3ULCA

Crystal structure of the pleckstrin homology domain of saccharomyces cerevisiae avo1, a torc2 subunit, in the p3121 crystal form
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
110
structure length
100
Chain Sequence
AYHKYKVWRRQQMSFINKHERTLAIDGDYIYIVPPENVKTKSLHISQVVLVKKSKRVPEHFKIFVRRDDIKRYYFEAVSGQECTEIVTRLQNLLSAYRMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structures of the pleckstrin homology domain of Saccharomyces cerevisiae Avo1 and its human orthologue Sin1, an essential subunit of TOR complex 2
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Membrane protein
molecule keywords Target of rapamycin complex 2 subunit AVO1
total genus 19
structure length 100
sequence length 110
ec nomenclature
pdb deposition date 2011-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16979 SIN1_PH SAPK-interacting protein 1 (Sin1), Pleckstrin-homology
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3ulcA01
5JP4A 1WJ1A 1UEFA 4ZRKA 2D4QA 2G35A 4HB2B 2YRYA 5DI9B 4HB4B 1V5PA 2H7EA 3A8QA 1DBHA 4GXBA 1Y5OA 4WJ7A 3ODXA 1V5UA 5J3QA 1UPRA 3D8FA 1RJ2A 2YS1A 3KZ1A 1AWEA 5C5BB 4KHAA 4D0NB 2K00A 1UNPA 1NTVA 4K2OA 1FGZA 2VRWB 1V88A 1LW3A 4HHVA 1XCGA 2LOXA 2VSZA 4WVFB 2CY5A 5DIFB 3UZTA 2K2JA 4HATB 1M7RA 2P0FA 1LB1A 2UZRA 3VOQA 1BTKA 1NU2A 4K17A 3D8EA 1DDWA 1W1DA 1EVHA 1J0WA 5L81A 2Y7BA 2YSZA 5HE1A 2IYBA 1ZC3B 1ZSQA 3GYPA 4EMOA 1X05A 1OMWA 3PZDA 3PVWA 3AU5A 3FSSA 2GCLA 4C0AA 2BCJA 5D3WA 2RSGA 4DX8A 2DHIA 2YVCA 2ZPYA 3HW2B 1Z87A 1RRPB 3PP2A 3PVLA 5C6RA 3DXEA 2JP2A 1U5GA 4KHBB 2Z0OA 1WVHA 1X86A 5DHFB 1FGYA 1H4RA 4A6KA 4CHJA 1TQZA 1H10A 1IRSA 1FAOA 2GS0A 1U27A 2NZ8B 1MIXA 2Y8GA 3OANA 4L6EA 2X18A 2HE7A 4ZRIA 4HAXB 4NSWA 4HAVB 2YS5A 2E2XA 5GOWB 3M1IB 2CODA 1Q67A 3SV1A 1MKEA 1XODA 1N3HA 1I2HA 1MK7B 2COCA 1PMSA 4GN1A 5C16A 2M38A 4BBKA 2P8VA 5JHHA 5KCVA 4F7GA 2DKPA 2MDXA 1PFJA 1U5EA 1X1FA 3CIKA 3ULCA 3KSYA 2GCJA 2J0MA 3T06A 1WGQA 2D10A 2LOZA 2MFQA 3P6AA 1K5DB 2L1CA 5JLJB 4YONA 1J19A 3PVUA 2YT1A 2D9ZA 2J0JA 4A6FA 1W1GA 3ZDTA 4MY6A 2ELAA 3N7CA 4P7IA 2Y8FA 3PEGA 3PSCA 3U7DA 2MKRA 5CLLB 3RCPA 2UZSA 5FI1A 2GJYA 2ELBA 2H7DA 1EGXA 4KHOA 4HB3B 3TFMA 1AQCA 1QQGA 2DKQA 2P0DA 2RNRB 1B55A 5LONB 2QKMA 2EMSA 1M7EA 1X1GA 1WG7A 3HQCA 1NI2A 3NSUA 2M14A 1Y19B 3FM8C 4A6FB 2CRFA 2YF0A 3X23A 5KQ1A 5J3YA 2YS3A 2LKOA 1BTNA 1OQNA 2RVBB 1WI1A 4MK0A 1V5MA 2DX5A 1KI1B 3IVFA 3P7ZA 3SO6A 1QC6A 4GZUA 1XX0A 3KY9A 2RLOA 4H8SA 4EJNA 2XQNM 1FHXA 2N0YA 5DH9B 4XWXA 2P0HA 1MIZB 3TO1A 1DDVA 5J3TA 1TJ6A 1FHWA 1FOEA 2OTXA 5LOPB 2QKLA 2N23A 2R09A 5D3XA 2D9VA 2DA0A 4GMXB 5EFXA 1X11A 2DTCA 2I5FA 1WJMA 2D2QA 2EMTA 2EC1A 4K2PA 1ZC4B 4TKNA 3QWMA 1GC7A 5C5BA 1MAIA 2DLWA 2CY4A 3F0WA 1P5TA 3BINA 1PLSA 1ZVRA 4IFSA 2NMBA 2W2XC 2LYDA 5JHGA 1EAZA 4HAUB 3TVVA 1UNRA 2R0DA 3A8PA 2L2IA 5D27A 2DHJA 1V61A 2YT0A 3CXBB 4DXAB 1KZGA 5HE3A 3TCAA 3V5WA 3KRWA 4CHMA 3O96A 4Y94A 2Z0PA 1DROA 1EF1A 2J59M 1XR0B 2OQBA 5DHAB 1P6SA 5FI0A 4PQ0A 1ISNA 2DYNA 1OY2A 