3ULCA

Crystal structure of the pleckstrin homology domain of saccharomyces cerevisiae avo1, a torc2 subunit, in the p3121 crystal form
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
110
structure length
100
Chain Sequence
AYHKYKVWRRQQMSFINKHERTLAIDGDYIYIVPPENVKTKSLHISQVVLVKKSKRVPEHFKIFVRRDDIKRYYFEAVSGQECTEIVTRLQNLLSAYRMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Membrane protein
molecule keywords Target of rapamycin complex 2 subunit AVO1
publication title Structures of the pleckstrin homology domain of Saccharomyces cerevisiae Avo1 and its human orthologue Sin1, an essential subunit of TOR complex 2
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 19
structure length 100
sequence length 110
ec nomenclature
pdb deposition date 2011-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16979 SIN1_PH SAPK-interacting protein 1 (Sin1), Pleckstrin-homology
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3ulcA01
4Z2MB 5LOPB 1X11A 3LJUX 4DX8A 1ZC3B 4NY0A 3IVFA 2DYNA 1OQNA 2I1JA 3P7ZA 1NTYA 2DTCA 2K2UA 5D3XA 4B6HA 2LKOA 3D8DA 3PVWA 3A8QA 2OTXA 3ODOA 1XODA 4A5KA 3ZDTA 4HAUB 1Y5OA 2I5CA 1UPQA 5JP4A 5CLQB 1RJ2A 5HE0A 1SHCA 2DN6A 1QQGA 1U5EA 3KSYA 5HE2A 5KCVA 1DYNA 2DHKA 3SUZA 4GZUA 2CY4A 1MAIA 3AU4A 1FHXA 4HAXB 1XCGA 1WG7A 3ML4A 3MDBC 4TYZA 4GMXB 4HAWB 3A8PA 2I1KA 2PZ1A 2UVMA 2QKLA 2UZSA 1I2HA 4Z2NA 2Y8FA 3QBVB 2UZRA 1ZM0A 2DLWA 3PVLA 1B55A 1PMSA 4GPTB 2FJLA 2HTHB 1KZGA 5LONB 1LB1A 1AQCA 4HAZB 1K5GB 3ULBA 5C6RA 4HB2B 5FI0A 2X18A 5C5BA 1KZ7A 2MWNB 4GN1A 3M1IB 4HB3B 1P6SA 1W1HA 3PZDA 2DX1A 4K81A 2YS3A 3DXEA 2ROVA 1DDVA 4MK0A 3ODXA 1DROA 4F7GA 2D11A 2KCJA 4KHOA 1P5TA 3AU5A 4TKNA 4A6HA 4C0AA 2MDXA 5C16A 1BTKA 2Y7BA 2DFKA 2YF0A 4A6FB 4KVGB 2D9VA 5DI9B 4HAYB 5DH9B 1QC6A 3F0WA 2CY5A 2GS0A 3N7CA 4Y94A 5J3QA 2EMTA 2IFSA 3FEHA 2KGXB 2M14A 1V88A 4PQ0A 2RSGA 3FM8C 5DHFB 2N23A 3RCPA 4HB4B 1UNPA 3SV1A 2LOZA 4HAVB 2Z0PA 2VSZA 4GMVA 1UPRA 3VIAA 2P8VA 3DXDA 1U5FA 4WJ7A 1W1GA 2CRFA 2ZPYA 1MPHA 4K2OA 3VOQA 4PNKA 1DDWA 4ZRJA 3PSCA 2R09A 3ZVRA 1MK9B 2HE7A 2YSZA 2GCJA 1LW3A 1FB8A 3HW2B 1MIXA 3BJIA 1H10A 2ADZA 2JP2A 4HHVA 2DKPA 2ELAA 2CAYA 4L6EA 1ZSQA 2RNRB 5JHGA 4MY6A 1FHWA 5CLLB 3FSSA 1IRSA 2ELBA 3F5RA 1EGXA 1ISNA 3D8EA 1U27A 1FHOA 4ZRIA 1V5MA 1EAZA 2COCA 4WSFA 2R0DA 2Z0OA 5GOWB 2OQBA 2V76A 2YVCA 4ZRKA 1GC7A 3OANA 1U5GA 1XD4A 4IAPA 1H4RA 3QWMA 3A98B 1RRPB 1M7RA 1OY2A 2L1CA 2D4QA 3X23A 2N0YA 4DBBA 4EJNA 1J19A 4BBKA 2Q13A 1PLSA 3GYPA 1TXDA 2GCLA 2K00A 1K5DB 4A6FA 2P0FA 2IYBA 1MK7B 1UNQA 4CYEA 1U5DA 2D9ZA 2E2XA 1V61A 3D8FA 5HE3A 4GXBA 5FI1A 2VKIA 2J0MA 4IOYX 5DIFB 2YT0A 4KHBB 4YL8A 5EFXA 4F7HA 2H7DA 1WJ1A 2L2IA 3G9WA 2J0JA 3DXCA 3ODWA 2MFQA 1MIZB 1P3RA 2I5FA 2ROZB 1WJMA 2DKQA 1Y19B 4HATB 4K17A 1Q67A 5D3VA 2P0DA 2MKRA 5J3YA 4H8SA 2D10A 1V89A 2D2QA 2CODA 1GC6A 4YONA 1XR0B 1ZC4B 2XQNM 3TVVA 3GYOA 3U7DA 2P0HA 1BWNA 1NU2A 2DA0A 1X1FA 1FAOA 2COAA 3CIKA 4F7UP 2YS5A 1FOEA 2W2XD 3QIJA 3KRWA 3V5WA 1ZVRA 