3ULCA

Crystal structure of the pleckstrin homology domain of saccharomyces cerevisiae avo1, a torc2 subunit, in the p3121 crystal form
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
110
structure length
100
Chain Sequence
b'AYHKYKVWRRQQMSFINKHERTLAIDGDYIYIVPPENVKTKSLHISQVVLVKKSKRVPEHFKIFVRRDDIKRYYFEAVSGQECTEIVTRLQNLLSAYRMN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Target of rapamycin complex 2 subunit AVO1
publication title Structures of the pleckstrin homology domain of Saccharomyces cerevisiae Avo1 and its human orthologue Sin1, an essential subunit of TOR complex 2
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Membrane protein
total genus 19
structure length 100
sequence length 110
ec nomenclature
pdb deposition date 2011-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16979 SIN1_PH SAPK-interacting protein 1 (Sin1), Pleckstrin-homology
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3ulcA01
1XODA 1K5GB 2QKLA 5J3TA 3GYOA 4IAPA 2LOXA 5DI9B 2Y8FA 1PFJA 1AWEA 4HAZB 1U5EA 4GMVA 1ZSQA 4HB0B 1DYNA 1WI1A 4IFSA 3HW2B 2GCLA 4HAWB 1NI2A 1U29A 2DLWA 1X1FA 2DYQA 3KZ1A 1Q67A 3AJ4A 3U7DA 3FEHA 3PG7A 4GXBA 2OTXA 4MK0A 3A8PA 3SNHA 4CHJA 4HAVB 1BWNA 1WVHA 2PZ1A 3TW1A 2YS1A 2D10A 1LB1A 4ZRKA 2W2XD 2RSGA 1EAZA 5D27A 3NSUA 2H7EA 1V88A 4Z2MB 3SO6A 2P0FA 2NZ8B 2NMBA 3SV1A 3T06A 2UZRA 2L1CA 1UEFA 3N7CA 1U27A 3IVFA 1H4RA 1SGHA 1MK9B 3CXBB 1SHCA 2J59M 2VSZA 2YVCA 4EKUA 3G9WA 1WGUA 5JLJB 2ROZB 2LKOA 2YT0A 5J3YA 5D3WA 3GYPA 2K00A 2R09A 5DHFB 1UNQA 3FSSA 5FI0A 3TFMA 2X18A 5HE1A 3WA0A 4KHOA 3PVUA 3KRWA 1Y19B 2ADZA 4NY0A 1QQGA 2P0HA 5FI1A 3F0WA 2K2UA 3ODWA 3O96A 2D2QA 3D8FA 2DHKA 4HDQA 2MWNB 2LG1A 3PP2A 4K2OA 2EMSA 3ODOA 2D9YA 4NSWA 2DYNA 1X11A 5JHGA 1U5DA 5JHHA 5GOWB 2IFSA 1Y5OA 2ELAA 2LYDA 1KZ7A 2RUKB 1MKEA 2DA0A 3U8ZA 2I5CA 1MAIA 4BBKA 4Z2NA 2EJ8A 4H8SA 4A5KA 1DDWA 2YS5A 4DX90 2E2XA 4TYZA 1KZGA 3VOQA 4PNKA 1MPHA 1J19A 2MDXA 2AEHA 3PEGA 4HAXB 1QC6A 4WVFB 2W2WA 4C0AA 4GZUA 1NTYA 4WSFA 3ZVRA 1P3RA 2FJLA 5LONB 4Y94A 3SYXA 4DBBA 4HATB 3MDBC 3P6AA 4MY6A 1X86A 1V89A 2HTHB 1DBHA 5L81A 2CY5A 3ULCA 4A6KA 4HAYB 2IYBA 3DXCA 3QWMA 4KHAA 1ISNA 2N23A 3AU4A 1BAKA 2DTCA 2GCJA 2J0MA 1MK7B 1ZC4B 4MT7A 3ZDTA 2YSZA 2UVMA 1U2BA 5DHAB 2D4QA 3ML4A 2M14A 2DFKA 2EMTA 2L2IA 2LULA 2HE7A 4ZRJA 1MIZB 2P8VA 3PZDA 1ZC3B 4L6EA 4K17A 4KHBB 3DXEA 3UZTA 4DX8A 1V5PA 1PMSA 4K81A 1XX0A 1ZVRA 5JP4A 1XR0B 5D3VA 2QKMA 1UNRA 3MPXA 3PVLA 2CRFA 2DX5A 1FOEA 5C16A 4EMOA 3ULBA 1M7EA 2D11A 1I7AA 4A6HA 1UNPA 1V61A 4CHMA 1WJ1A 1IRSA 5LOPB 2OQBA 2Z0OA 1U5FA 4WJ7A 3A8QA 1TXDA 1K5DB 4K2PA 3TCAA 4CYEA 2RVBB 2V76A 1N3HA 1WGQA 1W1DA 5HE2A 1BTNA 2CODA 3SUZA 1FGZA 4PQ0A 4GPTB 2DHIA 2VKIA 2COFA 2K2JA 5C79A 1X1GA 3X23A 4ZRIA 4B6HA 1H10A 1MIXA 2J0KA 1EGXA 1M7RA 1GG3A 3BJIA 4HDOA 2RLOA 2I1KA 2D9VA 2AL6A 4YL8A 1WJMA 5KCVA 2Y7BA 4YONA 3KY9A 3A98B 2DX1A 1NU2A 2MKRA 3QIJA 2Y8GA 2W2XC 5HE3A 1PLSA 2KCJA 3PVWA 3BINA 2D9ZA 1ZM0A 4HB4B 2R0DA 