1I7AA 3PG7A 1XKEA 2DFKA 2DX1A 5HE2A 3AU4A 3QBVB 1FB8A 3LJUX 2DN6A 2J0KA 1W1HA 3ODOA 3TW1A 1SHCA 2W2WA 3WA0A 2ROZB 4HAZB 2COAA 2DYQA 2IFSA 2AL6A 5HE0A 2LG1A 3VIAA 4MT7A 3SUZA 4DBBA 1UPQA 3F5RA 2K2UA 5D3VA 3WYFB 1ZM0A 3BJIA 3MPXA 4DX90 2KGXB 2HTHB 2RUKB 2I1KA 1U5FA 1MK9B 1BAKA 3DXCA 3ODWA 3DXDA 1V89A 1WGUA 2V76A 4IOYX 1E5WA 2W2XD 2MWNB 2I5CA 2AEHA 3SYXA 1DDMA 1XD4A 1U2BA 2ADZA 2D9WA 3HK0A 4HDQA 4KVGB 4EKUA 1GG3A 2D11A 1UNQA 2PZ1A 1K5GB 3FEHA 3D8DA 1NTYA 3AJ4A 4F7HA 4A6HA 4PNKA 2COFA 4Z2NA 2FJLA 5D3YA 3ML4A 1TXDA 1U5DA 3MDBC 2Q13A 1P3RA 4GPTB 2D9YA 5CLQB 4K81A 4HAYB 3U8ZA 4YL8A 4TYZA 2EJ8A 1GC6A 2RGNB 2KUPA 4Z2MB 3KRXA 3A98B 2KCJA 2DHKA 5KQ4A 4NY0A 3GYOA 4GMVA 4B6HA 2LULA 2I1JA 4KAXB 1MPHA 4F7UP 4CYEA 2CAYA 2Z0QA 5C79A 4ZRJA 4A5KA 3G9WA 4HB0B 3ULBA 2UVMA 2VKIA 3ZVRA 1DYNA 4HAWB 4WSFA 1SGHA 1FHOA 1U29A 1KZ7A 3SNHA 2D9XA 4HDOA 1BWNA 2ROVA 3QIJA 4IAPA
chains in the Genus database with same CATH superfamily
5JP4A 1WJ1A 1UEFA 2Z4DA 4ZRKA 2D4QA 2G35A 4HB2B 2YRYA 3HSAA 5DI9B 4HB4B 1V5PA 2H7EA 3A8QA 1DBHA 1T77A 4GXBA 1Y5OA 4WJ7A 3ODXA 1V5UA 5J3QA 1UPRA 3D8FA 3OHMB 1RJ2A 4D6WA 2YS1A 3KZ1A 1AWEA 5C5BB 4KHAA 4D0NB 2K00A 1UNPA 1NTVA 4K2OA 1FGZA 2VRWB 1V88A 1LW3A 4HHVA 1XCGA 2FJUB 2LOXA 2VSZA 4WVFB 2CY5A 5DIFB 3UZTA 2YT2A 2K2JA 4HATB 1M7RA 2P0FA 1LB1A 2UZRA 3VOQA 1BTKA 1NU2A 4K17A 3D8EA 1DDWA 1W1DA 1EVHA 1J0WA 5L81A 2Y7BA 2YSZA 5HE1A 2IYBA 1ZC3B 1ZSQA 3GYPA 4OSNA 1X05A 4EMOA 1OMWA 3PZDA 3PVWA 3AU5A 3FSSA 2GCLA 4C0AA 5IRSA 2BCJA 5D3WA 2RSGA 4DX8A 2DHIA 2YVCA 2ZPYA 3HW2B 1Z87A 1RRPB 3PP2A 3PVLA 5C6RA 3DXEA 2JP2A 1U5GA 4KHBB 2Z0OA 1WVHA 4CSQA 1X86A 5DHFB 1FGYA 1H4RA 4A6KA 4CHJA 4QJ3B 1TQZA 5M4YB 1H10A 1IRSA 1FAOA 2GS0A 1U27A 4KHBA 2NZ8B 1MIXA 2Y8GA 5I2SA 3OANA 4L6EA 2X18A 2HE7A 4ZRIA 4HAXB 4NSWA 4HAVB 2YS5A 2E2XA 5GOWB 3M1IB 2CODA 1Q67A 3SV1A 1MKEA 4DIXA 1XODA 1N3HA 1I2HA 1MK7B 2COCA 1PMSA 4GN1A 5C16A 2M38A 4BBKA 2P8VA 5JHHA 5KCVA 4F7GA 2DKPA 2R2YA 2MDXA 1PFJA 1U5EA 1X1FA 3CIKA 3ULCA 3KSYA 2GCJA 4GNKB 2J0MA 3T06A 2K49A 1WGQA 2D10A 2LOZA 2MFQA 3P6AA 1K5DB 2L1CA 5JLJB 4YONA 1J19A 3PVUA 2YT1A 2D9ZA 2J0JA 4A6FA 1W1GA 3ZDTA 4MY6A 3U12A 2ELAA 3N7CA 4P7IA 2Y8FA 3PEGA 3PSCA 2KR0A 3U7DA 2MKRA 5CLLB 3RCPA 2GUMA 2UZSA 5FI1A 2GJYA 2ELBA 2H7DA 1EGXA 4KHOA 4HB3B 3TFMA 1AQCA 1QQGA 2DKQA 2P0DA 2RNRB 1B55A 5LONB 2QKMA 2EMSA 1M7EA 1X1GA 1WG7A 3HQCA 1NI2A 3NSUA 3B77A 2M14A 1Y19B 2Z13A 3FM8C 4A6FB 2CRFA 2YF0A 3X23A 5KQ1A 5J3YA 1MI1A 2YS3A 2LKOA 5I2MA 1BTNA 1OQNA 2RVBB 1WI1A 4MK0A 1V5MA 2DX5A 1KI1B 3IVFA 3P7ZA 3SO6A 1QC6A 4GZUA 1XX0A 3KY9A 2RLOA 4H8SA 4EJNA 2XQNM 1FHXA 2N0YA 5DH9B 4XWXA 2ZKMX 2P0HA 1MIZB 3TO1A 1DDVA 5J3TA 1TJ6A 1FHWA 1FOEA 2OTXA 5LOPB 2QKLA 2N23A 3FVCA 4HSIA 2R09A 5D3XA 2D9VA 2DA0A 4GMXB 5EFXA 1X11A 2DTCA 2I5FA 2K8EA 1WJMA 2D2QA 2EMTA 2EC1A 4K2PA 1ZC4B 4TKNA 3QWMA 1GC7A 5C5BA 1MAIA 2DLWA 2CY4A 1ZYIA 3F0WA 1P5TA 3BINA 1PLSA 1ZVRA 2NMBA 4IFSA 2W2XC 2LYDA 5JHGA 1EAZA 4HAUB 4QXAB 3TVVA 1UNRA 2R0DA 3A8PA 2RRFA 