1X86A 3NSUA 3ULCA 3CXBB 2YS1A 3SNHA 2LULA 3PG7A 3MPXA 2LYDA 4WVFB 2RGNB 2YT1A 2J59M 2RVBB 1NI2A 3SO6A 1EF1A 2RLOA 1PFJA 3KY9A 2QKMA 3P6AA 2BCJA 2M38A 5J3TA 5D3WA 1UNRA 5JHHA 1BTNA 1DBHA 2Z0QA 2YRYA 4KAXB 1NTVA 1WGQA 2COFA 5JLJB 5L81A 2AL6A 2AEHA 3PEGA 3HQCA 1DDMA 4HDOA 2J0KA 2Y8GA 1TJ6A 5HE1A 3PP2A 1M7EA 3T06A 2DYQA 4DXAB 1EVHA 1U2BA 4IFSA 1J0WA 4XWXA 2KUPA 3WA0A 4CHMA 1WGUA 1OMWA 1WVHA 2GJYA 2DX5A 1XKEA 4K2PA 2W2XC 1MKEA 2W2WA 3KRXA 3KZ1A 1W1DA 4KHAA 2D9WA 5DHAB 1UEFA 4CHJA 3TCAA 4P7IA 2LOXA 3O96A 2DHIA 5C5BB 2DHJA 1KI1B 4HDQA 2D9XA 3UZTA 4DX90 1V5PA 1X05A 3WYFB 3TFMA 1GG3A 3BINA 3PVUA 4EKUA 3AJ4A 1E5WA 1AWEA 3TO1A 3SYXA 5D3YA 2NZ8B 2VRWB 2H7EA 5KQ4A 1Z87A 2NMBA 4A6KA 5KQ1A 2EJ8A 1TQZA 5D27A 2EC1A 4D0NB 1FGYA 1FGZA 3TW1A 2K2JA 1WI1A 4MT7A 2G35A 1N3HA 1SGHA 2D9YA 4NSWA 4EMOA 1V5UA 2EMSA 1I7AA 2LG1A 4HB0B 1BAKA 5C79A 1U29A 3U8ZA 1XX0A 2RUKB 1X1GA 3HK0A
chains in the Genus database with same CATH superfamily
4Z2MB 5LOPB 1X11A 5I2SA 3LJUX 4DX8A 1ZC3B 4NY0A 3IVFA 5LG4B 2DYNA 1OQNA 2I1JA 3P7ZA 1NTYA 2DTCA 2K2UA 2KUQA 5D3XA 4B6HA 2LKOA 3D8DA 3PVWA 3A8QA 2OTXA 3ODOA 1XODA 4A5KA 3ZDTA 4HAUB 1Y5OA 2I5CA 3HSAA 1UPQA 5JP4A 5CLQB 1RJ2A 5HE0A 4OT1A 1SHCA 2DN6A 1MI1A 1QQGA 1U5EA 3KSYA 5HE2A 5KCVA 1DYNA 2DHKA 2KIEA 3SUZA 4GZUA 2CY4A 1MAIA 3AU4A 1FHXA 4HAXB 1XCGA 1WG7A 3NWAA 3ML4A 3MDBC 4TYZA 4GMXB 4HAWB 3A8PA 2I1KA 2PZ1A 2UVMA 4QJ5B 2QKLA 2UZSA 2GUMA 1I2HA 4Z2NA 2Y8FA 2K8EA 3QBVB 2UZRA 1ZM0A 2DLWA 3PVLA 1B55A 1PMSA 4GPTB 2FJLA 2HTHB 1KZGA 5LONB 1LB1A 1AQCA 4HAZB 1K5GB 3ULBA 5C6RA 4HB2B 5FI0A 2X18A 5C5BA 1KZ7A 2MWNB 2NBVA 4GN1A 3M1IB 4HB3B 1P6SA 1W1HA 2RRFA 3PZDA 4CSQA 2DX1A 4K81A 2YS3A 3DXEA 2ROVA 1DDVA 4MK0A 3ODXA 1DROA 4F7GA 2D11A 2KCJA 4KHOA 1P5TA 2K49A 3AU5A 4TKNA 4A6HA 4C0AA 2MDXA 5C16A 1BTKA 2Y7BA 2DFKA 2YF0A 4A6FB 4KVGB 2D9VA 5DI9B 4D6WA 4HAYB 5DH9B 1QC6A 3F0WA 2CY5A 2GS0A 3N7CA 4Y94A 5J3QA 2EMTA 2IFSA 3FEHA 2KGXB 2M14A 1V88A 4PQ0A 2RSGA 3FM8C 5DHFB 2N23A 3RCPA 4HB4B 2Z4DA 1UNPA 3SV1A 3HIEA 2LOZA 4HAVB 2Z0PA 2VSZA 4GMVA 1UPRA 4QXAB 3VIAA 2P8VA 3DXDA 1U5FA 4WJ7A 3U12A 1W1GA 2CRFA 2ZPYA 1MPHA 4K2OA 3VOQA 4PNKA 1DDWA 4ZRJA 3PSCA 5M4YB 2R09A 3ZVRA 1MK9B 4L1RA 1T77A 2HE7A 2YSZA 2GCJA 1LW3A 1FB8A 3HW2B 1MIXA 3BJIA 1H10A 2ADZA 2JP2A 4HHVA 2DKPA 2ELAA 2CAYA 4L6EA 1ZSQA 2RNRB 5JHGA 4MY6A 1FHWA 5CLLB 3FSSA 1IRSA 2ELBA 3F5RA 1EGXA 1ISNA 3D8EA 1U27A 1FHOA 4ZRIA 1V5MA 1EAZA 2COCA 4WSFA 2R0DA 2Z0OA 5GOWB 3FVCA 2OQBA 2V76A 2YVCA 4ZRKA 1GC7A 3OANA 1U5GA 1XD4A 4IAPA 1H4RA 3QWMA 3A98B 1RRPB 1M7RA 1OY2A 2L1CA 2D4QA 4GNKB 2Z13A 3X23A 2N0YA 4DBBA 4EJNA 1J19A 4BBKA 2Q13A 1PLSA 3GYPA 1TXDA 2GCLA 2K00A 1K5DB 4GOUA 4A6FA 2P0FA 2IYBA 1MK7B 1UNQA 4CYEA 1U5DA 2D9ZA 2E2XA 1V61A 3D8FA 5HE3A 4GXBA 5FI1A 2VKIA 2J0MA 4IOYX 2FJUB 3A58A 5DIFB 2YT0A 4KHBB 4YL8A 5I2MA 4DIXA 5EFXA 4F7HA 2H7DA 1WJ1A 2R2YA 2L2IA 3G9WA 2J0JA 3DXCA 3ODWA 2MFQA 3DCXA 1MIZB 1P3RA 2I5FA 2ROZB 1WJMA 2DKQA 1Y19B 4HATB 4K17A 1Q67A 5D3VA 3B77A 2P0DA 2MKRA 