5CLQB

Ran y39a in complex with gppnhp and ranbd1
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
134
structure length
134
Chain Sequence
EPVVPLPDKIEVKTGEEDEEEFFCNRAKLFRFDVESKEWKERGIGNVKILRHKTSGKIRLLMRREQVLKICANHYISPDMKLTPNAGSDRSFVWHALDYADELPKPEQLAIRFKTPEEAALFKCKFEEAQSILK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords GTP-binding nuclear protein Ran
publication title Catalysis of GTP Hydrolysis by Small GTPases at Atomic Detail by Integration of X-ray Crystallography, Experimental, and Theoretical IR Spectroscopy.
pubmed doi rcsb
source organism Homo sapiens
total genus 33
structure length 134
sequence length 134
chains with identical sequence D
ec nomenclature ec 6.3.2.-:
pdb deposition date 2015-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00638 Ran_BP1 RanBP1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 5clqB00
2D9YA 2RNRB 3VIAA 1UPQA 1UNRA 4DX8A 1OY2A 4KHAA 4GMVA 1FB8A 3AU5A 2I1KA 1XKEA 1B55A 2ROZB 3GYOA 3MDBC 1XX0A 1XD4A 2BCJA 4YONA 2HTHB 5DI9B 5JLJB 1GG3A 2YT1A 3P7ZA 1TJ6A 5FI0A 2JP2A 1GC6A 2YT0A 1FGZA 3DXEA 1QQGA 2MDXA 3M1IB 3AJ4A 1MAIA 2YF0A 5D3WA 5JHHA 5JHGA 2DHJA 1XODA 1ZC3B 5FI1A 5J3QA 5C79A 3KSYA 3PG7A 1WJMA 2G35A 2D9XA 5DHFB 2YVCA 4KAXB 4DXAB 4HDQA 4GXBA 2LOXA 1U29A 2Q13A 3ODXA 1XR0B 2DX5A 4A6HA 3PP2A 1W1DA 1U5EA 1BTKA 1BWNA 1WGQA 5HE0A 5JP4A 1V5UA 3FM8C 3U7DA 2CRFA 4ZRIA 1U2BA 1NTYA 1PLSA 2M14A 2RSGA 4HDOA 2I5FA 1AWEA 4HB4B 1UEFA 2Y8GA 1W1HA 4TYZA 1W1GA 2LKOA 4B6HA 5C5BA 1V5PA 2P8VA 4IAPA 4L6EA 3ML4A 2ELBA 2ADZA 2D11A 1NU2A 1MK9B 2Z0PA 1IRSA 2DX1A 2Y8FA 2KGXB 2D9VA 1WVHA 4HAUB 1X1FA 1FHXA 1V5MA 3TO1A 2MKRA 2AL6A 4K17A 5KCVA 2COFA 1H4RA 1ZSQA 2D9ZA 1RRPB 3CIKA 1H10A 5D3XA 1KI1B 5J3YA 4TKNA 4K81A 4K2PA 3D8DA 2HE7A 5HE2A 1M7EA 2L2IA 5D3VA 2IFSA 1EF1A 2EMTA 2UZRA 2R0DA 2COAA 1FHWA 1LB1A 2EMSA 1UNPA 2UZSA 1Z87A 2RUKB 1BAKA 4MY6A 1P3RA 2M38A 2CAYA 5GOWB 1MKEA 3G9WA 2K2UA 3DXCA 1SHCA 2J0JA 3HQCA 3SNHA 2CY5A 4Y94A 1J0WA 4A5KA 1UPRA 3DXDA 4HAYB 3HW2B 2KUPA 3U8ZA 1WJ1A 4Z2NA 4CHMA 2LYDA 1BTNA 5C6RA 1XCGA 4F7HA 2OQBA 2VKIA 4XWXA 1EGXA 1DDMA 3KRXA 4KVGB 2DYNA 