2L2IA 5D27A 2DHJA 1V61A 3HIEA 2YT0A 3CXBB 4DXAB 1KZGA 3NWAA 5HE3A 3TCAA 3V5WA 3KRWA 4CHMA 3O96A 4Y94A 2Z0PA 1DROA 1EF1A 2J59M 1XR0B 2OQBA 5DHAB 1P6SA 5FI0A 4PQ0A 1ISNA 2DYNA 1OY2A 1I7AA 3PG7A 1XKEA 2DFKA 3NWDA 2DX1A 5HE2A 3AU4A 3QBVB 1FB8A 3LJUX 2DN6A 2J0KA 1W1HA 3ODOA 3TW1A 1SHCA 2W2WA 3WA0A 2ROZB 4HAZB 2COAA 2DYQA 2IFSA 2AL6A 5HE0A 2LG1A 3VIAA 4MT7A 3SUZA 4DBBA 4OT1A 1UPQA 3F5RA 2K2UA 2Z59A 5D3VA 3WYFB 4QJ4B 1ZM0A 3BJIA 3MPXA 3NW8A 4DX90 2KGXB 2HTHB 2RUKB 2I1KA 1U5FA 1MK9B 1BAKA 2KUQA 3DXCA 3ODWA 3DXDA 1V89A 1WGUA 4L1RA 2V76A 4IOYX 1E5WA 2W2XD 2MWNB 2I5CA 3A58A 2AEHA 3SYXA 1DDMA 1XD4A 1U2BA 2ADZA 2D9WA 3HK0A 4HDQA 4KVGB 4EKUA 1GG3A 2D11A 1UNQA 2PZ1A 1K5GB 3FEHA 3D8DA 1NTYA 2KIGA 3AJ4A 4F7HA 4A6HA 4PNKA 4GOUA 2COFA 4Z2NA 2FJLA 5D3YA 2KIEA 3ML4A 1TXDA 1U5DA 2NBVA 3MDBC 2Q13A 1P3RA 3NWFA 4GPTB 2D9YA 5CLQB 4K81A 4HAYB 3U8ZA 4YL8A 4TYZA 2EJ8A 1GC6A 4QJ5B 2RGNB 2KUPA 2Z14A 4Z2MB 3KRXA 3A98B 2KCJA 2DHKA 5KQ4A 4NY0A 3GYOA 4GMVA 4B6HA 2LULA 2I1JA 4KAXB 1MPHA 4F7UP 4CYEA 2CAYA 2Z0QA 5C79A 4ZRJA 4A5KA 3G9WA 4HB0B 3ULBA 2UVMA 2VKIA 3ZVRA 1DYNA 4HAWB 4WSFA 1SGHA 1FHOA 1U29A 1KZ7A 3SNHA 5LG4B 3DCXA 2D9XA 4HDOA 1BWNA 2ROVA 3QIJA 4IAPA
chains in the Genus database with same CATH topology
5JP4A 1WJ1A 1UEFA 4ZRKA 2D4QA 2G35A 4HB2B 2YRYA 5DI9B 4HB4B 1V5PA 2H7EA 3A8QA 1DBHA 4GXBA 1Y5OA 4WJ7A 3ODXA 1V5UA 5J3QA 1UPRA 3D8FA 1RJ2A 2YS1A 3KZ1A 1AWEA 5C5BB 4KHAA 4D0NB 2K00A 1UNPA 1NTVA 4K2OA 1FGZA 2VRWB 1V88A 1LW3A 4HHVA 1XCGA 2LOXA 2VSZA 4WVFB 2CY5A 5DIFB 3UZTA 2K2JA 4HATB 1M7RA 2P0FA 1LB1A 2UZRA 3VOQA 1BTKA 1NU2A 4K17A 3D8EA 1DDWA 1W1DA 1EVHA 1J0WA 5L81A 2Y7BA 2YSZA 5HE1A 2IYBA 1ZC3B 1ZSQA 3GYPA 4EMOA 1X05A 1OMWA 3PZDA 3PVWA 3AU5A 3FSSA 2GCLA 4C0AA 2BCJA 5D3WA 2RSGA 4DX8A 2DHIA 2YVCA 2ZPYA 3HW2B 1Z87A 1RRPB 3PP2A 3PVLA 5C6RA 3DXEA 2JP2A 1U5GA 4KHBB 2Z0OA 1WVHA 1X86A 5DHFB 1FGYA 1H4RA 4A6KA 4CHJA 1TQZA 1H10A 1IRSA 1FAOA 2GS0A 1U27A 2NZ8B 1MIXA 2Y8GA 3OANA 4L6EA 2X18A 2HE7A 4ZRIA 4HAXB 4NSWA 4HAVB 2YS5A 2E2XA 5GOWB 3M1IB 2CODA 1Q67A 3SV1A 1MKEA 1XODA 1N3HA 1I2HA 1MK7B 2COCA 1PMSA 4GN1A 5C16A 2M38A 4BBKA 2P8VA 5JHHA 5KCVA 4F7GA 2DKPA 2MDXA 1PFJA 1U5EA 1X1FA 3CIKA 3ULCA 3KSYA 2GCJA 2J0MA 3T06A 1WGQA 2D10A 2LOZA 2MFQA 3P6AA 1K5DB 2L1CA 5JLJB 4YONA 1J19A 3PVUA 2YT1A 2D9ZA 2J0JA 4A6FA 1W1GA 3ZDTA 4MY6A 2ELAA 3N7CA 4P7IA 2Y8FA 3PEGA 3PSCA 3U7DA 2MKRA 5CLLB 3RCPA 2UZSA 5FI1A 2GJYA 2ELBA 2H7DA 1EGXA 4KHOA 4HB3B 3TFMA 1AQCA 1QQGA 2DKQA 2P0DA 2RNRB 1B55A 5LONB 2QKMA 2EMSA 1M7EA 1X1GA 1WG7A 3HQCA 1NI2A 3NSUA 2M14A 1Y19B 3FM8C 4A6FB 2CRFA 2YF0A 3X23A 5KQ1A 5J3YA 2YS3A 2LKOA 1BTNA 1OQNA 2RVBB 1WI1A 4MK0A 1V5MA 2DX5A 1KI1B 3IVFA 3P7ZA 3SO6A 1QC6A 4GZUA 1XX0A 3KY9A 2RLOA 4H8SA 4EJNA 2XQNM 1FHXA 2N0YA 5DH9B 4XWXA 2P0HA 1MIZB 3TO1A 1DDVA 5J3TA 1TJ6A 1FHWA 1FOEA 2OTXA 5LOPB 2QKLA 2N23A 2R09A 5D3XA 2D9VA 2DA0A 4GMXB 5EFXA 1X11A 2DTCA 2I5FA 1WJMA 2D2QA 2EMTA 2EC1A 4K2PA 1ZC4B 4TKNA 3QWMA 1GC7A 5C5BA 1MAIA 2DLWA 2CY4A 3F0WA 1P5TA 