5J3YA 4H8SA 2D10A 1V89A 2D2QA 2CODA 1GC6A 4YONA 1XR0B 4QJ3B 1ZC4B 4QJ4B 2XQNM 3TVVA 3GYOA 3U7DA 2P0HA 1BWNA 1NU2A 2DA0A 5IRSA 1X1FA 1FAOA 2COAA 3CIKA 4F7UP 3NW8A 2YS5A 1FOEA 2W2XD 3QIJA 3KRWA 3V5WA 1ZVRA 1X86A 3NSUA 3ULCA 3CXBB 2YS1A 3SNHA 2LULA 4OSNA 3PG7A 3MPXA 2LYDA 4WVFB 2RGNB 2KIGA 2YT1A 3NWDA 2J59M 2RVBB 1NI2A 3SO6A 1EF1A 2RLOA 1PFJA 3KY9A 2QKMA 3P6AA 2BCJA 2M38A 5J3TA 5D3WA 1UNRA 5JHHA 1BTNA 1DBHA 2Z0QA 2YRYA 4KAXB 4HSIA 2ZKMX 1NTVA 1WGQA 2COFA 5JLJB 5L81A 2AL6A 2AEHA 3PEGA 3HQCA 1DDMA 4HDOA 2J0KA 2Y8GA 1TJ6A 5HE1A 3PP2A 1M7EA 3T06A 2DYQA 4DXAB 1EVHA 1U2BA 4IFSA 1J0WA 4XWXA 2KUPA 3WA0A 4CHMA 2Z14A 1WGUA 1OMWA 1WVHA 2GJYA 2DX5A 1XKEA 3NWFA 4K2PA 2W2XC 1MKEA 2W2WA 3KRXA 3KZ1A 1W1DA 4KHAA 2D9WA 5DHAB 1UEFA 4CHJA 2Z59A 4P7IA 3TCAA 2LOXA 3O96A 2DHIA 5C5BB 2DHJA 1KI1B 4HDQA 2D9XA 3UZTA 4DX90 1V5PA 1X05A 3OHMB 3WYFB 3TFMA 1GG3A 3BINA 3PVUA 4EKUA 3AJ4A 1E5WA 1AWEA 3TO1A 3SYXA 5D3YA 2NZ8B 2VRWB 2H7EA 5KQ4A 4KHBA 1Z87A 2NMBA 4A6KA 5KQ1A 2EJ8A 1ZYIA 1TQZA 5D27A 2EC1A 2KR0A 4D0NB 1FGYA 1FGZA 3TW1A 2K2JA 1WI1A 4MT7A 2G35A 1N3HA 1SGHA 2D9YA 4NSWA 4EMOA 1V5UA 2EMSA 1I7AA 2LG1A 4HB0B 1BAKA 5C79A 1U29A 3U8ZA 1XX0A 2RUKB 1X1GA 2YT2A 3HK0A
chains in the Genus database with same CATH topology
4Z2MB 5LOPB 1X11A 3LJUX 4DX8A 1ZC3B 4NY0A 3IVFA 2DYNA 1OQNA 2I1JA 3P7ZA 1NTYA 2DTCA 2K2UA 5D3XA 4B6HA 2LKOA 3D8DA 3PVWA 3A8QA 2OTXA 3ODOA 1XODA 4A5KA 3ZDTA 4HAUB 1Y5OA 2I5CA 1UPQA 5JP4A 5CLQB 1RJ2A 5HE0A 1SHCA 2DN6A 1QQGA 1U5EA 3KSYA 5HE2A 5KCVA 1DYNA 2DHKA 3SUZA 4GZUA 2CY4A 1MAIA 3AU4A 1FHXA 4HAXB 1XCGA 1WG7A 3ML4A 3MDBC 4TYZA 4GMXB 4HAWB 3A8PA 2I1KA 2PZ1A 2UVMA 2QKLA 2UZSA 1I2HA 4Z2NA 2Y8FA 3QBVB 2UZRA 1ZM0A 2DLWA 3PVLA 1B55A 1PMSA 4GPTB 2FJLA 2HTHB 1KZGA 5LONB 1LB1A 1AQCA 4HAZB 1K5GB 3ULBA 5C6RA 4HB2B 5FI0A 2X18A 5C5BA 1KZ7A 2MWNB 4GN1A 3M1IB 4HB3B 1P6SA 1W1HA 3PZDA 2DX1A 4K81A 2YS3A 3DXEA 2ROVA 1DDVA 4MK0A 3ODXA 1DROA 4F7GA 2D11A 2KCJA 4KHOA 1P5TA 3AU5A 4TKNA 4A6HA 4C0AA 2MDXA 5C16A 1BTKA 2Y7BA 2DFKA 2YF0A 4A6FB 4KVGB 2D9VA 5DI9B 4HAYB 5DH9B 1QC6A 3F0WA 2CY5A 2GS0A 3N7CA 4Y94A 5J3QA 2EMTA 2IFSA 3FEHA 2KGXB 2M14A 1V88A 4PQ0A 2RSGA 3FM8C 5DHFB 2N23A 3RCPA 4HB4B 1UNPA 3SV1A 2LOZA 4HAVB 2Z0PA 2VSZA 4GMVA 1UPRA 3VIAA 2P8VA 3DXDA 1U5FA 4WJ7A 1W1GA 2CRFA 2ZPYA 1MPHA 4K2OA 3VOQA 4PNKA 1DDWA 4ZRJA 3PSCA 2R09A 3ZVRA 1MK9B 2HE7A 2YSZA 2GCJA 1LW3A 1FB8A 3HW2B 1MIXA 3BJIA 1H10A 2ADZA 2JP2A 4HHVA 2DKPA 2ELAA 2CAYA 4L6EA 1ZSQA 2RNRB 5JHGA 4MY6A 1FHWA 5CLLB 3FSSA 1IRSA 2ELBA 3F5RA 1EGXA 1ISNA 3D8EA 1U27A 1FHOA 4ZRIA 1V5MA 1EAZA 2COCA 4WSFA 2R0DA 2Z0OA 5GOWB 2OQBA 2V76A 2YVCA 4ZRKA 1GC7A 3OANA 1U5GA 1XD4A 4IAPA 1H4RA 3QWMA 3A98B 1RRPB 1M7RA 1OY2A 2L1CA 2D4QA 3X23A 2N0YA 4DBBA 4EJNA 1J19A 4BBKA 2Q13A 1PLSA 3GYPA 1TXDA 2GCLA 2K00A 1K5DB 4A6FA 2P0FA 2IYBA 1MK7B 1UNQA 4CYEA 1U5DA 2D9ZA 2E2XA 1V61A 3D8FA 5HE3A 4GXBA 5FI1A 2VKIA 2J0MA 4IOYX 5DIFB 2YT0A 4KHBB 4YL8A 5EFXA 4F7HA 2H7DA 1WJ1A 2L2IA 3G9WA 2J0JA 3DXCA 3ODWA 2MFQA 1MIZB 