1DDMA 1FGYA 3LJUX 2J0JA 3KSYA 4A6FB 4HB3B 2XQNM 2MFQA 2G35A 1W1HA 1GC6A 1XD4A 3ODXA 2Z0PA 2YF0A 3TVVA 1TJ6A 2UZSA 3V5WA 4HB2B 4F7UP 1FAOA 5EFXA 2I5FA 4KVGB 2Z0QA 2DN6A 3RCPA 1OY2A 2BCJA 3TO1A 4GN1A 1OMWA 2KGXB 2DKQA 1FHOA 1RRPB 2P0DA 5C6RA 1OQNA 1B55A 1LW3A 3D8EA 3QBVB 4KAXB 4HHVA 1EF1A 2COAA 2DKPA 3P7ZA 1AQCA 2YS3A 1WG7A 3KRXA 5C5BB 1DROA 2H7DA 2Q13A 2RNRB 3HK0A 2EC1A 2YRYA 1P5TA 5D3YA 3DXDA 4HAUB 4TKNA 3PSCA 1FHWA 2ZPYA 2LOZA 4A6FA 2DHJA 4XWXA 1XCGA 1V5MA 2COCA 2GS0A 2ROVA 5CLLB 2D9XA 1NTVA 2CY4A 2VRWB 1V5UA 2ELBA 2D9WA 3AU5A 2CAYA 4IOYX 5D3XA 5HE0A 5DIFB 5J3QA 2GJYA 3OANA 1E5WA 3WYFB 4D0NB 1XKEA 1Z87A 1I2HA 2YT1A 4EJNA 1U5GA 3FM8C 1KI1B 4F7HA 5CLQB 4DXAB 5C5BA 1W1GA 3VIAA 2JP2A 4F7GA 1BTKA 2KUPA 2N0YA 1TQZA 3D8DA 3CIKA 1P6SA 2I1JA 3M1IB 1GC7A 1DDVA 1X05A 1J0WA 1FB8A 2RGNB 1RJ2A 3HQCA 5DH9B 1EVHA 5KQ4A 4P7IA 1UPRA 4GMXB 2M38A 3F5RA 1FHXA 5KQ1A 1UPQA
chains in the Genus database with same CATH superfamily
1XODA 1K5GB 2QKLA 5J3TA 3GYOA 4IAPA 2LOXA 5DI9B 1T77A 1PFJA 2Y8FA 1AWEA 4HAZB 1U5EA 4GMVA 1ZSQA 4HB0B 1DYNA 1WI1A 2FJUB 4IFSA 3HW2B 2GCLA 4HAWB 1NI2A 2K8EA 1U29A 2DLWA 1X1FA 2DYQA 3KZ1A 1Q67A 3AJ4A 3U7DA 3FEHA 3PG7A 4GXBA 2KUQA 2OTXA 4MK0A 3A8PA 3SNHA 4CHJA 2KIGA 2RRFA 4HAVB 1BWNA 1WVHA 2PZ1A 3TW1A 2R2YA 2YS1A 2D10A 1LB1A 4QJ3B 4ZRKA 2W2XD 2RSGA 1EAZA 4QXAB 5D27A 3NSUA 3B77A 4OSNA 2H7EA 1V88A 4Z2MB 3SO6A 2P0FA 2NZ8B 2NMBA 3SV1A 3T06A 2UZRA 2L1CA 1UEFA 3N7CA 1U27A 3IVFA 1H4RA 1SGHA 1MK9B 3CXBB 2GUMA 1SHCA 4DIXA 2J59M 2VSZA 2YVCA 4EKUA 3G9WA 1WGUA 5JLJB 2ROZB 2LKOA 2YT0A 5J3YA 5D3WA 3GYPA 2K00A 2R09A 5DHFB 1UNQA 3A58A 4GNKB 3FSSA 5FI0A 3TFMA 2X18A 5HE1A 3WA0A 2Z13A 4KHOA 3PVUA 3KRWA 1Y19B 2ADZA 4NY0A 1QQGA 2P0HA 5FI1A 4L1RA 3F0WA 2K2UA 3O96A 3ODWA 2D2QA 3D8FA 2DHKA 4HDQA 2MWNB 2LG1A 3PP2A 4QJ5B 4K2OA 2EMSA 3ODOA 2D9YA 4NSWA 3NW8A 2KR0A 2DYNA 1X11A 5JHGA 1U5DA 5JHHA 5GOWB 2IFSA 1Y5OA 2ELAA 2LYDA 1KZ7A 2RUKB 1MKEA 2DA0A 3U8ZA 2I5CA 1MAIA 4BBKA 3U12A 4Z2NA 2EJ8A 4H8SA 4A5KA 1DDWA 2YS5A 4DX90 2E2XA 4QJ4B 4TYZA 1KZGA 3VOQA 4PNKA 1MPHA 1J19A 2MDXA 2AEHA 3PEGA 4HAXB 1QC6A 4WVFB 1MI1A 2W2WA 4C0AA 4GZUA 1NTYA 4WSFA 3ZVRA 1P3RA 2FJLA 5LONB 4Y94A 3SYXA 4DBBA 4HATB 3MDBC 3P6AA 4MY6A 2YT2A 1X86A 1V89A 2HTHB 1DBHA 5L81A 2CY5A 3ULCA 4A6KA 4HAYB 2IYBA 3DXCA 3QWMA 4KHAA 3FVCA 1ISNA 2N23A 3AU4A 1BAKA 2DTCA 2GCJA 2J0MA 1MK7B 1ZC4B 4MT7A 3ZDTA 2YSZA 2UVMA 1U2BA 5DHAB 2D4QA 3ML4A 2M14A 5I2MA 2DFKA 2EMTA 2L2IA 2LULA 2HE7A 4ZRJA 1MIZB 2P8VA 3PZDA 1ZC3B 4L6EA 4K17A 4KHBB 3DXEA 3UZTA 4DX8A 1V5PA 1PMSA 4K81A 2Z14A 1XX0A 1ZVRA 5JP4A 1XR0B 5D3VA 2QKMA 1UNRA 3MPXA 3PVLA 2CRFA 2DX5A 1FOEA 5C16A 4EMOA 3ULBA 1M7EA 2D11A 1I7AA 4A6HA 1UNPA 1V61A 2K49A 4CHMA 1WJ1A 1IRSA 5LOPB 2OQBA 2Z0OA 1U5FA 4WJ7A 3A8QA 1TXDA 1K5DB 4K2PA 3TCAA 4CYEA 4D6WA 3NWFA 2RVBB 2V76A 1N3HA 1WGQA 1W1DA 5HE2A 1BTNA 4HSIA 2CODA 3SUZA 1FGZA 4PQ0A 4GPTB 2DHIA 2VKIA 2COFA 2K2JA 5C79A 1X1GA 3X23A 4ZRIA 4B6HA 1H10A 4KHBA 1MIXA 2J0KA 1EGXA 1M7RA 1GG3A 3BJIA 