Z13 A;  2KIG A;  2ELB A;  1IRS A;  3ODX A;  2L1C A;  3P7Z A;  4HHV A;  4Z2N A;  2RUK B;  5KCV A;  3TCA A;  2KGX B;  1U2B A;  4K2P A;  1I2H A;  4GPT B;  1GC6 A;  1EVH A;  1MK9 B;  4TKN A;  2K00 A;  5KQ4 A;  3ODO A;  4HAU B;  1ZYI A;  2N0Y A;  2L2I A;  2AL6 A;  3HSA A;  4KAX B;  5IRS A;  4L1R A;  1TQZ A;  3PZD A;  1DBH A;  1X1G A;  1GG3 A;  1P6S A;  2H7E A;  2Z14 A;  1DYN A;  1FB8 A;  2UZR A;  5DI9 B;  1SHC A;  2V76 A;  1NU2 A;  1WJM A;  2DHJ A;  2DYN A;  4QJ5 B;  1UNP A;  2RVB B;  3NSU A;  3LJU X;  2VSZ A;  1J19 A;  1ZC4 B;  2QKM A;  5DHA B;  5GOW B;  2Z0Q A;  3N7C A;  1PMS A;  1U27 A;  2I1J A;  4DBB A;  2W2W A;  1FHO A;  2LKO A;  3DXC A;  4HB3 B;  2J59 M;  1KZ7 A;  1OQN A;  5HE0 A;  4NY0 A;  3GYP A;  2R09 A;  3ZDT A;  1FHW A;  1ZSQ A;  2LUL A;  2OTX A;  1BTN A;  4CHM A;  3F0W A;  2ROV A;  4TYZ A; 
#chains in the Genus database with same CATH homology
 1U5E A;  3IVF A;  3VOQ A;  2P0D A;  3PVW A;  5HE3 A;  1WGU A;  3P6A A;  1XD4 A;  4A6F A;  4HAW B;  2NZ8 B;  2HE7 A;  2KUP A;  3SYX A;  1WI1 A;  5D27 A;  5JLJ B;  1Z87 A;  2EMT A;  2HTH B;  3SUZ A;  4GXB A;  3HQC A;  3TVV A;  2EMS A;  1W1D A;  4H8S A;  1PLS A;  1UNR A;  5CLQ B;  4ZRK A;  5DHF B;  4BBK A;  5HE2 A;  3KY9 A;  4EJN A;  2M14 A;  3X23 A;  1SGH A;  4WSF A;  4A5K A;  4F7H A;  4KHA A;  4IOY X;  1W1G A;  4ZRJ A;  1DDW A;  3DXD A;  2I5F A;  3ODW A;  1LB1 A;  3A8Q A;  1UPR A;  1ZVR A;  2D9X A;  3O96 A;  5C6R A;  1W1H A;  4HAZ B;  2P8V A;  4MT7 A;  4C0A A;  2COD A;  4IAP A;  2EJ8 A;  2DYQ A;  4NSW A;  5J3Q A;  3V5W A;  2D2Q A;  4K81 A;  3TO1 A;  2D4Q A;  2D9Y A;  2YT1 A;  1P3R A;  4DXA B;  1QC6 A;  3PSC A;  5DH9 B;  2MDX A;  5FI0 A;  5LON B;  3MDB C;  3VIA A;  2N23 A;  5D3Y A;  2R0D A;  3PEG A;  3PG7 A;  2M38 A;  2G35 A;  2W2X C;  4KHO A;  1WVH A;  1X11 A;  2IYB A;  5JHH A;  3CIK A;  4DX8 A;  4ZRI A;  3ULB A;  3RCP A;  3KRW A;  4F7U P;  1GC7 A;  1FAO A;  1KZG A;  2LG1 A;  1EF1 A;  2J0J A;  2P0H A;  2UVM A;  1K5D B;  1EGX A;  1XX0 A;  5J3T A;  3AJ4 A;  2VRW B;  2Q13 A;  4YL8 A;  4K2O A;  5D3W A;  5C5B B;  4F7G A;  5KQ1 A;  2K2J A;  3OAN A;  2Z0O A;  1K5G B;  2VKI A;  2YSZ A;  2YF0 A;  1Q67 A;  3FM8 C;  2YS1 A;  3HW2 B;  2MWN B;  1XOD A;  1U5G A;  2Y7B A;  2D9Z A;  4HDQ A;  1FHX A;  3GYO A;  4GMX B;  1QQG A;  4HB2 B;  4Y94 A;  3DXE A;  4HB4 B;  2OQB A;  1RJ2 A;  1PFJ A;  2D10 A;  4KVG B;  4HAY B;  3ZVR A;  2ADZ A;  3G9W A;  2LOX A;  2Y8F A;  2CAY A;  3T06 A;  1V61 A;  1M7E A;  1X1F A;  2YRY A;  2DKP A;  2ZPY A;  3D8D A;  4KHB B;  4HAT B;  2X18 A;  4A6H A;  4P7I A;  4HB0 B;  4MK0 A;  3SO6 A;  3TW1 A;  1ISN A;  1U29 A;  4YON A;  5EFX