1P3RA 2I5FA 2ROZB 1WJMA 2DKQA 1Y19B 4HATB 4K17A 1Q67A 5D3VA 2P0DA 2MKRA 5J3YA 4H8SA 2D10A 1V89A 2D2QA 2CODA 1GC6A 4YONA 1XR0B 1ZC4B 2XQNM 3TVVA 3GYOA 3U7DA 2P0HA 1BWNA 1NU2A 2DA0A 1X1FA 1FAOA 2COAA 3CIKA 4F7UP 2YS5A 1FOEA 2W2XD 3QIJA 3KRWA 3V5WA 1ZVRA 1X86A 3NSUA 3ULCA 3CXBB 2YS1A 3SNHA 2LULA 3PG7A 3MPXA 2LYDA 4WVFB 2RGNB 2YT1A 2J59M 2RVBB 1NI2A 3SO6A 1EF1A 2RLOA 1PFJA 3KY9A 2QKMA 3P6AA 2BCJA 2M38A 5J3TA 5D3WA 1UNRA 5JHHA 1BTNA 1DBHA 2Z0QA 2YRYA 4KAXB 1NTVA 1WGQA 2COFA 5JLJB 5L81A 2AL6A 2AEHA 3PEGA 3HQCA 1DDMA 4HDOA 2J0KA 2Y8GA 1TJ6A 5HE1A 3PP2A 1M7EA 3T06A 2DYQA 4DXAB 1EVHA 1U2BA 4IFSA 1J0WA 4XWXA 2KUPA 3WA0A 4CHMA 1WGUA 1OMWA 1WVHA 2GJYA 2DX5A 1XKEA 4K2PA 2W2XC 1MKEA 2W2WA 3KRXA 3KZ1A 1W1DA 4KHAA 2D9WA 5DHAB 1UEFA 4CHJA 3TCAA 4P7IA 2LOXA 3O96A 2DHIA 5C5BB 2DHJA 1KI1B 4HDQA 2D9XA 3UZTA 4DX90 1V5PA 1X05A 3WYFB 3TFMA 1GG3A 3BINA 3PVUA 4EKUA 3AJ4A 1E5WA 1AWEA 3TO1A 3SYXA 5D3YA 2NZ8B 2VRWB 2H7EA 5KQ4A 1Z87A 2NMBA 4A6KA 5KQ1A 2EJ8A 1TQZA 5D27A 2EC1A 4D0NB 1FGYA 1FGZA 3TW1A 2K2JA 1WI1A 4MT7A 2G35A 1N3HA 1SGHA 2D9YA 4NSWA 4EMOA 1V5UA 2EMSA 1I7AA 2LG1A 4HB0B 1BAKA 5C79A 1U29A 3U8ZA 1XX0A 2RUKB 1X1GA 3HK0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Z2M B;  5LOP B;  1X11 A;  3LJU X;  4DX8 A;  1ZC3 B;  4NY0 A;  3IVF A;  2DYN A;  1OQN A;  2I1J A;  3P7Z A;  1NTY A;  2DTC A;  2K2U A;  5D3X A;  4B6H A;  2LKO A;  3D8D A;  3PVW A;  3A8Q A;  2OTX A;  3ODO A;  1XOD A;  4A5K A;  3ZDT A;  4HAU B;  1Y5O A;  2I5C A;  1UPQ A;  5JP4 A;  5CLQ B;  1RJ2 A;  5HE0 A;  1SHC A;  2DN6 A;  1QQG A;  1U5E A;  3KSY A;  5HE2 A;  5KCV A;  1DYN A;  2DHK A;  3SUZ A;  4GZU A;  2CY4 A;  1MAI A;  3AU4 A;  1FHX A;  4HAX B;  1XCG A;  1WG7 A;  3ML4 A;  3MDB C;  4TYZ A;  4GMX B;  4HAW B;  3A8P A;  2I1K A;  2PZ1 A;  2UVM A;  2QKL A;  2UZS A;  1I2H A;  4Z2N A;  2Y8F A;  3QBV B;  2UZR A;  1ZM0 A;  2DLW A;  3PVL A;  1B55 A;  1PMS A;  4GPT B;  2FJL A;  2HTH B;  1KZG A;  5LON B;  1LB1 A;  1AQC A;  4HAZ B;  1K5G B;  3ULB A;  5C6R A;  4HB2 B;  5FI0 A;  2X18 A;  5C5B A;  1KZ7 A;  2MWN B;  4GN1 A;  3M1I B;  4HB3 B;  1P6S A;  1W1H A;  3PZD A;  2DX1 A;  4K81 A;  2YS3 A;  3DXE A;  2ROV A;  1DDV A;  4MK0 A;  3ODX A;  1DRO A;  4F7G A;  2D11 A;  2KCJ A;  4KHO A;  1P5T A;  3AU5 A;  4TKN A;  4A6H A;  4C0A A;  2MDX A;  5C16 A;  1BTK A;  2Y7B A;  2DFK A;  2YF0 A;  4A6F B;  4KVG B;  2D9V A;  5DI9 B;  4HAY B;  5DH9 B;  1QC6 A;  3F0W A;  2CY5 A;  2GS0 A;  3N7C A;  4Y94 A;  5J3Q A;  2EMT A;  2IFS A;  3FEH A;  2KGX B;  2M14 A;  1V88 A;  4PQ0 A;  2RSG A;  3FM8 C;  5DHF B;  2N23 A;  3RCP A;  4HB4 B;  1UNP A;  3SV1 A;  2LOZ A;  4HAV B;  2Z0P A;  2VSZ A;  4GMV A;  1UPR A;  3VIA A;  2P8V A;  3DXD A;  1U5F A;  4WJ7 A;  1W1G A;  2CRF A;  2ZPY A;  1MPH A;  4K2O A;  3VOQ A;  4PNK A;  1DDW A;  4ZRJ A;  3PSC A;  2R09 A;  3ZVR A;  1MK9 B;  2HE7 A;  2YSZ A;  2GCJ A;  1LW3 A;  1FB8 A;  3HW2 B;  1MIX A;  3BJI A;  1H10 A;  2ADZ A;  2JP2 A;  4HHV A;  2DKP A;  2ELA