2Z59A 4HDOA 2RLOA 3NWDA 2I1KA 2D9VA 2AL6A 4YL8A 3OHMB 1WJMA 5KCVA 2Y7BA 4YONA 3KY9A 3A98B 2DX1A 4GOUA 1NU2A 2MKRA 3QIJA 2Y8GA 2W2XC 5HE3A 1PLSA 2KCJA 3PVWA 3BINA 2D9ZA 1ZM0A 4HB4B 2R0DA 1DDMA 1FGYA 3LJUX 2J0JA 3NWAA 3KSYA 4A6FB 4HB3B 2XQNM 2MFQA 2G35A 1W1HA 1GC6A 1XD4A 3ODXA 2Z0PA 2YF0A 1ZYIA 3TVVA 1TJ6A 2UZSA 3V5WA 4HB2B 4F7UP 1FAOA 5EFXA 2I5FA 4KVGB 2Z0QA 2DN6A 3RCPA 1OY2A 2BCJA 3TO1A 4GN1A 1OMWA 5I2SA 2KGXB 2DKQA 1FHOA 5M4YB 1RRPB 2P0DA 5C6RA 1OQNA 1B55A 1LW3A 3D8EA 3QBVB 4KAXB 4HHVA 3DCXA 3HSAA 1EF1A 2COAA 2DKPA 3P7ZA 1AQCA 2YS3A 1WG7A 3KRXA 2KIEA 5C5BB 1DROA 2H7DA 2Q13A 2RNRB 3HK0A 2EC1A 2YRYA 1P5TA 5D3YA 3DXDA 4HAUB 4TKNA 3PSCA 1FHWA 2ZPYA 2LOZA 4A6FA 2DHJA 4XWXA 1XCGA 1V5MA 2COCA 2GS0A 2ROVA 5CLLB 2D9XA 3HIEA 2ZKMX 1NTVA 4OT1A 2CY4A 2VRWB 4CSQA 1V5UA 2ELBA 5IRSA 2D9WA 3AU5A 2CAYA 4IOYX 5D3XA 5HE0A 5DIFB 5J3QA 2GJYA 3OANA 1E5WA 3WYFB 4D0NB 1XKEA 1Z87A 1I2HA 2YT1A 4EJNA 1U5GA 2NBVA 3FM8C 1KI1B 4F7HA 5CLQB 4DXAB 5C5BA 1W1GA 3VIAA 2JP2A 4F7GA 1BTKA 2KUPA 2N0YA 2Z4DA 1TQZA 3D8DA 3CIKA 1P6SA 2I1JA 3M1IB 1GC7A 1DDVA 1X05A 1J0WA 5LG4B 1FB8A 2RGNB 1RJ2A 3HQCA 5DH9B 1EVHA 5KQ4A 4P7IA 1UPRA 4GMXB 2M38A 3F5RA 1FHXA 5KQ1A 1UPQA
chains in the Genus database with same CATH topology
1XODA 1K5GB 2QKLA 5J3TA 3GYOA 4IAPA 2LOXA 5DI9B 2Y8FA 1PFJA 1AWEA 4HAZB 1U5EA 4GMVA 1ZSQA 4HB0B 1DYNA 1WI1A 4IFSA 3HW2B 2GCLA 4HAWB 1NI2A 1U29A 2DLWA 1X1FA 2DYQA 3KZ1A 1Q67A 3AJ4A 3U7DA 3FEHA 3PG7A 4GXBA 2OTXA 4MK0A 3A8PA 3SNHA 4CHJA 4HAVB 1BWNA 1WVHA 2PZ1A 3TW1A 2YS1A 2D10A 1LB1A 4ZRKA 2W2XD 2RSGA 1EAZA 5D27A 3NSUA 2H7EA 1V88A 4Z2MB 3SO6A 2P0FA 2NZ8B 2NMBA 3SV1A 3T06A 2UZRA 2L1CA 1UEFA 3N7CA 1U27A 3IVFA 1H4RA 1SGHA 1MK9B 3CXBB 1SHCA 2J59M 2VSZA 2YVCA 4EKUA 3G9WA 1WGUA 5JLJB 2ROZB 2LKOA 2YT0A 5J3YA 5D3WA 3GYPA 2K00A 2R09A 5DHFB 1UNQA 3FSSA 5FI0A 3TFMA 2X18A 5HE1A 3WA0A 4KHOA 3PVUA 3KRWA 1Y19B 2ADZA 4NY0A 1QQGA 2P0HA 5FI1A 3F0WA 2K2UA 3ODWA 3O96A 2D2QA 3D8FA 2DHKA 4HDQA 2MWNB 2LG1A 3PP2A 4K2OA 2EMSA 3ODOA 2D9YA 4NSWA 2DYNA 1X11A 5JHGA 1U5DA 5JHHA 5GOWB 2IFSA 1Y5OA 2ELAA 2LYDA 1KZ7A 2RUKB 1MKEA 2DA0A 3U8ZA 2I5CA 1MAIA 4BBKA 4Z2NA 2EJ8A 4H8SA 4A5KA 1DDWA 2YS5A 4DX90 2E2XA 4TYZA 1KZGA 3VOQA 4PNKA 1MPHA 1J19A 2MDXA 2AEHA 3PEGA 4HAXB 1QC6A 4WVFB 2W2WA 4C0AA 4GZUA 1NTYA 4WSFA 3ZVRA 1P3RA 2FJLA 5LONB 4Y94A 3SYXA 4DBBA 4HATB 3MDBC 3P6AA 4MY6A 1X86A 1V89A 2HTHB 1DBHA 5L81A 2CY5A 3ULCA 4A6KA 4HAYB 2IYBA 3DXCA 3QWMA 4KHAA 1ISNA 2N23A 3AU4A 1BAKA 2DTCA 2GCJA 2J0MA 1MK7B 1ZC4B 4MT7A 3ZDTA 2YSZA 2UVMA 1U2BA 5DHAB 2D4QA 3ML4A 2M14A 2DFKA 2EMTA 2L2IA 2LULA 2HE7A 4ZRJA 1MIZB 2P8VA 3PZDA 1ZC3B 4L6EA 4K17A 4KHBB 3DXEA 3UZTA 4DX8A 1V5PA 1PMSA 4K81A 1XX0A 1ZVRA 5JP4A 1XR0B 5D3VA 2QKMA 1UNRA 3MPXA 3PVLA 2CRFA 2DX5A 1FOEA 5C16A 4EMOA 3ULBA 1M7EA 2D11A 1I7AA 4A6HA 1UNPA 1V61A 4CHMA 1WJ1A 1IRSA 5LOPB 2OQBA 2Z0OA 1U5FA 4WJ7A 3A8QA 1TXDA 1K5DB 4K2PA 3TCAA 4CYEA 2RVBB 2V76A 1N3HA 1WGQA 1W1DA 5HE2A 1BTNA 2CODA 3SUZA 1FGZA 4PQ0A 4GPTB 2DHIA 