A;  1H4R A;  2COC A;  2E2X A;  1UNQ A;  2DHK A;  4CHJ A;  2LYD A;  1DDV A;  1V5M A;  2CY5 A;  3UZT A;  2D9V A;  5D3V A;  1E5W A;  2RGN B;  2YVC A;  1XR0 B;  1UEF A;  2RLO A;  1KI1 B;  4Z2M B;  2H7D A;  1I7A A;  3U8Z A;  2DN6 A;  1H10 A;  3D8E A;  5JP4 A;  1U5D A;  2Y8G A;  3AU4 A;  3QIJ A;  3BJI A;  2FJL A;  4HAX B;  1X86 A;  2JP2 A;  1FGZ A;  1WJ1 A;  4HDO A;  1WGQ A;  2DA0 A;  2UZS A;  2COA A;  4A6K A;  3SNH A;  2KCJ A;  2GCJ A;  2RNR B;  5J3Y A;  1NTY A;  1WG7 A;  2PZ1 A;  2MFQ A;  3KZ1 A;  1Y19 B;  3QWM A;  3AU5 A;  2EC1 A;  2MKR A;  2ELA A;  3A98 B;  2YS3 A;  5C16 A;  1P5T A;  2XQN M;  2Z0P A;  4CYE A;  4A6F B;  5LOP B;  4B6H A;  5D3X A;  4GZU A;  3M1I B;  2DX5 A;  4EKU A;  1DRO A;  2AEH A;  2D11 A;  1BTK A;  3ULC A;  1TJ6 A;  4WVF B;  1N3H A;  1XKE A;  1MIZ B;  2YT0 A;  4DX9 0;  1X05 A;  5DIF B;  1V89 A;  4MY6 A;  2DHI A;  1BAK A;  3SV1 A;  2K2U A;  2I5C A;  3ML4 A;  4K17 A;  1XCG A;  3F5R A;  2GCL A;  1OMW A;  2CRF A;  3A8P A;  1MPH A;  5JHG A;  1V5P A;  2GS0 A;  1AQC A;  2BCJ A;  3HK0 A;  4WJ7 A;  1FOE A;  4L6E A;  2J0K A;  2NMB A;  2DKQ A;  2J0M A;  1V5U A;  1Y5O A;  4GN1 A;  1AWE A;  4XWX A;  2DFK A;  3KSY A;  4EMO A;  2RSG A;  1LW3 A;  3D8F A;  2DLW A;  2DX1 A;  1ZM0 A;  5HE1 A;  5C5B A;  3U7D A;  3MPX A;  2YS5 A;  2P0F A;  3PVU A;  2COF A;  1ZC3 B;  2CY4 A;  2GJY A;  2ROZ B;  1MK7 B;  3PP2 A;  1BWN A;  3CXB B;  4D0N B;  2W2X D;  3KRX A;  4GMV A;  4PNK A;  4PQ0 A;  2QKL A;  1TXD A;  3WYF B;  4IFS A;  2DTC A;  2IFS A;  2D9W A;  3TFM A;  1OY2 A;  3WA0 A;  1M7R A;  1V88 A;  1EAZ A;  1B55 A;  3BIN A;  1MAI A;  4HAV B;  5CLL B;  1J0W A;  3FEH A;  2I1K A;  1MKE A;  5FI1 A;  1RRP B;  1NTV A;  1DDM A;  2LOZ A;  5C79 A;  1UPQ A;  1MIX A;  3QBV B;  3PVL A;  5L81 A;  1FGY A;  3FSS A;  1NI2 A;  1U5F A;  2ELB A;  1IRS A;  3ODX A;  2L1C A;  3P7Z A;  4HHV A;  4Z2N A;  2RUK B;  5KCV A;  3TCA A;  2KGX B;  1U2B A;  4K2P A;  1I2H A;  4GPT B;  1GC6 A;  1EVH A;  1MK9 B;  4TKN A;  2K00 A;  5KQ4 A;  3ODO A;  4HAU B;  2N0Y A;  2L2I A;  2AL6 A;  4KAX B;  1TQZ A;  3PZD A;  1DBH A;  1X1G A;  1GG3 A;  1P6S A;  2H7E A;  1DYN A;  1FB8 A;  2UZR A;  5DI9 B;  1SHC A;  2V76 A;  1NU2 A;  1WJM A;  2DHJ A;  2DYN A;  1UNP A;  2RVB B;  3NSU A;  3LJU X;  2VSZ A;  1J19 A;  1ZC4 B;  2QKM A;  5DHA B;  5GOW B;  2Z0Q A;  3N7C A;  1PMS A;  1U27 A;  2I1J A;  4DBB A;  2W2W A;  1FHO A;  2LKO A;  3DXC A;  4HB3 B;  2J59 M;  1KZ7 A;  1OQN A;  5HE0 A;  4NY0 A;  3GYP A;  2R09 A;  3ZDT A;  1FHW A;  1ZSQ A;  2LUL A;  2OTX A;  1BTN A;  4CHM A;  3F0W A;  2ROV A;  4TYZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...