3ODWA 1SGHA 2E2XA 2IYBA 2K00A 5HE1A 1Q67A 2Z0QA 2GCJA 3PVWA 2H7EA 2ZPYA 3SYXA 1DDVA 1PFJA 2P0FA 5KQ1A 3UZTA 2DLWA 2MFQA 1V88A 4DBBA 4GZUA 2FJLA 4ZRKA 4BBKA 1K5GB 2Y7BA 2LOZA 4HAWB 3KY9A 1ZM0A 4CYEA 4A6FA 2J59M 1LW3A 1EAZA 4WJ7A 5DHAB 2N0YA 2DHKA 2YRYA 4PQ0A 3ULCA 3ZDTA 2ROVA 4A6KA 5KQ4A 2CODA 3O96A 3PSCA 4HAXB 2AEHA 3A8QA 3IVFA 1V61A 2LG1A 3SUZA 1Y5OA 2KCJA 2DTCA 2YS3A 3PVLA 4HB0B 4MK0A 1FGYA 1OMWA 3P6AA 4IOYX 5LOPB 1I7AA 3LJUX 4H8SA 4HAVB 1E5WA 3PEGA 3TW1A 1MIXA 2X18A 2EJ8A 1Y19B 2YS5A 5HE3A 2GS0A 5D27A 4GN1A 2H7DA 2COCA 3PVUA 2K2JA 3OANA 1WGUA 1U5GA 5C16A 3NSUA 4D0NB 2VSZA 4IFSA 1WG7A 2UVMA 1PMSA 3FSSA 2NZ8B 5D3YA 1J19A 3SV1A 2RGNB 2W2WA 5CLLB 3F5RA 1MK7B 1NTVA 1KZ7A 4NSWA 3F0WA 4F7UP 3ZVRA 4PNKA 4P7IA 2MWNB 2DA0A 3WA0A 3GYPA 2V76A 1DROA 1FAOA 1TXDA 1X11A 3VOQA 5EFXA 2D9WA 3KRWA 1ISNA 1EVHA 1FHOA 1MIZB 2QKMA 1P5TA 1U27A 5LONB 4DX90 1NI2A 4WVFB 2D10A 2P0HA 1M7RA 2NMBA 4F7GA 1DBHA 2D2QA 1N3HA 2YSZA 1WI1A 1X1GA 2CY4A 4KHBB 4HB3B 3TVVA 2J0MA 3CXBB 3HK0A 3ODOA 2VRWB 3FEHA 2L1CA 3WYFB 1DYNA 4C0AA 1P6SA 4EMOA 4KHOA 1MPHA 4HATB 4CHJA 3V5WA 4A6FB 3TCAA 3QBVB 1I2HA 3AU4A 5C5BB 2N23A 2YS1A 3A8PA 3X23A 1V89A 1OQNA 3BJIA 2Z0OA 3N7CA 1GC7A 2DYQA 2DFKA 1ZC4B 4ZRJA 4WSFA 5DH9B 3QIJA 2W2XC 5DIFB 2XQNM 3TFMA 4EJNA 2DKPA 1X86A 1AQCA 4K2OA 4HB2B 5J3TA 2EC1A 3MPXA 3D8EA 3D8FA 1X05A 1U5DA 2OTXA 1U5FA 1RJ2A 2W2XD 3KZ1A 4MT7A 3RCPA 1ZVRA 3A98B 3QWMA 2RVBB 4NY0A 1QC6A 2I5CA 2QKLA 4GMXB 4GPTB 4HHVA 2D4QA 2DN6A 3ULBA 2RLOA 2GJYA 3BINA 1DDWA 3PZDA 1UNQA 2DHIA 2DKQA 4Z2MB 5L81A 3SO6A 4YL8A 2GCLA 5CLQB 1FOEA 2P0DA 4HAZB 1TQZA 3T06A 1K5DB 1KZGA 2ELAA 2I1JA 2LULA 2PZ1A 2J0KA 2R09A 4EKUA
chains in the Genus database with same CATH superfamily
4DIXA 2D9YA 2RNRB 3VIAA 1UPQA 1UNRA 4DX8A 1OY2A 4KHAA 4GMVA 1FB8A 3AU5A 2I1KA 4D6WA 1XKEA 1B55A 2ROZB 3GYOA 3MDBC 1XX0A 1XD4A 2BCJA 4YONA 2HTHB 5DI9B 5JLJB 1GG3A 2YT1A 3P7ZA 1TJ6A 5FI0A 2JP2A 1GC6A 2YT0A 1FGZA 3DXEA 2RRFA 1QQGA 2MDXA 3M1IB 3AJ4A 1MAIA 2YF0A 5D3WA 5JHHA 5JHGA 2DHJA 1XODA 1ZC3B 4GOUA 5FI1A 5J3QA 5C79A 3KSYA 3PG7A 1WJMA 2G35A 2D9XA 5DHFB 2YVCA 4KAXB 1T77A 4OSNA 4DXAB 4HDQA 4GXBA 