3BINA 1PLSA 1ZVRA 4IFSA 2NMBA 2W2XC 2LYDA 5JHGA 1EAZA 4HAUB 3TVVA 1UNRA 2R0DA 3A8PA 2L2IA 5D27A 2DHJA 1V61A 2YT0A 3CXBB 4DXAB 1KZGA 5HE3A 3TCAA 3V5WA 3KRWA 4CHMA 3O96A 4Y94A 2Z0PA 1DROA 1EF1A 2J59M 1XR0B 2OQBA 5DHAB 1P6SA 5FI0A 4PQ0A 1ISNA 2DYNA 1OY2A 1I7AA 3PG7A 1XKEA 2DFKA 2DX1A 5HE2A 3AU4A 3QBVB 1FB8A 3LJUX 2DN6A 2J0KA 1W1HA 3ODOA 3TW1A 1SHCA 2W2WA 3WA0A 2ROZB 4HAZB 2COAA 2DYQA 2IFSA 2AL6A 5HE0A 2LG1A 3VIAA 4MT7A 3SUZA 4DBBA 1UPQA 3F5RA 2K2UA 5D3VA 3WYFB 1ZM0A 3BJIA 3MPXA 4DX90 2KGXB 2HTHB 2RUKB 2I1KA 1U5FA 1MK9B 1BAKA 3DXCA 3ODWA 3DXDA 1V89A 1WGUA 2V76A 4IOYX 1E5WA 2W2XD 2MWNB 2I5CA 2AEHA 3SYXA 1DDMA 1XD4A 1U2BA 2ADZA 2D9WA 3HK0A 4HDQA 4KVGB 4EKUA 1GG3A 2D11A 1UNQA 2PZ1A 1K5GB 3FEHA 3D8DA 1NTYA 3AJ4A 4F7HA 4A6HA 4PNKA 2COFA 4Z2NA 2FJLA 5D3YA 3ML4A 1TXDA 1U5DA 3MDBC 2Q13A 1P3RA 4GPTB 2D9YA 5CLQB 4K81A 4HAYB 3U8ZA 4YL8A 4TYZA 2EJ8A 1GC6A 2RGNB 2KUPA 4Z2MB 3KRXA 3A98B 2KCJA 2DHKA 5KQ4A 4NY0A 3GYOA 4GMVA 4B6HA 2LULA 2I1JA 4KAXB 1MPHA 4F7UP 4CYEA 2CAYA 2Z0QA 5C79A 4ZRJA 4A5KA 3G9WA 4HB0B 3ULBA 2UVMA 2VKIA 3ZVRA 1DYNA 4HAWB 4WSFA 1SGHA 1FHOA 1U29A 1KZ7A 3SNHA 2D9XA 4HDOA 1BWNA 2ROVA 3QIJA 4IAPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JP4 A;  1WJ1 A;  1UEF A;  4ZRK A;  2D4Q A;  2G35 A;  4HB2 B;  2YRY A;  5DI9 B;  4HB4 B;  1V5P A;  2H7E A;  3A8Q A;  1DBH A;  4GXB A;  1Y5O A;  4WJ7 A;  3ODX A;  1V5U A;  5J3Q A;  1UPR A;  3D8F A;  1RJ2 A;  2YS1 A;  3KZ1 A;  1AWE A;  5C5B B;  4KHA A;  4D0N B;  2K00 A;  1UNP A;  1NTV A;  4K2O A;  1FGZ A;  2VRW B;  1V88 A;  1LW3 A;  4HHV A;  1XCG A;  2LOX A;  2VSZ A;  4WVF B;  2CY5 A;  5DIF B;  3UZT A;  2K2J A;  4HAT B;  1M7R A;  2P0F A;  1LB1 A;  2UZR A;  3VOQ A;  1BTK A;  1NU2 A;  4K17 A;  3D8E A;  1DDW A;  1W1D A;  1EVH A;  1J0W A;  5L81 A;  2Y7B A;  2YSZ A;  5HE1 A;  2IYB A;  1ZC3 B;  1ZSQ A;  3GYP A;  4EMO A;  1X05 A;  1OMW A;  3PZD A;  3PVW A;  3AU5 A;  3FSS A;  2GCL A;  4C0A A;  2BCJ A;  5D3W A;  2RSG A;  4DX8 A;  2DHI A;  2YVC A;  2ZPY A;  3HW2 B;  1Z87 A;  1RRP B;  3PP2 A;  3PVL A;  5C6R A;  3DXE A;  2JP2 A;  1U5G A;  4KHB B;  2Z0O A;  1WVH A;  1X86 A;  5DHF B;  1FGY A;  1H4R A;  4A6K A;  4CHJ A;  1TQZ A;  1H10 A;  1IRS A;  1FAO A;  2GS0 A;  1U27 A;  2NZ8 B;  1MIX A;  2Y8G A;  3OAN A;  4L6E A;  2X18 A;  2HE7 A;  4ZRI A;  4HAX B;  4NSW A;  4HAV B;  2YS5 A;  2E2X A;  5GOW B;  3M1I B;  2COD A;  1Q67 A;  3SV1 A;  1MKE A;  1XOD A;  1N3H A;  1I2H A;  1MK7 B;  2COC A;  1PMS A;  4GN1 A;  5C16 A;  2M38 A;  4BBK A;  2P8V A;  5JHH A;  5KCV A;  4F7G A;  2DKP A;  2MDX A;  1PFJ A;  1U5E A;  1X1F A;  3CIK A;  3ULC A;  3KSY A;  2GCJ A;  2J0M A;  3T06 A;  1WGQ A;  2D10 A;  2LOZ A;  2MFQ A;  3P6A A;  1K5D B;  2L1C A;  5JLJ B;  4YON A;  1J19 A;  3PVU A;  2YT1 A;  2D9Z A;  2J0J A;  4A6F A;  1W1G A;  3ZDT A;  4MY6 A;  2ELA A;  3N7C A;  4P7I A;  2Y8F A;  3PEG A;  3PSC A;  3U7D A;  2MKR A;  5CLL B;  3RCP A;  2UZS A;  5FI1 A;  2GJY A;  2ELB A;  2H7D A;  1EGX A;  