A;  2CAY A;  4L6E A;  1ZSQ A;  2RNR B;  5JHG A;  4MY6 A;  1FHW A;  5CLL B;  3FSS A;  1IRS A;  2ELB A;  3F5R A;  1EGX A;  1ISN A;  3D8E A;  1U27 A;  1FHO A;  4ZRI A;  1V5M A;  1EAZ A;  2COC A;  4WSF A;  2R0D A;  2Z0O A;  5GOW B;  2OQB A;  2V76 A;  2YVC A;  4ZRK A;  1GC7 A;  3OAN A;  1U5G A;  1XD4 A;  4IAP A;  1H4R A;  3QWM A;  3A98 B;  1RRP B;  1M7R A;  1OY2 A;  2L1C A;  2D4Q A;  3X23 A;  2N0Y A;  4DBB A;  4EJN A;  1J19 A;  4BBK A;  2Q13 A;  1PLS A;  3GYP A;  1TXD A;  2GCL A;  2K00 A;  1K5D B;  4A6F A;  2P0F A;  2IYB A;  1MK7 B;  1UNQ A;  4CYE A;  1U5D A;  2D9Z A;  2E2X A;  1V61 A;  3D8F A;  5HE3 A;  4GXB A;  5FI1 A;  2VKI A;  2J0M A;  4IOY X;  5DIF B;  2YT0 A;  4KHB B;  4YL8 A;  5EFX A;  4F7H A;  2H7D A;  1WJ1 A;  2L2I A;  3G9W A;  2J0J A;  3DXC A;  3ODW A;  2MFQ A;  1MIZ B;  1P3R A;  2I5F A;  2ROZ B;  1WJM A;  2DKQ A;  1Y19 B;  4HAT B;  4K17 A;  1Q67 A;  5D3V A;  2P0D A;  2MKR A;  5J3Y A;  4H8S A;  2D10 A;  1V89 A;  2D2Q A;  2COD A;  1GC6 A;  4YON A;  1XR0 B;  1ZC4 B;  2XQN M;  3TVV A;  3GYO A;  3U7D A;  2P0H A;  1BWN A;  1NU2 A;  2DA0 A;  1X1F A;  1FAO A;  2COA A;  3CIK A;  4F7U P;  2YS5 A;  1FOE A;  2W2X D;  3QIJ A;  3KRW A;  3V5W A;  1ZVR A;  1X86 A;  3NSU A;  3ULC A;  3CXB B;  2YS1 A;  3SNH A;  2LUL A;  3PG7 A;  3MPX A;  2LYD A;  4WVF B;  2RGN B;  2YT1 A;  2J59 M;  2RVB B;  1NI2 A;  3SO6 A;  1EF1 A;  2RLO A;  1PFJ A;  3KY9 A;  2QKM A;  3P6A A;  2BCJ A;  2M38 A;  5J3T A;  5D3W A;  1UNR A;  5JHH A;  1BTN A;  1DBH A;  2Z0Q A;  2YRY A;  4KAX B;  1NTV A;  1WGQ A;  2COF A;  5JLJ B;  5L81 A;  2AL6 A;  2AEH A;  3PEG A;  3HQC A;  1DDM A;  4HDO A;  2J0K A;  2Y8G A;  1TJ6 A;  5HE1 A;  3PP2 A;  1M7E A;  3T06 A;  2DYQ A;  4DXA B;  1EVH A;  1U2B A;  4IFS A;  1J0W A;  4XWX A;  2KUP A;  3WA0 A;  4CHM A;  1WGU A;  1OMW A;  1WVH A;  2GJY A;  2DX5 A;  1XKE A;  4K2P A;  2W2X C;  1MKE A;  2W2W A;  3KRX A;  3KZ1 A;  1W1D A;  4KHA A;  2D9W A;  5DHA B;  1UEF A;  4CHJ A;  3TCA A;  4P7I A;  2LOX A;  3O96 A;  2DHI A;  5C5B B;  2DHJ A;  1KI1 B;  4HDQ A;  2D9X A;  3UZT A;  4DX9 0;  1V5P A;  1X05 A;  3WYF B;  3TFM A;  1GG3 A;  3BIN A;  3PVU A;  4EKU A;  3AJ4 A;  1E5W A;  1AWE A;  3TO1 A;  3SYX A;  5D3Y A;  2NZ8 B;  2VRW B;  2H7E A;  5KQ4 A;  1Z87 A;  2NMB A;  4A6K A;  5KQ1 A;  2EJ8 A;  1TQZ A;  5D27 A;  2EC1 A;  4D0N B;  1FGY A;  1FGZ A;  3TW1 A;  2K2J A;  1WI1 A;  4MT7 A;  2G35 A;  1N3H A;  1SGH A;  2D9Y A;  4NSW A;  4EMO A;  1V5U A;  2EMS A;  1I7A A;  2LG1 A;  4HB0 B;  1BAK A;  5C79 A;  1U29 A;  3U8Z A;  1XX0 A;  2RUK B;  1X1G A;  3HK0 A; 
#chains in the Genus database with same CATH topology