2LOXA 1U29A 2Q13A 3ODXA 1XR0B 2DX5A 4A6HA 3PP2A 1W1DA 1U5EA 1BTKA 1BWNA 1WGQA 5HE0A 5JP4A 1V5UA 3FM8C 3U7DA 2CRFA 4ZRIA 5LG4B 1U2BA 1NTYA 1PLSA 2M14A 2RSGA 4HDOA 2I5FA 1AWEA 4HB4B 1UEFA 2Y8GA 1W1HA 4TYZA 1W1GA 2LKOA 4B6HA 5C5BA 1V5PA 2Z59A 2P8VA 4IAPA 4L6EA 3ML4A 2ELBA 2ADZA 4L1RA 2D11A 1NU2A 1MK9B 2Z0PA 1IRSA 2DX1A 2Y8FA 2KGXB 2D9VA 3HIEA 1WVHA 4HAUB 1X1FA 1FHXA 1V5MA 3TO1A 2MKRA 2AL6A 4K17A 5KCVA 2COFA 1H4RA 1ZSQA 4HSIA 2D9ZA 1RRPB 3CIKA 1H10A 5D3XA 1KI1B 5J3YA 2KUQA 4TKNA 4K81A 4K2PA 3D8DA 2HE7A 5HE2A 2NBVA 1M7EA 2L2IA 5D3VA 3HSAA 2IFSA 1EF1A 2EMTA 2UZRA 2R0DA 2COAA 1FHWA 1LB1A 2EMSA 1UNPA 2UZSA 1Z87A 2RUKB 1BAKA 4MY6A 1P3RA 2M38A 2CAYA 5GOWB 1MKEA 3G9WA 2K2UA 3DXCA 4OT1A 2GUMA 1SHCA 2J0JA 3HQCA 3SNHA 2CY5A 4Y94A 1J0WA 4A5KA 1UPRA 3DXDA 4HAYB 3HW2B 2KUPA 2KR0A 3U8ZA 1WJ1A 4Z2NA 4CHMA 2LYDA 1BTNA 4QJ4B 5I2SA 5C6RA 1XCGA 4F7HA 2OQBA 2VKIA 3NW8A 4XWXA 1EGXA 1DDMA 3KRXA 4KVGB 2DYNA 5I2MA 3ODWA 1SGHA 2E2XA 2IYBA 2K00A 5HE1A 1Q67A 2Z0QA 2GCJA 3PVWA 2H7EA 2ZPYA 3SYXA 1DDVA 1PFJA 2P0FA 5KQ1A 3UZTA 2DLWA 4QJ3B 2MFQA 1V88A 4DBBA 4KHBA 4GZUA 2FJLA 4ZRKA 4BBKA 5M4YB 1K5GB 2Y7BA 2LOZA 4HAWB 3KY9A 1ZM0A 4CYEA 4A6FA 2J59M 1LW3A 2Z14A 1EAZA 4WJ7A 5DHAB 2N0YA 2DHKA 2YRYA 4PQ0A 3ULCA 3ZDTA 2ROVA 4A6KA 5KQ4A 2CODA 3O96A 3PSCA 4HAXB 2YT2A 2AEHA 3A8QA 3DCXA 2R2YA 3IVFA 1V61A 2LG1A 3SUZA 1Y5OA 2KCJA 2DTCA 2YS3A 3PVLA 4HB0B 4MK0A 1FGYA 1OMWA 3P6AA 4IOYX 5LOPB 1I7AA 3LJUX 4H8SA 1MI1A 4HAVB 1E5WA 3PEGA 2KIEA 3TW1A 1MIXA 2X18A 2EJ8A 1Y19B 2YS5A 5HE3A 2Z4DA 4QXAB 2GS0A 5D27A 4GN1A 2H7DA 3FVCA 2COCA 3PVUA 2K2JA 3OANA 1WGUA 1U5GA 5C16A 3NSUA 4D0NB 2VSZA 4IFSA 1WG7A 2UVMA 1PMSA 3FSSA 2NZ8B 5D3YA 1J19A 3SV1A 2RGNB 2W2WA 5CLLB 3F5RA 2K8EA 1MK7B 3U12A 1NTVA 1KZ7A 4NSWA 3F0WA 4F7UP 3ZVRA 4PNKA 4P7IA 2MWNB 2DA0A 3WA0A 3GYPA 2V76A 1DROA 1FAOA 1TXDA 1X11A 3VOQA 5EFXA 2D9WA 3KRWA 1ISNA 1EVHA 1FHOA 1MIZB 2QKMA 1P5TA 1U27A 5LONB 4DX90 1NI2A 4WVFB 2D10A 2P0HA 1M7RA 2NMBA 4F7GA 1DBHA 2D2QA 1N3HA 4CSQA 2YSZA 1WI1A 3NWFA 1X1GA 2CY4A 4KHBB 4HB3B 3TVVA 2J0MA 3CXBB 3HK0A 3ODOA 4QJ5B 2VRWB 3FEHA 2L1CA 3WYFB 1DYNA 4C0AA 1P6SA 4EMOA 4KHOA 