4KHO A;  4HB3 B;  3TFM A;  1AQC A;  1QQG A;  2DKQ A;  2P0D A;  2RNR B;  1B55 A;  5LON B;  2QKM A;  2EMS A;  1M7E A;  1X1G A;  1WG7 A;  3HQC A;  1NI2 A;  3NSU A;  2M14 A;  1Y19 B;  3FM8 C;  4A6F B;  2CRF A;  2YF0 A;  3X23 A;  5KQ1 A;  5J3Y A;  2YS3 A;  2LKO A;  1BTN A;  1OQN A;  2RVB B;  1WI1 A;  4MK0 A;  1V5M A;  2DX5 A;  1KI1 B;  3IVF A;  3P7Z A;  3SO6 A;  1QC6 A;  4GZU A;  1XX0 A;  3KY9 A;  2RLO A;  4H8S A;  4EJN A;  2XQN M;  1FHX A;  2N0Y A;  5DH9 B;  4XWX A;  2P0H A;  1MIZ B;  3TO1 A;  1DDV A;  5J3T A;  1TJ6 A;  1FHW A;  1FOE A;  2OTX A;  5LOP B;  2QKL A;  2N23 A;  2R09 A;  5D3X A;  2D9V A;  2DA0 A;  4GMX B;  5EFX A;  1X11 A;  2DTC A;  2I5F A;  1WJM A;  2D2Q A;  2EMT A;  2EC1 A;  4K2P A;  1ZC4 B;  4TKN A;  3QWM A;  1GC7 A;  5C5B A;  1MAI A;  2DLW A;  2CY4 A;  3F0W A;  1P5T A;  3BIN A;  1PLS A;  1ZVR A;  4IFS A;  2NMB A;  2W2X C;  2LYD A;  5JHG A;  1EAZ A;  4HAU B;  3TVV A;  1UNR A;  2R0D A;  3A8P A;  2L2I A;  5D27 A;  2DHJ A;  1V61 A;  2YT0 A;  3CXB B;  4DXA B;  1KZG A;  5HE3 A;  3TCA A;  3V5W A;  3KRW A;  4CHM A;  3O96 A;  4Y94 A;  2Z0P A;  1DRO A;  1EF1 A;  2J59 M;  1XR0 B;  2OQB A;  5DHA B;  1P6S A;  5FI0 A;  4PQ0 A;  1ISN A;  2DYN A;  1OY2 A;  1I7A A;  3PG7 A;  1XKE A;  2DFK A;  2DX1 A;  5HE2 A;  3AU4 A;  3QBV B;  1FB8 A;  3LJU X;  2DN6 A;  2J0K A;  1W1H A;  3ODO A;  3TW1 A;  1SHC A;  2W2W A;  3WA0 A;  2ROZ B;  4HAZ B;  2COA A;  2DYQ A;  2IFS A;  2AL6 A;  5HE0 A;  2LG1 A;  3VIA A;  4MT7 A;  3SUZ A;  4DBB A;  1UPQ A;  3F5R A;  2K2U A;  5D3V A;  3WYF B;  1ZM0 A;  3BJI A;  3MPX A;  4DX9 0;  2KGX B;  2HTH B;  2RUK B;  2I1K A;  1U5F A;  1MK9 B;  1BAK A;  3DXC A;  3ODW A;  3DXD A;  1V89 A;  1WGU A;  2V76 A;  4IOY X;  1E5W A;  2W2X D;  2MWN B;  2I5C A;  2AEH A;  3SYX A;  1DDM A;  1XD4 A;  1U2B A;  2ADZ A;  2D9W A;  3HK0 A;  4HDQ A;  4KVG B;  4EKU A;  1GG3 A;  2D11 A;  1UNQ A;  2PZ1 A;  1K5G B;  3FEH A;  3D8D A;  1NTY A;  3AJ4 A;  4F7H A;  4A6H A;  4PNK A;  2COF A;  4Z2N A;  2FJL A;  5D3Y A;  3ML4 A;  1TXD A;  1U5D A;  3MDB C;  2Q13 A;  1P3R A;  4GPT B;  2D9Y A;  5CLQ B;  4K81 A;  4HAY B;  3U8Z A;  4YL8 A;  4TYZ A;  2EJ8 A;  1GC6 A;  2RGN B;  2KUP A;  4Z2M B;  3KRX A;  3A98 B;  2KCJ A;  2DHK A;  5KQ4 A;  4NY0 A;  3GYO A;  4GMV A;  4B6H A;  2LUL A;  2I1J A;  4KAX B;  1MPH A;  4F7U P;  4CYE A;  2CAY A;  2Z0Q A;  5C79 A;  4ZRJ A;  4A5K A;  3G9W A;  4HB0 B;  3ULB A;  2UVM A;  2VKI A;  3ZVR A;  1DYN A;  4HAW B;  4WSF A;  1SGH A;  1FHO A;  1U29 A;  1KZ7 A;  3SNH A;  2D9X A;  4HDO A;  1BWN A;  2ROV A;  3QIJ A;  4IAP A; 
#chains in the Genus database with same CATH topology