2VKIA 2COFA 2K2JA 5C79A 1X1GA 3X23A 4ZRIA 4B6HA 1H10A 1MIXA 2J0KA 1EGXA 1M7RA 1GG3A 3BJIA 4HDOA 2RLOA 2I1KA 2D9VA 2AL6A 4YL8A 1WJMA 5KCVA 2Y7BA 4YONA 3KY9A 3A98B 2DX1A 1NU2A 2MKRA 3QIJA 2Y8GA 2W2XC 5HE3A 1PLSA 2KCJA 3PVWA 3BINA 2D9ZA 1ZM0A 4HB4B 2R0DA 1DDMA 1FGYA 3LJUX 2J0JA 3KSYA 4A6FB 4HB3B 2XQNM 2MFQA 2G35A 1W1HA 1GC6A 1XD4A 3ODXA 2Z0PA 2YF0A 3TVVA 1TJ6A 2UZSA 3V5WA 4HB2B 4F7UP 1FAOA 5EFXA 2I5FA 4KVGB 2Z0QA 2DN6A 3RCPA 1OY2A 2BCJA 3TO1A 4GN1A 1OMWA 2KGXB 2DKQA 1FHOA 1RRPB 2P0DA 5C6RA 1OQNA 1B55A 1LW3A 3D8EA 3QBVB 4KAXB 4HHVA 1EF1A 2COAA 2DKPA 3P7ZA 1AQCA 2YS3A 1WG7A 3KRXA 5C5BB 1DROA 2H7DA 2Q13A 2RNRB 3HK0A 2EC1A 2YRYA 1P5TA 5D3YA 3DXDA 4HAUB 4TKNA 3PSCA 1FHWA 2ZPYA 2LOZA 4A6FA 2DHJA 4XWXA 1XCGA 1V5MA 2COCA 2GS0A 2ROVA 5CLLB 2D9XA 1NTVA 2CY4A 2VRWB 1V5UA 2ELBA 2D9WA 3AU5A 2CAYA 4IOYX 5D3XA 5HE0A 5DIFB 5J3QA 2GJYA 3OANA 1E5WA 3WYFB 4D0NB 1XKEA 1Z87A 1I2HA 2YT1A 4EJNA 1U5GA 3FM8C 1KI1B 4F7HA 5CLQB 4DXAB 5C5BA 1W1GA 3VIAA 2JP2A 4F7GA 1BTKA 2KUPA 2N0YA 1TQZA 3D8DA 3CIKA 1P6SA 2I1JA 3M1IB 1GC7A 1DDVA 1X05A 1J0WA 1FB8A 2RGNB 1RJ2A 3HQCA 5DH9B 1EVHA 5KQ4A 4P7IA 1UPRA 4GMXB 2M38A 3F5RA 1FHXA 5KQ1A 1UPQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XOD A;  1K5G B;  2QKL A;  5J3T A;  3GYO A;  4IAP A;  2LOX A;  5DI9 B;  2Y8F A;  1PFJ A;  1AWE A;  4HAZ B;  1U5E A;  4GMV A;  1ZSQ A;  4HB0 B;  1DYN A;  1WI1 A;  4IFS A;  3HW2 B;  2GCL A;  4HAW B;  1NI2 A;  1U29 A;  2DLW A;  1X1F A;  2DYQ A;  3KZ1 A;  1Q67 A;  3AJ4 A;  3U7D A;  3FEH A;  3PG7 A;  4GXB A;  2OTX A;  4MK0 A;  3A8P A;  3SNH A;  4CHJ A;  4HAV B;  1BWN A;  1WVH A;  2PZ1 A;  3TW1 A;  2YS1 A;  2D10 A;  1LB1 A;  4ZRK A;  2W2X D;  2RSG A;  1EAZ A;  5D27 A;  3NSU A;  2H7E A;  1V88 A;  4Z2M B;  3SO6 A;  2P0F A;  2NZ8 B;  2NMB A;  3SV1 A;  3T06 A;  2UZR A;  2L1C A;  1UEF A;  3N7C A;  1U27 A;  3IVF A;  1H4R A;  1SGH A;  1MK9 B;  3CXB B;  1SHC A;  2J59 M;  2VSZ A;  2YVC A;  4EKU A;  3G9W A;  1WGU A;  5JLJ B;  2ROZ B;  2LKO A;  2YT0 A;  5J3Y A;  5D3W A;  3GYP A;  2K00 A;  2R09 A;  5DHF B;  1UNQ A;  3FSS A;  5FI0 A;  3TFM A;  2X18 A;  5HE1 A;  3WA0 A;  4KHO A;  3PVU A;  3KRW A;  1Y19 B;  2ADZ A;  4NY0 A;  1QQG A;  2P0H A;  5FI1 A;  3F0W A;  2K2U A;  3ODW A;  3O96 A;  2D2Q A;  3D8F A;  2DHK A;  4HDQ A;  2MWN B;  2LG1 A;  3PP2 A;  4K2O A;  2EMS A;  3ODO A;  2D9Y A;  4NSW A;  2DYN A;  1X11 A;  5JHG A;  1U5D A;  5JHH A;  5GOW B;  2IFS A;  1Y5O A;  2ELA A;  2LYD A;  1KZ7 A;  2RUK B;  1MKE A;  2DA0 A;  3U8Z A;  2I5C A;  1MAI A;  4BBK A;  4Z2N A;  2EJ8 A;  4H8S A;  4A5K A;  1DDW A;  2YS5 A;  4DX9 0;  2E2X A;  4TYZ A;  1KZG A;  3VOQ A;  4PNK A;  1MPH A;  1J19 A;  2MDX A;  2AEH A;  3PEG A;  4HAX B;  1QC6 A;  4WVF B;  2W2W A;  4C0A A;  4GZU A;  1NTY A;  4WSF A;  3ZVR A;  1P3R A;  2FJL A;  5LON B;  4Y94 A;  3SYX A;  4DBB A;  4HAT B;  3MDB C;  3P6A A;  4MY6 A;  1X86 A;  1V89 A;  2HTH B;  1DBH A;  5L81 A;  2CY5 A;  3ULC A;  4A6K A;  4HAY B;  2IYB A;  3DXC