 4Z2M B;  5LOP B;  1X11 A;  5I2S A;  3LJU X;  4DX8 A;  1ZC3 B;  4NY0 A;  3IVF A;  5LG4 B;  2DYN A;  1OQN A;  2I1J A;  3P7Z A;  1NTY A;  2DTC A;  2K2U A;  2KUQ A;  5D3X A;  4B6H A;  2LKO A;  3D8D A;  3PVW A;  3A8Q A;  2OTX A;  3ODO A;  1XOD A;  4A5K A;  3ZDT A;  4HAU B;  1Y5O A;  2I5C A;  3HSA A;  1UPQ A;  5JP4 A;  5CLQ B;  1RJ2 A;  5HE0 A;  4OT1 A;  1SHC A;  2DN6 A;  1MI1 A;  1QQG A;  1U5E A;  3KSY A;  5HE2 A;  5KCV A;  1DYN A;  2DHK A;  2KIE A;  3SUZ A;  4GZU A;  2CY4 A;  1MAI A;  3AU4 A;  1FHX A;  4HAX B;  1XCG A;  1WG7 A;  3NWA A;  3ML4 A;  3MDB C;  4TYZ A;  4GMX B;  4HAW B;  3A8P A;  2I1K A;  2PZ1 A;  2UVM A;  4QJ5 B;  2QKL A;  2UZS A;  2GUM A;  1I2H A;  4Z2N A;  2Y8F A;  2K8E A;  3QBV B;  2UZR A;  1ZM0 A;  2DLW A;  3PVL A;  1B55 A;  1PMS A;  4GPT B;  2FJL A;  2HTH B;  1KZG A;  5LON B;  1LB1 A;  1AQC A;  4HAZ B;  1K5G B;  3ULB A;  5C6R A;  4HB2 B;  5FI0 A;  2X18 A;  5C5B A;  1KZ7 A;  2MWN B;  2NBV A;  4GN1 A;  3M1I B;  4HB3 B;  1P6S A;  1W1H A;  2RRF A;  3PZD A;  4CSQ A;  2DX1 A;  4K81 A;  2YS3 A;  3DXE A;  2ROV A;  1DDV A;  4MK0 A;  3ODX A;  1DRO A;  4F7G A;  2D11 A;  2KCJ A;  4KHO A;  1P5T A;  2K49 A;  3AU5 A;  4TKN A;  4A6H A;  4C0A A;  2MDX A;  5C16 A;  1BTK A;  2Y7B A;  2DFK A;  2YF0 A;  4A6F B;  4KVG B;  2D9V A;  5DI9 B;  4D6W A;  4HAY B;  5DH9 B;  1QC6 A;  3F0W A;  2CY5 A;  2GS0 A;  3N7C A;  4Y94 A;  5J3Q A;  2EMT A;  2IFS A;  3FEH A;  2KGX B;  2M14 A;  1V88 A;  4PQ0 A;  2RSG A;  3FM8 C;  5DHF B;  2N23 A;  3RCP A;  4HB4 B;  2Z4D A;  1UNP A;  3SV1 A;  3HIE A;  2LOZ A;  4HAV B;  2Z0P A;  2VSZ A;  4GMV A;  1UPR A;  4QXA B;  3VIA A;  2P8V A;  3DXD A;  1U5F A;  4WJ7 A;  3U12 A;  1W1G A;  2CRF A;  2ZPY A;  1MPH A;  4K2O A;  3VOQ A;  4PNK A;  1DDW A;  4ZRJ A;  3PSC A;  5M4Y B;  2R09 A;  3ZVR A;  1MK9 B;  4L1R A;  1T77 A;  2HE7 A;  2YSZ A;  2GCJ A;  1LW3 A;  1FB8 A;  3HW2 B;  1MIX A;  3BJI A;  1H10 A;  2ADZ A;  2JP2 A;  4HHV A;  2DKP A;  2ELA A;  2CAY A;  4L6E A;  1ZSQ A;  2RNR B;  5JHG A;  4MY6 A;  1FHW A;  5CLL B;  3FSS A;  1IRS A;  2ELB A;  3F5R A;  1EGX A;  1ISN A;  3D8E A;  1U27 A;  1FHO A;  4ZRI A;  1V5M A;  1EAZ A;  2COC A;  4WSF A;  2R0D A;  2Z0O A;  5GOW B;  3FVC A;  2OQB A;  2V76 A;  2YVC A;  4ZRK A;  1GC7 A;  3OAN A;  1U5G A;  1XD4 A;  4IAP A;  1H4R A;  3QWM A;  3A98 B;  1RRP B;  1M7R A;  1OY2 A;  2L1C A;  2D4Q A;  4GNK B;  2Z13 A;  3X23 A;  2N0Y A;  4DBB A;  4EJN A;  1J19 A;  4BBK A;  2Q13 A;  1PLS A;  3GYP A;  1TXD A;  2GCL A;  2K00 A;  1K5D B;  4GOU A;  4A6F A;  2P0F A;  2IYB A;  1MK7 B;  1UNQ A;  4CYE A;  1U5D A;  2D9Z A;  2E2X A;  1V61 A;  3D8F A;  5HE3 A;  4GXB A;  5FI1 A;  2VKI A;  2J0M A;  4IOY X;  2FJU B;  3A58 A;  5DIF B;  2YT0 A;  4KHB B;  4YL8 A;  5I2M A;  4DIX A;  5EFX A;  4F7H A;  2H7D A;  1WJ1 A;  2R2Y A;  2L2I A;  3G9W A;  2J0J A;  3DXC A;  3ODW A;  2MFQ A;  3DCX A;  1MIZ B;  1P3R A;  2I5F A;  2ROZ B;  1WJM A;  2DKQ A;  1Y19 B;  4HAT B;  4K17 A;  1Q67 A;  5D3V A;  3B77 A;  2P0D A;  2MKR A;  5J3Y A;  4H8S A;  2D10 A;  1V89 A;  2D2Q A;  2COD A;  1GC6 A;  4YON A;  1XR0 B;  4QJ3 B;  1ZC4 B;  4QJ4 B;  2XQN M;  3TVV A;  3GYO A;  3U7D A;  2P0H A;  1BWN A;  1NU2 A;  2DA0 A;  5IRS A;  1X1F A;  1FAO A;  2COA A;  3CIK A;  4F7U P;  3NW8 A;  2YS5 A;  1FOE A;  2W2X D;  3QIJ A;  3KRW A;  3V5W A;  1ZVR A;  1X86 A;  3NSU A;  3ULC A;  3CXB B;  2YS1 A;  3SNH A;  2LUL A;  4OSN A;  3PG7 A;  3MPX A;  2LYD A;  4WVF B;  2RGN B;  2KIG A;  2YT1 A;  3NWD A;  2J59 M;  2RVB B;  1NI2 A;  3SO6 A;  1EF1 A;  2RLO A;  1PFJ A;  3KY9 A;  2QKM A;  3P6A A;  2BCJ A;  2M38 A;  5J3T A;  5D3W A;  1UNR A;  5JHH A;  1BTN A;  1DBH A;  2Z0Q A;  2YRY A;  4KAX B;  4HSI A;  2ZKM X;  1NTV A;  1WGQ A;  2COF A;  5JLJ B;  5L81 A;  2AL6 A;  2AEH A;  3PEG A;  3HQC A;  1DDM A;  4HDO A;  2J0K A;  2Y8G A;  1TJ6 A;  5HE1 A;  3PP2 A;  1M7E A;  3T06 A;  2DYQ A;  4DXA B;  1EVH A;  1U2B A;  4IFS A;  1J0W A;  4XWX A;  2KUP A;  3WA0 A;  4CHM A;  2Z14 A;  1WGU A;  1OMW A;  1WVH A;  2GJY A;  2DX5 A;  1XKE A;  3NWF A;  4K2P A;  2W2X C;  1MKE A;  2W2W A;  3KRX A;  3KZ1 A;  1W1D A;  4KHA A;  2D9W A;  5DHA B;  1UEF A;  4CHJ A;  2Z59 A;  4P7I A;  3TCA A;  2LOX A;  3O96 A;  2DHI A;  5C5B B;  2DHJ A;  1KI1 B;  4HDQ A;  2D9X A;  3UZT A;  4DX9 0;  1V5P A;  1X05 A;  3OHM B;  3WYF B;  3TFM A;  1GG3 A;  3BIN A;  3PVU A;  4EKU A;  3AJ4 A;  1E5W A;  1AWE A;  3TO1 A;  3SYX A;  5D3Y A;  2NZ8 B;  2VRW B;  2H7E A;  5KQ4 A;  4KHB A;  1Z87 A;  2NMB A;  4A6K A;  5KQ1 A;  2EJ8 A;  1ZYI A;  1TQZ A;  5D27 A;  2EC1 A;  2KR0 A;  4D0N B;  1FGY A;  1FGZ A;  3TW1 A;  2K2J A;  1WI1 A;  4MT7 A;  2G35 A;  1N3H A;  1SGH A;  2D9Y A;  4NSW A;  4EMO A;  1V5U A;  2EMS A;  1I7A A;  2LG1 A;  4HB0 B;  1BAK A;  5C79 A;  1U29 A;  3U8Z A;  1XX0 A;  2RUK B;  1X1G A;  2YT2 A;  3HK0 A; 
#chains in the Genus database with same CATH homology
 4Z2M B;  5LOP B;  1X11 A;  3LJU X;  4DX8 A;  1ZC3 B;  4NY0 A;  3IVF A;  2DYN A;  1OQN A;  2I1J A;  3P7Z A;  1NTY A;  2DTC A;  2K2U A;  5D3X A;  4B6H A;  2LKO A;  3D8D A;  3PVW A;  3A8Q A;  2OTX A;  3ODO A;  1XOD A;  4A5K A;  3ZDT A;  4HAU B;  1Y5O A;  2I5C A;  1UPQ A;  5JP4 A;  5CLQ B;  1RJ2 A;  5HE0 A;  1SHC A;  2DN6 A;  1QQG A;  1U5E A;  3KSY A;  5HE2 A;  5KCV A;  1DYN A;  2DHK A;  3SUZ A;  4GZU A;  2CY4 A;  1MAI A;  3AU4 A;  1FHX A;  4HAX B;  1XCG A;  1WG7 A;  3ML4 A;  3MDB C;  4TYZ A;  4GMX B;  4HAW B;  3A8P A;  2I1K A;  2PZ1 A;  2UVM A;  2QKL A;  2UZS A;  1I2H A;  4Z2N A;  2Y8F A;  3QBV B;  2UZR A;  1ZM0 A;  2DLW A;  3PVL A;  1B55 A;  1PMS A;  4GPT B;  2FJL A;  2HTH B;  1KZG A;  5LON B;  1LB1 A;  1AQC A;  4HAZ B;  1K5G B;  3ULB A;  5C6R A;  4HB2 B;  5FI0 A;  2X18 A;  5C5B A;  1KZ7 A;  2MWN B;  4GN1 A;  3M1I B;  4HB3 B;  1P6S A;  1W1H A;  3PZD A;  2DX1 A;  4K81 A;  2YS3 A;  3DXE A;  2ROV A;  1DDV A;  4MK0 A;  3ODX A;  1DRO A;  4F7G A;  2D11 A;  2KCJ A;  4KHO A;  1P5T A;  3AU5 A;  4TKN A;  4A6H A;  4C0A A;  2MDX A;  5C16 A;  1BTK A;  2Y7B A;  2DFK A;  2YF0 A;  4A6F B;  4KVG B;  2D9V A;  5DI9 B;  4HAY B;  5DH9 B;  1QC6 A;  3F0W A;  2CY5 A;  2GS0 A;  3N7C A;  4Y94 A;  5J3Q A;  2EMT A;  2IFS A;  3FEH A;  2KGX B;  2M14 A;  1V88 A;  4PQ0 A;  2RSG A;  3FM8 C;  5DHF B;  2N23 A;  3RCP A;  4HB4 B;  1UNP A;  3SV1 A;  2LOZ A;  4HAV