 5JP4 A;  1WJ1 A;  1UEF A;  2Z4D A;  4ZRK A;  2D4Q A;  2G35 A;  4HB2 B;  2YRY A;  3HSA A;  5DI9 B;  4HB4 B;  1V5P A;  2H7E A;  3A8Q A;  1DBH A;  1T77 A;  4GXB A;  1Y5O A;  4WJ7 A;  3ODX A;  1V5U A;  5J3Q A;  1UPR A;  3D8F A;  3OHM B;  1RJ2 A;  4D6W A;  2YS1 A;  3KZ1 A;  1AWE A;  5C5B B;  4KHA A;  4D0N B;  2K00 A;  1UNP A;  1NTV A;  4K2O A;  1FGZ A;  2VRW B;  1V88 A;  1LW3 A;  4HHV A;  1XCG A;  2FJU B;  2LOX A;  2VSZ A;  4WVF B;  2CY5 A;  5DIF B;  3UZT A;  2YT2 A;  2K2J A;  4HAT B;  1M7R A;  2P0F A;  1LB1 A;  2UZR A;  3VOQ A;  1BTK A;  1NU2 A;  4K17 A;  3D8E A;  1DDW A;  1W1D A;  1EVH A;  1J0W A;  5L81 A;  2Y7B A;  2YSZ A;  5HE1 A;  2IYB A;  1ZC3 B;  1ZSQ A;  3GYP A;  4OSN A;  1X05 A;  4EMO A;  1OMW A;  3PZD A;  3PVW A;  3AU5 A;  3FSS A;  2GCL A;  4C0A A;  5IRS A;  2BCJ A;  5D3W A;  2RSG A;  4DX8 A;  2DHI A;  2YVC A;  2ZPY A;  3HW2 B;  1Z87 A;  1RRP B;  3PP2 A;  3PVL A;  5C6R A;  3DXE A;  2JP2 A;  1U5G A;  4KHB B;  2Z0O A;  1WVH A;  4CSQ A;  1X86 A;  5DHF B;  1FGY A;  1H4R A;  4A6K A;  4CHJ A;  4QJ3 B;  1TQZ A;  5M4Y B;  1H10 A;  1IRS A;  1FAO A;  2GS0 A;  1U27 A;  4KHB A;  2NZ8 B;  1MIX A;  2Y8G A;  5I2S A;  3OAN A;  4L6E A;  2X18 A;  2HE7 A;  4ZRI A;  4HAX B;  4NSW A;  4HAV B;  2YS5 A;  2E2X A;  5GOW B;  3M1I B;  2COD A;  1Q67 A;  3SV1 A;  1MKE A;  4DIX A;  1XOD A;  1N3H A;  1I2H A;  1MK7 B;  2COC A;  1PMS A;  4GN1 A;  5C16 A;  2M38 A;  4BBK A;  2P8V A;  5JHH A;  5KCV A;  4F7G A;  2DKP A;  2R2Y A;  2MDX A;  1PFJ A;  1U5E A;  1X1F A;  3CIK A;  3ULC A;  3KSY A;  2GCJ A;  4GNK B;  2J0M A;  3T06 A;  2K49 A;  1WGQ A;  2D10 A;  2LOZ A;  2MFQ A;  3P6A A;  1K5D B;  2L1C A;  5JLJ B;  4YON A;  1J19 A;  3PVU A;  2YT1 A;  2D9Z A;  2J0J A;  4A6F A;  1W1G A;  3ZDT A;  4MY6 A;  3U12 A;  2ELA A;  3N7C A;  4P7I A;  2Y8F A;  3PEG A;  3PSC A;  2KR0 A;  3U7D A;  2MKR A;  5CLL B;  3RCP A;  2GUM A;  2UZS A;  5FI1 A;  2GJY A;  2ELB A;  2H7D A;  1EGX A;  4KHO A;  4HB3 B;  3TFM A;  1AQC A;  1QQG A;  2DKQ A;  2P0D A;  2RNR B;  1B55 A;  5LON B;  2QKM A;  2EMS A;  1M7E A;  1X1G A;  1WG7 A;  3HQC A;  1NI2 A;  3NSU A;  3B77 A;  2M14 A;  1Y19 B;  2Z13 A;  3FM8 C;  4A6F B;  2CRF A;  2YF0 A;  3X23 A;  5KQ1 A;  5J3Y A;  1MI1 A;  2YS3 A;  2LKO A;  5I2M A;  1BTN A;  1OQN A;  2RVB B;  1WI1 A;  4MK0 A;  1V5M A;  2DX5 A;  1KI1 B;  3IVF A;  3P7Z A;  3SO6 A;  1QC6 A;  4GZU A;  1XX0 A;  3KY9 A;  2RLO A;  4H8S A;  4EJN A;  2XQN M;  1FHX A;  2N0Y A;  5DH9 B;  4XWX A;  2ZKM X;  2P0H A;  1MIZ B;  3TO1 A;  1DDV A;  5J3T A;  1TJ6 A;  1FHW A;  1FOE A;  2OTX A;  5LOP B;  2QKL A;  2N23 A;  3FVC A;  4HSI A;  2R09 A;  5D3X A;  2D9V A;  2DA0 A;  4GMX B;  5EFX A;  1X11 A;  2DTC A;  2I5F A;  2K8E A;  1WJM A;  2D2Q A;  2EMT A;  2EC1 A;  4K2P A;  1ZC4 B;  4TKN A;  3QWM A;  1GC7 A;  5C5B A;  1MAI A;  2DLW A;  2CY4 A;  1ZYI A;  3F0W A;  1P5T A;  3BIN A;  1PLS A;  1ZVR A;  2NMB A;  4IFS A;  2W2X C;  2LYD A;  5JHG A;  1EAZ A;  4HAU B;  4QXA B;  3TVV A;  1UNR A;  2R0D A;  3A8P A;  2RRF A;  2L2I A;  5D27 A;  2DHJ A;  1V61 A;  3HIE A;  2YT0 A;  3CXB B;  4DXA B;  1KZG A;  3NWA A;  5HE3 A;  3TCA A;  3V5W A;  3KRW A;  4CHM A;  3O96 A;  4Y94 A;  2Z0P A;  1DRO A;  1EF1 A;  2J59 M;  1XR0 B;  2OQB A;  5DHA B;  1P6S A;  5FI0 A;  4PQ0 A;  1ISN A;  2DYN A;  1OY2 A;  1I7A