A;  3QWM A;  4KHA A;  1ISN A;  2N23 A;  3AU4 A;  1BAK A;  2DTC A;  2GCJ A;  2J0M A;  1MK7 B;  1ZC4 B;  4MT7 A;  3ZDT A;  2YSZ A;  2UVM A;  1U2B A;  5DHA B;  2D4Q A;  3ML4 A;  2M14 A;  2DFK A;  2EMT A;  2L2I A;  2LUL A;  2HE7 A;  4ZRJ A;  1MIZ B;  2P8V A;  3PZD A;  1ZC3 B;  4L6E A;  4K17 A;  4KHB B;  3DXE A;  3UZT A;  4DX8 A;  1V5P A;  1PMS A;  4K81 A;  1XX0 A;  1ZVR A;  5JP4 A;  1XR0 B;  5D3V A;  2QKM A;  1UNR A;  3MPX A;  3PVL A;  2CRF A;  2DX5 A;  1FOE A;  5C16 A;  4EMO A;  3ULB A;  1M7E A;  2D11 A;  1I7A A;  4A6H A;  1UNP A;  1V61 A;  4CHM A;  1WJ1 A;  1IRS A;  5LOP B;  2OQB A;  2Z0O A;  1U5F A;  4WJ7 A;  3A8Q A;  1TXD A;  1K5D B;  4K2P A;  3TCA A;  4CYE A;  2RVB B;  2V76 A;  1N3H A;  1WGQ A;  1W1D A;  5HE2 A;  1BTN A;  2COD A;  3SUZ A;  1FGZ A;  4PQ0 A;  4GPT B;  2DHI A;  2VKI A;  2COF A;  2K2J A;  5C79 A;  1X1G A;  3X23 A;  4ZRI A;  4B6H A;  1H10 A;  1MIX A;  2J0K A;  1EGX A;  1M7R A;  1GG3 A;  3BJI A;  4HDO A;  2RLO A;  2I1K A;  2D9V A;  2AL6 A;  4YL8 A;  1WJM A;  5KCV A;  2Y7B A;  4YON A;  3KY9 A;  3A98 B;  2DX1 A;  1NU2 A;  2MKR A;  3QIJ A;  2Y8G A;  2W2X C;  5HE3 A;  1PLS A;  2KCJ A;  3PVW A;  3BIN A;  2D9Z A;  1ZM0 A;  4HB4 B;  2R0D A;  1DDM A;  1FGY A;  3LJU X;  2J0J A;  3KSY A;  4A6F B;  4HB3 B;  2XQN M;  2MFQ A;  2G35 A;  1W1H A;  1GC6 A;  1XD4 A;  3ODX A;  2Z0P A;  2YF0 A;  3TVV A;  1TJ6 A;  2UZS A;  3V5W A;  4HB2 B;  4F7U P;  1FAO A;  5EFX A;  2I5F A;  4KVG B;  2Z0Q A;  2DN6 A;  3RCP A;  1OY2 A;  2BCJ A;  3TO1 A;  4GN1 A;  1OMW A;  2KGX B;  2DKQ A;  1FHO A;  1RRP B;  2P0D A;  5C6R A;  1OQN A;  1B55 A;  1LW3 A;  3D8E A;  3QBV B;  4KAX B;  4HHV A;  1EF1 A;  2COA A;  2DKP A;  3P7Z A;  1AQC A;  2YS3 A;  1WG7 A;  3KRX A;  5C5B B;  1DRO A;  2H7D A;  2Q13 A;  2RNR B;  3HK0 A;  2EC1 A;  2YRY A;  1P5T A;  5D3Y A;  3DXD A;  4HAU B;  4TKN A;  3PSC A;  1FHW A;  2ZPY A;  2LOZ A;  4A6F A;  2DHJ A;  4XWX A;  1XCG A;  1V5M A;  2COC A;  2GS0 A;  2ROV A;  5CLL B;  2D9X A;  1NTV A;  2CY4 A;  2VRW B;  1V5U A;  2ELB A;  2D9W A;  3AU5 A;  2CAY A;  4IOY X;  5D3X A;  5HE0 A;  5DIF B;  5J3Q A;  2GJY A;  3OAN A;  1E5W A;  3WYF B;  4D0N B;  1XKE A;  1Z87 A;  1I2H A;  2YT1 A;  4EJN A;  1U5G A;  3FM8 C;  1KI1 B;  4F7H A;  5CLQ B;  4DXA B;  5C5B A;  1W1G A;  3VIA A;  2JP2 A;  4F7G A;  1BTK A;  2KUP A;  2N0Y A;  1TQZ A;  3D8D A;  3CIK A;  1P6S A;  2I1J A;  3M1I B;  1GC7 A;  1DDV A;  1X05 A;  1J0W A;  1FB8 A;  2RGN B;  1RJ2 A;  3HQC A;  5DH9 B;  1EVH A;  5KQ4 A;  4P7I A;  1UPR A;  4GMX B;  2M38 A;  3F5R A;  1FHX A;  5KQ1 A;  1UPQ A; 
#chains in the Genus database with same CATH topology