B;  2Z0P A;  2VSZ A;  4GMV A;  1UPR A;  3VIA A;  2P8V A;  3DXD A;  1U5F A;  4WJ7 A;  1W1G A;  2CRF A;  2ZPY A;  1MPH A;  4K2O A;  3VOQ A;  4PNK A;  1DDW A;  4ZRJ A;  3PSC A;  2R09 A;  3ZVR A;  1MK9 B;  2HE7 A;  2YSZ A;  2GCJ A;  1LW3 A;  1FB8 A;  3HW2 B;  1MIX A;  3BJI A;  1H10 A;  2ADZ A;  2JP2 A;  4HHV A;  2DKP A;  2ELA A;  2CAY A;  4L6E A;  1ZSQ A;  2RNR B;  5JHG A;  4MY6 A;  1FHW A;  5CLL B;  3FSS A;  1IRS A;  2ELB A;  3F5R A;  1EGX A;  1ISN A;  3D8E A;  1U27 A;  1FHO A;  4ZRI A;  1V5M A;  1EAZ A;  2COC A;  4WSF A;  2R0D A;  2Z0O A;  5GOW B;  2OQB A;  2V76 A;  2YVC A;  4ZRK A;  1GC7 A;  3OAN A;  1U5G A;  1XD4 A;  4IAP A;  1H4R A;  3QWM A;  3A98 B;  1RRP B;  1M7R A;  1OY2 A;  2L1C A;  2D4Q A;  3X23 A;  2N0Y A;  4DBB A;  4EJN A;  1J19 A;  4BBK A;  2Q13 A;  1PLS A;  3GYP A;  1TXD A;  2GCL A;  2K00 A;  1K5D B;  4A6F A;  2P0F A;  2IYB A;  1MK7 B;  1UNQ A;  4CYE A;  1U5D A;  2D9Z A;  2E2X A;  1V61 A;  3D8F A;  5HE3 A;  4GXB A;  5FI1 A;  2VKI A;  2J0M A;  4IOY X;  5DIF B;  2YT0 A;  4KHB B;  4YL8 A;  5EFX A;  4F7H A;  2H7D A;  1WJ1 A;  2L2I A;  3G9W A;  2J0J A;  3DXC A;  3ODW A;  2MFQ A;  1MIZ B;  1P3R A;  2I5F A;  2ROZ B;  1WJM A;  2DKQ A;  1Y19 B;  4HAT B;  4K17 A;  1Q67 A;  5D3V A;  2P0D A;  2MKR A;  5J3Y A;  4H8S A;  2D10 A;  1V89 A;  2D2Q A;  2COD A;  1GC6 A;  4YON A;  1XR0 B;  1ZC4 B;  2XQN M;  3TVV A;  3GYO A;  3U7D A;  2P0H A;  1BWN A;  1NU2 A;  2DA0 A;  1X1F A;  1FAO A;  2COA A;  3CIK A;  4F7U P;  2YS5 A;  1FOE A;  2W2X D;  3QIJ A;  3KRW A;  3V5W A;  1ZVR A;  1X86 A;  3NSU A;  3ULC A;  3CXB B;  2YS1 A;  3SNH A;  2LUL A;  3PG7 A;  3MPX A;  2LYD A;  4WVF B;  2RGN B;  2YT1 A;  2J59 M;  2RVB B;  1NI2 A;  3SO6 A;  1EF1 A;  2RLO A;  1PFJ A;  3KY9 A;  2QKM A;  3P6A A;  2BCJ A;  2M38 A;  5J3T A;  5D3W A;  1UNR A;  5JHH A;  1BTN A;  1DBH A;  2Z0Q A;  2YRY A;  4KAX B;  1NTV A;  1WGQ A;  2COF A;  5JLJ B;  5L81 A;  2AL6 A;  2AEH A;  3PEG A;  3HQC A;  1DDM A;  4HDO A;  2J0K A;  2Y8G A;  1TJ6 A;  5HE1 A;  3PP2 A;  1M7E A;  3T06 A;  2DYQ A;  4DXA B;  1EVH A;  1U2B A;  4IFS A;  1J0W A;  4XWX A;  2KUP A;  3WA0 A;  4CHM A;  1WGU A;  1OMW A;  1WVH A;  2GJY A;  2DX5 A;  1XKE A;  4K2P A;  2W2X C;  1MKE A;  2W2W A;  3KRX A;  3KZ1 A;  1W1D A;  4KHA A;  2D9W A;  5DHA B;  1UEF A;  4CHJ A;  3TCA A;  4P7I A;  2LOX A;  3O96 A;  2DHI A;  5C5B B;  2DHJ A;  1KI1 B;  4HDQ A;  2D9X A;  3UZT A;  4DX9 0;  1V5P A;  1X05 A;  3WYF B;  3TFM A;  1GG3 A;  3BIN A;  3PVU A;  4EKU A;  3AJ4 A;  1E5W A;  1AWE A;  3TO1 A;  3SYX A;  5D3Y A;  2NZ8 B;  2VRW B;  2H7E A;  5KQ4 A;  1Z87 A;  2NMB A;  4A6K A;  5KQ1 A;  2EJ8 A;  1TQZ A;  5D27 A;  2EC1 A;  4D0N B;  1FGY A;  1FGZ A;  3TW1 A;  2K2J A;  1WI1 A;  4MT7 A;  2G35 A;  1N3H A;  1SGH A;  2D9Y A;  4NSW A;  4EMO A;  1V5U A;  2EMS A;  1I7A A;  2LG1 A;  4HB0 B;  1BAK A;  5C79 A;  1U29 A;  3U8Z A;  1XX0 A;  2RUK B;  1X1G A;  3HK0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...