A;  3PG7 A;  1XKE A;  2DFK A;  3NWD A;  2DX1 A;  5HE2 A;  3AU4 A;  3QBV B;  1FB8 A;  3LJU X;  2DN6 A;  2J0K A;  1W1H A;  3ODO A;  3TW1 A;  1SHC A;  2W2W A;  3WA0 A;  2ROZ B;  4HAZ B;  2COA A;  2DYQ A;  2IFS A;  2AL6 A;  5HE0 A;  2LG1 A;  3VIA A;  4MT7 A;  3SUZ A;  4DBB A;  4OT1 A;  1UPQ A;  3F5R A;  2K2U A;  2Z59 A;  5D3V A;  3WYF B;  4QJ4 B;  1ZM0 A;  3BJI A;  3MPX A;  3NW8 A;  4DX9 0;  2KGX B;  2HTH B;  2RUK B;  2I1K A;  1U5F A;  1MK9 B;  1BAK A;  2KUQ A;  3DXC A;  3ODW A;  3DXD A;  1V89 A;  1WGU A;  4L1R A;  2V76 A;  4IOY X;  1E5W A;  2W2X D;  2MWN B;  2I5C A;  3A58 A;  2AEH A;  3SYX A;  1DDM A;  1XD4 A;  1U2B A;  2ADZ A;  2D9W A;  3HK0 A;  4HDQ A;  4KVG B;  4EKU A;  1GG3 A;  2D11 A;  1UNQ A;  2PZ1 A;  1K5G B;  3FEH A;  3D8D A;  1NTY A;  2KIG A;  3AJ4 A;  4F7H A;  4A6H A;  4PNK A;  4GOU A;  2COF A;  4Z2N A;  2FJL A;  5D3Y A;  2KIE A;  3ML4 A;  1TXD A;  1U5D A;  2NBV A;  3MDB C;  2Q13 A;  1P3R A;  3NWF A;  4GPT B;  2D9Y A;  5CLQ B;  4K81 A;  4HAY B;  3U8Z A;  4YL8 A;  4TYZ A;  2EJ8 A;  1GC6 A;  4QJ5 B;  2RGN B;  2KUP A;  2Z14 A;  4Z2M B;  3KRX A;  3A98 B;  2KCJ A;  2DHK A;  5KQ4 A;  4NY0 A;  3GYO A;  4GMV A;  4B6H A;  2LUL A;  2I1J A;  4KAX B;  1MPH A;  4F7U P;  4CYE A;  2CAY A;  2Z0Q A;  5C79 A;  4ZRJ A;  4A5K A;  3G9W A;  4HB0 B;  3ULB A;  2UVM A;  2VKI A;  3ZVR A;  1DYN A;  4HAW B;  4WSF A;  1SGH A;  1FHO A;  1U29 A;  1KZ7 A;  3SNH A;  5LG4 B;  3DCX A;  2D9X A;  4HDO A;  1BWN A;  2ROV A;  3QIJ A;  4IAP A; 
#chains in the Genus database with same CATH homology
 5JP4 A;  1WJ1 A;  1UEF A;  4ZRK A;  2D4Q A;  2G35 A;  4HB2 B;  2YRY A;  5DI9 B;  4HB4 B;  1V5P A;  2H7E A;  3A8Q A;  1DBH A;  4GXB A;  1Y5O A;  4WJ7 A;  3ODX A;  1V5U A;  5J3Q A;  1UPR A;  3D8F A;  1RJ2 A;  2YS1 A;  3KZ1 A;  1AWE A;  5C5B B;  4KHA A;  4D0N B;  2K00 A;  1UNP A;  1NTV A;  4K2O A;  1FGZ A;  2VRW B;  1V88 A;  1LW3 A;  4HHV A;  1XCG A;  2LOX A;  2VSZ A;  4WVF B;  2CY5 A;  5DIF B;  3UZT A;  2K2J A;  4HAT B;  1M7R A;  2P0F A;  1LB1 A;  2UZR A;  3VOQ A;  1BTK A;  1NU2 A;  4K17 A;  3D8E A;  1DDW A;  1W1D A;  1EVH A;  1J0W A;  5L81 A;  2Y7B A;  2YSZ A;  5HE1 A;  2IYB A;  1ZC3 B;  1ZSQ A;  3GYP A;  4EMO A;  1X05 A;  1OMW A;  3PZD A;  3PVW A;  3AU5 A;  3FSS A;  2GCL A;  4C0A A;  2BCJ A;  5D3W A;  2RSG A;  4DX8 A;  2DHI A;  2YVC A;  2ZPY A;  3HW2 B;  1Z87 A;  1RRP B;  3PP2 A;  3PVL A;  5C6R A;  3DXE A;  2JP2 A;  1U5G A;  4KHB B;  2Z0O A;  1WVH A;  1X86 A;  5DHF B;  1FGY A;  1H4R A;  4A6K A;  4CHJ A;  1TQZ A;  1H10 A;  1IRS A;  1FAO A;  2GS0 A;  1U27 A;  2NZ8 B;  1MIX A;  2Y8G A;  3OAN A;  4L6E A;  2X18 A;  2HE7 A;  4ZRI A;  4HAX B;  4NSW A;  4HAV B;  2YS5 A;  2E2X A;  5GOW B;  3M1I B;  2COD A;  1Q67 A;  3SV1 A;  1MKE A;  1XOD A;  1N3H A;  1I2H A;  1MK7 B;  2COC A;  1PMS A;  4GN1 A;  5C16 A;  2M38 A;  4BBK A;  2P8V A;  5JHH A;  5KCV A;  4F7G A;  2DKP A;  2MDX A;  1PFJ A;  1U5E A;  1X1F A;  3CIK A;  3ULC A;  3KSY A;  2GCJ A;  2J0M A;  3T06 A;  1WGQ A;  2D10 A;  2LOZ A;  2MFQ A;  3P6A A;  1K5D B;  2L1C A;  5JLJ B;  4YON A;  1J19 A;  3PVU A;  2YT1 A;  2D9Z A;  2J0J A;  4A6F A;  1W1G A;  3ZDT A;  4MY6 A;  2ELA A;  3N7C A;  4P7I A;  2Y8F A;  3PEG A;  3PSC A;  3U7D A;  2MKR A;  5CLL B;  3RCP A;  2UZS A;  5FI1 A;  2GJY A;  2ELB A;  2H7D A;  1EGX A;  4KHO A;  4HB3 B;  3TFM A;  1AQC A;  1QQG A;  2DKQ A;  2P0D A;  2RNR B;  1B55 A;  5LON B;  2QKM A;  2EMS A;  1M7E A;  1X1G A;  1WG7 A;  3HQC A;  1NI2 A;  3NSU A;  2M14 A;  1Y19 B;  3FM8 C;  4A6F B;  2CRF A;  2YF0 A;  3X23 A;  5KQ1 A;  5J3Y A;  2YS3 A;  2LKO A;  1BTN A;  1OQN A;  2RVB B;  1WI1 A;  4MK0 A;  1V5M A;  2DX5 A;  1KI1 B;  3IVF A;  3P7Z A;  3SO6 A;  1QC6 A;  4GZU A;  1XX0 A;  3KY9 A;  2RLO A;  4H8S A;  4EJN A;  2XQN M;  1FHX A;  2N0Y A;  5DH9 B;  4XWX A;  2P0H A;  1MIZ B;  3TO1 A;  1DDV A;  5J3T A;  1TJ6 A;  1FHW A;  1FOE A;  2OTX A;  5LOP B;  2QKL A;  2N23 A;  2R09 A;  5D3X A;  2D9V A;  2DA0 A;  4GMX B;  5EFX A;  1X11 A;  2DTC A;  2I5F A;  1WJM A;  2D2Q A;  2EMT A;  2EC1 A;  4K2P A;  1ZC4 B;  4TKN A;  3QWM A;  1GC7 A;  5C5B A;  1MAI A;  2DLW A;  2CY4 A;  3F0W A;  1P5T A;  3BIN A;  1PLS A;  1ZVR A;  4IFS A;  2NMB A;  2W2X C;  2LYD A;  5JHG A;  1EAZ A;  4HAU B;  3TVV A;  1UNR A;  2R0D A;  3A8P A;  2L2I A;  5D27 A;  2DHJ A;  1V61 A;  2YT0 A;  3CXB B;  4DXA B;  1KZG A;  5HE3 A;  3TCA A;  3V5W A;  3KRW A;  4CHM A;  3O96 A;  4Y94 A;  2Z0P A;  1DRO A;  1EF1 A;  2J59 M;  1XR0 B;  2OQB A;  5DHA B;  1P6S A;  5FI0 A;  4PQ0 A;  1ISN A;  2DYN A;  1OY2 A;  1I7A A;  3PG7 A;  1XKE A;  2DFK A;  2DX1 A;  5HE2 A;  3AU4 A;  3QBV B;  1FB8 A;  3LJU X;  2DN6 A;  2J0K A;  1W1H A;  3ODO A;  3TW1 A;  1SHC A;  2W2W A;  3WA0 A;  2ROZ B;  4HAZ B;  2COA A;  2DYQ A;  2IFS A;  2AL6 A;  5HE0 A;  2LG1 A;  3VIA A;  4MT7 A;  3SUZ A;  4DBB A;  1UPQ A;  3F5R A;  2K2U A;  5D3V A;  3WYF B;  1ZM0 A;  3BJI A;  3MPX A;  4DX9 0;  2KGX B;  2HTH B;  2RUK B;  2I1K A;  1U5F A;  1MK9 B;  1BAK A;  3DXC A;  3ODW A;  3DXD A;  1V89 A;  1WGU A;  2V76 A;  4IOY X;  1E5W A;  2W2X D;  2MWN B;  2I5C A;  2AEH A;  3SYX A;  1DDM A;  1XD4 A;  1U2B A;  2ADZ A;  2D9W A;  3HK0 A;  4HDQ A;  4KVG B;  4EKU A;  1GG3 A;  2D11 A;  1UNQ A;  2PZ1 A;  1K5G B;  3FEH A;  3D8D A;  1NTY A;  3AJ4 A;  4F7H A;  4A6H A;  4PNK A;  2COF A;  4Z2N A;  2FJL A;  5D3Y A;  3ML4 A;  1TXD A;  1U5D A;  3MDB C;  2Q13 A;  1P3R A;  4GPT B;  2D9Y A;  5CLQ B;  4K81 A;  4HAY B;  3U8Z A;  4YL8 A;  4TYZ A;  2EJ8 A;  1GC6 A;  2RGN B;  2KUP A;  4Z2M B;  3KRX A;  3A98 B;  2KCJ A;  2DHK A;  5KQ4 A;  4NY0 A;  3GYO A;  4GMV A;  4B6H A;  2LUL A;  2I1J A;  4KAX B;  1MPH A;  4F7U P;  4CYE A;  2CAY A;  2Z0Q A;  5C79 A;  4ZRJ A;  4A5K A;  3G9W A;  4HB0 B;  3ULB A;  2UVM A;  2VKI A;  3ZVR A;  1DYN A;  4HAW B;  4WSF A;  1SGH A;  1FHO A;  1U29 A;  1KZ7 A;  3SNH A;  2D9X A;  4HDO A;  1BWN A;  2ROV A;  3QIJ A;  4IAP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...