 1XOD A;  1K5G B;  2QKL A;  5J3T A;  3GYO A;  4IAP A;  2LOX A;  5DI9 B;  1T77 A;  1PFJ A;  2Y8F A;  1AWE A;  4HAZ B;  1U5E A;  4GMV A;  1ZSQ A;  4HB0 B;  1DYN A;  1WI1 A;  2FJU B;  4IFS A;  3HW2 B;  2GCL A;  4HAW B;  1NI2 A;  2K8E A;  1U29 A;  2DLW A;  1X1F A;  2DYQ A;  3KZ1 A;  1Q67 A;  3AJ4 A;  3U7D A;  3FEH A;  3PG7 A;  4GXB A;  2KUQ A;  2OTX A;  4MK0 A;  3A8P A;  3SNH A;  4CHJ A;  2KIG A;  2RRF A;  4HAV B;  1BWN A;  1WVH A;  2PZ1 A;  3TW1 A;  2R2Y A;  2YS1 A;  2D10 A;  1LB1 A;  4QJ3 B;  4ZRK A;  2W2X D;  2RSG A;  1EAZ A;  4QXA B;  5D27 A;  3NSU A;  3B77 A;  4OSN A;  2H7E A;  1V88 A;  4Z2M B;  3SO6 A;  2P0F A;  2NZ8 B;  2NMB A;  3SV1 A;  3T06 A;  2UZR A;  2L1C A;  1UEF A;  3N7C A;  1U27 A;  3IVF A;  1H4R A;  1SGH A;  1MK9 B;  3CXB B;  2GUM A;  1SHC A;  4DIX A;  2J59 M;  2VSZ A;  2YVC A;  4EKU A;  3G9W A;  1WGU A;  5JLJ B;  2ROZ B;  2LKO A;  2YT0 A;  5J3Y A;  5D3W A;  3GYP A;  2K00 A;  2R09 A;  5DHF B;  1UNQ A;  3A58 A;  4GNK B;  3FSS A;  5FI0 A;  3TFM A;  2X18 A;  5HE1 A;  3WA0 A;  2Z13 A;  4KHO A;  3PVU A;  3KRW A;  1Y19 B;  2ADZ A;  4NY0 A;  1QQG A;  2P0H A;  5FI1 A;  4L1R A;  3F0W A;  2K2U A;  3O96 A;  3ODW A;  2D2Q A;  3D8F A;  2DHK A;  4HDQ A;  2MWN B;  2LG1 A;  3PP2 A;  4QJ5 B;  4K2O A;  2EMS A;  3ODO A;  2D9Y A;  4NSW A;  3NW8 A;  2KR0 A;  2DYN A;  1X11 A;  5JHG A;  1U5D A;  5JHH A;  5GOW B;  2IFS A;  1Y5O A;  2ELA A;  2LYD A;  1KZ7 A;  2RUK B;  1MKE A;  2DA0 A;  3U8Z A;  2I5C A;  1MAI A;  4BBK A;  3U12 A;  4Z2N A;  2EJ8 A;  4H8S A;  4A5K A;  1DDW A;  2YS5 A;  4DX9 0;  2E2X A;  4QJ4 B;  4TYZ A;  1KZG A;  3VOQ A;  4PNK A;  1MPH A;  1J19 A;  2MDX A;  2AEH A;  3PEG A;  4HAX B;  1QC6 A;  4WVF B;  1MI1 A;  2W2W A;  4C0A A;  4GZU A;  1NTY A;  4WSF A;  3ZVR A;  1P3R A;  2FJL A;  5LON B;  4Y94 A;  3SYX A;  4DBB A;  4HAT B;  3MDB C;  3P6A A;  4MY6 A;  2YT2 A;  1X86 A;  1V89 A;  2HTH B;  1DBH A;  5L81 A;  2CY5 A;  3ULC A;  4A6K A;  4HAY B;  2IYB A;  3DXC A;  3QWM A;  4KHA A;  3FVC A;  1ISN A;  2N23 A;  3AU4 A;  1BAK A;  2DTC A;  2GCJ A;  2J0M A;  1MK7 B;  1ZC4 B;  4MT7 A;  3ZDT A;  2YSZ A;  2UVM A;  1U2B A;  5DHA B;  2D4Q A;  3ML4 A;  2M14 A;  5I2M A;  2DFK A;  2EMT A;  2L2I A;  2LUL A;  2HE7 A;  4ZRJ A;  1MIZ B;  2P8V A;  3PZD A;  1ZC3 B;  4L6E A;  4K17 A;  4KHB B;  3DXE A;  3UZT A;  4DX8 A;  1V5P A;  1PMS A;  4K81 A;  2Z14 A;  1XX0 A;  1ZVR A;  5JP4 A;  1XR0 B;  5D3V A;  2QKM A;  1UNR A;  3MPX A;  3PVL A;  2CRF A;  2DX5 A;  1FOE A;  5C16 A;  4EMO A;  3ULB A;  1M7E A;  2D11 A;  1I7A A;  4A6H A;  1UNP A;  1V61 A;  2K49 A;  4CHM A;  1WJ1 A;  1IRS A;  5LOP B;  2OQB A;  2Z0O A;  1U5F A;  4WJ7 A;  3A8Q A;  1TXD A;  1K5D B;  4K2P A;  3TCA A;  4CYE A;  4D6W A;  3NWF A;  2RVB B;  2V76 A;  1N3H A;  1WGQ A;  1W1D A;  5HE2 A;  1BTN A;  4HSI A;  2COD A;  3SUZ A;  1FGZ A;  4PQ0 A;  4GPT B;  2DHI A;  2VKI A;  2COF A;  2K2J A;  5C79 A;  1X1G A;  3X23 A;  4ZRI A;  4B6H A;  1H10 A;  4KHB A;  1MIX A;  2J0K A;  1EGX A;  1M7R A;  1GG3 A;  3BJI A;  2Z59 A;  4HDO A;  2RLO A;  3NWD A;  2I1K A;  2D9V A;  2AL6 A;  4YL8 A;  3OHM B;  1WJM A;  5KCV A;  2Y7B A;  4YON A;  3KY9 A;  3A98 B;  2DX1 A;  4GOU A;  1NU2 A;  2MKR A;  3QIJ A;  2Y8G A;  2W2X C;  5HE3 A;  1PLS A;  2KCJ A;  3PVW A;  3BIN A;  2D9Z A;  1ZM0 A;  4HB4 B;  2R0D A;  1DDM A;  1FGY A;  3LJU X;  2J0J A;  3NWA A;  3KSY A;  4A6F B;  4HB3 B;  2XQN M;  2MFQ A;  2G35 A;  1W1H A;  1GC6 A;  1XD4 A;  3ODX A;  2Z0P A;  2YF0 A;  1ZYI A;  3TVV A;  1TJ6 A;  2UZS A;  3V5W A;  4HB2 B;  4F7U P;  1FAO A;  5EFX A;  2I5F A;  4KVG B;  2Z0Q A;  2DN6 A;  3RCP A;  1OY2 A;  2BCJ A;  3TO1 A;  4GN1 A;  1OMW A;  5I2S A;  2KGX B;  2DKQ A;  1FHO A;  5M4Y B;  1RRP B;  2P0D A;  5C6R A;  1OQN A;  1B55 A;  1LW3 A;  3D8E A;  3QBV B;  4KAX B;  4HHV A;  3DCX A;  3HSA A;  1EF1 A;  2COA A;  2DKP A;  3P7Z A;  1AQC A;  2YS3 A;  1WG7 A;  3KRX A;  2KIE A;  5C5B B;  1DRO A;  2H7D A;  2Q13 A;  2RNR B;  3HK0 A;  2EC1 A;  2YRY A;  1P5T A;  5D3Y A;  3DXD A;  4HAU B;  4TKN A;  3PSC A;  1FHW A;  2ZPY A;  2LOZ A;  4A6F A;  2DHJ A;  4XWX A;  1XCG A;  1V5M A;  2COC A;  2GS0 A;  2ROV A;  5CLL B;  2D9X A;  3HIE A;  2ZKM X;  1NTV A;  4OT1 A;  2CY4 A;  2VRW B;  4CSQ A;  1V5U A;  2ELB A;  5IRS A;  2D9W A;  3AU5 A;  2CAY A;  4IOY X;  5D3X A;  5HE0 A;  5DIF B;  5J3Q A;  2GJY A;  3OAN A;  1E5W A;  3WYF B;  4D0N B;  1XKE A;  1Z87 A;  1I2H A;  2YT1 A;  4EJN A;  1U5G A;  2NBV A;  3FM8 C;  1KI1 B;  4F7H A;  5CLQ B;  4DXA B;  5C5B A;  1W1G A;  3VIA A;  2JP2 A;  4F7G A;  1BTK A;  2KUP A;  2N0Y A;  2Z4D A;  1TQZ A;  3D8D A;  3CIK A;  1P6S A;  2I1J A;  3M1I B;  1GC7 A;  1DDV A;  1X05 A;  1J0W A;  5LG4 B;  1FB8 A;  2RGN B;  1RJ2 A;  3HQC A;  5DH9 B;  1EVH A;  5KQ4 A;  4P7I A;  1UPR A;  4GMX B;  2M38 A;  3F5R A;  1FHX A;  5KQ1 A;  1UPQ A; 
#chains in the Genus database with same CATH homology
 1XOD A;  1K5G B;  2QKL A;  5J3T A;  3GYO A;  4IAP A;  2LOX A;  5DI9 B;  2Y8F A;  1PFJ A;  1AWE A;  4HAZ B;  1U5E A;  4GMV A;  1ZSQ A;  4HB0 B;  1DYN A;  1WI1 A;  4IFS A;  3HW2 B;  2GCL A;  4HAW B;  1NI2 A;  1U29 A;  2DLW A;  1X1F A;  2DYQ A;  3KZ1 A;  1Q67 A;  3AJ4 A;  3U7D A;  3FEH A;  3PG7 A;  4GXB A;  2OTX A;  4MK0 A;  3A8P A;  3SNH A;  4CHJ A;  4HAV B;  1BWN A;  1WVH A;  2PZ1 A;  3TW1 A;  2YS1 A;  2D10 A;  1LB1 A;  4ZRK A;  2W2X D;  2RSG A;  1EAZ A;  5D27 A;  3NSU A;  2H7E A;  1V88 A;  4Z2M B;  3SO6 A;  2P0F A;  2NZ8 B;  2NMB A;  3SV1 A;  3T06 A;  2UZR A;  2L1C A;  1UEF A;  3N7C A;  1U27 A;  3IVF A;  1H4R A;  1SGH A;  1MK9 B;  3CXB B;  1SHC A;  2J59 M;  2VSZ A;  2YVC A;  4EKU A;  3G9W A;  1WGU A;  5JLJ B;  2ROZ B;  2LKO A;  2YT0 A;  5J3Y A;  5D3W A;  3GYP A;  2K00 A;  2R09 A;  5DHF B;  1UNQ A;  3FSS A;  5FI0 A;  3TFM A;  2X18 A;  5HE1 A;  3WA0 A;  4KHO A;  3PVU A;  3KRW A;  1Y19 B;  2ADZ A;  4NY0 A;  1QQG A;  2P0H A;  5FI1 A;  3F0W A;  2K2U A;  3ODW A;  3O96 A;  2D2Q A;  3D8F A;  2DHK A;  4HDQ A;  2MWN B;  2LG1 A;  3PP2 A;  4K2O A;  2EMS A;  3ODO A;  2D9Y A;  4NSW A;  2DYN A;  1X11 A;  5JHG A;  1U5D A;  5JHH A;  5GOW B;  2IFS A;  1Y5O A;  2ELA A;  2LYD A;  1KZ7 A;  2RUK B;  1MKE A;  2DA0 A;  3U8Z A;  2I5C A;  1MAI A;  4BBK A;  4Z2N A;  2EJ8 A;  4H8S A;  4A5K A;  1DDW A;  2YS5 A;  4DX9 0;  2E2X A;  4TYZ A;  1KZG A;  3VOQ A;  4PNK A;  1MPH A;  1J19 A;  2MDX A;  2AEH A;  3PEG A;  4HAX B;  1QC6 A;  4WVF B;  2W2W A;  4C0A A;  4GZU A;  1NTY A;  4WSF A;  3ZVR A;  1P3R A;  2FJL A;  5LON B;  4Y94 A;  3SYX A;  4DBB A;  4HAT B;  3MDB C;  3P6A A;  4MY6 A;  1X86 A;  1V89 A;  2HTH B;  1DBH A;  5L81 A;  2CY5 A;  3ULC A;  4A6K A;  4HAY B;  2IYB A;  3DXC A;  3QWM A;  4KHA A;  1ISN A;  2N23 A;  3AU4 A;  1BAK A;  2DTC A;  2GCJ A;  2J0M A;  1MK7 B;  1ZC4 B;  4MT7 A;  3ZDT A;  2YSZ A;  2UVM A;  1U2B A;  5DHA B;  2D4Q A;  3ML4 A;  2M14 A;  2DFK A;  2EMT A;  2L2I A;  2LUL A;  2HE7 A;  4ZRJ A;  1MIZ B;  2P8V A;  3PZD A;  1ZC3 B;  4L6E A;  4K17 A;  4KHB B;  3DXE A;  3UZT A;  4DX8 A;  1V5P A;  1PMS A;  4K81 A;  1XX0 A;  1ZVR A;  5JP4 A;  1XR0 B;  5D3V A;  2QKM A;  1UNR A;  3MPX A;  3PVL A;  2CRF A;  2DX5 A;  1FOE A;  5C16 A;  4EMO A;  3ULB A;  1M7E A;  2D11 A;  1I7A A;  4A6H A;  1UNP A;  1V61 A;  4CHM A;  1WJ1 A;  1IRS A;  5LOP B;  2OQB A;  2Z0O A;  1U5F A;  4WJ7 A;  3A8Q A;  1TXD A;  1K5D B;  4K2P A;  3TCA A;  4CYE A;  2RVB B;  2V76 A;  1N3H A;  1WGQ A;  1W1D A;  5HE2 A;  1BTN A;  2COD A;  3SUZ A;  1FGZ A;  4PQ0 A;  4GPT B;  2DHI A;  2VKI A;  2COF A;  2K2J A;  5C79 A;  1X1G A;  3X23 A;  4ZRI A;  4B6H A;  1H10 A;  1MIX A;  2J0K A;  1EGX A;  1M7R A;  1GG3 A;  3BJI A;  4HDO A;  2RLO A;  2I1K A;  2D9V A;  2AL6 A;  4YL8 A;  1WJM A;  5KCV A;  2Y7B A;  4YON A;  3KY9 A;  3A98 B;  2DX1 A;  1NU2 A;  2MKR A;  3QIJ A;  2Y8G A;  2W2X C;  5HE3 A;  1PLS A;  2KCJ A;  3PVW A;  3BIN A;  2D9Z A;  1ZM0 A;  4HB4 B;  2R0D A;  1DDM A;  1FGY A;  3LJU X;  2J0J A;  3KSY A;  4A6F B;  4HB3 B;  2XQN M;  2MFQ A;  2G35 A;  1W1H A;  1GC6 A;  1XD4 A;  3ODX A;  2Z0P A;  2YF0 A;  3TVV A;  1TJ6 A;  2UZS A;  3V5W A;  4HB2 B;  4F7U P;  1FAO A;  5EFX A;  2I5F A;  4KVG B;  2Z0Q A;  2DN6 A;  3RCP A;  1OY2 A;  2BCJ A;  3TO1 A;  4GN1 A;  1OMW A;  2KGX B;  2DKQ A;  1FHO A;  1RRP B;  2P0D A;  5C6R A;  1OQN A;  1B55 A;  1LW3 A;  3D8E A;  3QBV B;  4KAX B;  4HHV A;  1EF1 A;  2COA A;  2DKP A;  3P7Z A;  1AQC A;  2YS3 A;  1WG7 A;  3KRX A;  5C5B B;  1DRO A;  2H7D A;  2Q13 A;  2RNR B;  3HK0 A;  2EC1 A;  2YRY A;  1P5T A;  5D3Y A;  3DXD A;  4HAU B;  4TKN A;  3PSC A;  1FHW A;  2ZPY A;  2LOZ A;  4A6F A;  2DHJ A;  4XWX A;  1XCG A;  1V5M A;  2COC A;  2GS0 A;  2ROV A;  5CLL B;  2D9X A;  1NTV A;  2CY4 A;  2VRW B;  1V5U A;  2ELB A;  2D9W A;  3AU5 A;  2CAY A;  4IOY X;  5D3X A;  5HE0 A;  5DIF B;  5J3Q A;  2GJY A;  3OAN A;  1E5W A;  3WYF B;  4D0N B;  1XKE A;  1Z87 A;  1I2H A;  2YT1 A;  4EJN A;  1U5G A;  3FM8 C;  1KI1 B;  4F7H A;  5CLQ B;  4DXA B;  5C5B A;  1W1G A;  3VIA A;  2JP2 A;  4F7G A;  1BTK A;  2KUP A;  2N0Y A;  1TQZ A;  3D8D A;  3CIK A;  1P6S A;  2I1J A;  3M1I B;  1GC7 A;  1DDV A;  1X05 A;  1J0W A;  1FB8 A;  2RGN B;  1RJ2 A;  3HQC A;  5DH9 B;  1EVH A;  5KQ4 A;  4P7I A;  1UPR A;  4GMX B;  2M38 A;  3F5R A;  1FHX A;  5KQ1 A;  1UPQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...