1MPHA 4HATB 4CHJA 3V5WA 4A6FB 3TCAA 3QBVB 1I2HA 3AU4A 5C5BB 2N23A 2YS1A 3A8PA 3X23A 1V89A 1OQNA 3BJIA 2Z0OA 3N7CA 1GC7A 2DYQA 2DFKA 1ZC4B 4ZRJA 4WSFA 3NWAA 5DH9B 3QIJA 2W2XC 5DIFB 2XQNM 3TFMA 4EJNA 2DKPA 1X86A 2ZKMX 1AQCA 1ZYIA 4K2OA 4HB2B 5J3TA 2EC1A 3MPXA 3D8EA 3D8FA 4GNKB 1X05A 1U5DA 2OTXA 1U5FA 1RJ2A 2KIGA 2W2XD 3KZ1A 4MT7A 3RCPA 1ZVRA 3A98B 3QWMA 2RVBB 3NWDA 4NY0A 5IRSA 1QC6A 2I5CA 2QKLA 4GMXB 4GPTB 3OHMB 4HHVA 2D4QA 2DN6A 3ULBA 2RLOA 2GJYA 3BINA 2K49A 1DDWA 3PZDA 2Z13A 1UNQA 2DHIA 2DKQA 3A58A 4Z2MB 5L81A 3SO6A 4YL8A 2GCLA 5CLQB 1FOEA 2P0DA 3B77A 2FJUB 4HAZB 1TQZA 3T06A 1K5DB 1KZGA 2ELAA 2I1JA 2LULA 2PZ1A 2J0KA 2R09A 4EKUA
chains in the Genus database with same CATH topology
2D9YA 2RNRB 3VIAA 1UPQA 1UNRA 4DX8A 1OY2A 4KHAA 4GMVA 1FB8A 3AU5A 2I1KA 1XKEA 1B55A 2ROZB 3GYOA 3MDBC 1XX0A 1XD4A 2BCJA 4YONA 2HTHB 5DI9B 5JLJB 1GG3A 2YT1A 3P7ZA 1TJ6A 5FI0A 2JP2A 1GC6A 2YT0A 1FGZA 3DXEA 1QQGA 2MDXA 3M1IB 3AJ4A 1MAIA 2YF0A 5D3WA 5JHHA 5JHGA 2DHJA 1XODA 1ZC3B 5FI1A 5J3QA 5C79A 3KSYA 3PG7A 1WJMA 2G35A 2D9XA 5DHFB 2YVCA 4KAXB 4DXAB 4HDQA 4GXBA 2LOXA 1U29A 2Q13A 3ODXA 1XR0B 2DX5A 4A6HA 3PP2A 1W1DA 1U5EA 1BTKA 1BWNA 1WGQA 5HE0A 5JP4A 1V5UA 3FM8C 3U7DA 2CRFA 4ZRIA 1U2BA 1NTYA 1PLSA 2M14A 2RSGA 4HDOA 2I5FA 1AWEA 4HB4B 1UEFA 2Y8GA 1W1HA 4TYZA 1W1GA 2LKOA 4B6HA 5C5BA 1V5PA 2P8VA 4IAPA 4L6EA 3ML4A 2ELBA 2ADZA 2D11A 1NU2A 1MK9B 2Z0PA 1IRSA 2DX1A 2Y8FA 2KGXB 2D9VA 1WVHA 4HAUB 1X1FA 1FHXA 1V5MA 3TO1A 2MKRA 2AL6A 4K17A 5KCVA 2COFA 1H4RA 1ZSQA 2D9ZA 1RRPB 3CIKA 1H10A 5D3XA 1KI1B 5J3YA 4TKNA 4K81A 4K2PA 3D8DA 2HE7A 5HE2A 1M7EA 2L2IA 5D3VA 2IFSA 1EF1A 2EMTA 2UZRA 2R0DA 2COAA 1FHWA 1LB1A 2EMSA 1UNPA 2UZSA 1Z87A 2RUKB 1BAKA 4MY6A 1P3RA 2M38A 2CAYA 5GOWB 1MKEA 3G9WA 2K2UA 3DXCA 1SHCA 2J0JA 3HQCA 3SNHA 2CY5A 4Y94A 1J0WA 4A5KA 1UPRA 3DXDA 4HAYB 3HW2B 2KUPA 3U8ZA 1WJ1A 4Z2NA 4CHMA 2LYDA 1BTNA 5C6RA 1XCGA 4F7HA 2OQBA 2VKIA 4XWXA 1EGXA 1DDMA 3KRXA 4KVGB 2DYNA 3ODWA 1SGHA 2E2XA 2IYBA 2K00A 5HE1A 1Q67A 2Z0QA 2GCJA 3PVWA 2H7EA 2ZPYA 3SYXA 1DDVA 1PFJA 2P0FA 5KQ1A 3UZTA 2DLWA 2MFQA 1V88A 4DBBA 4GZUA 2FJLA 4ZRKA 4BBKA 1K5GB 2Y7BA 2LOZA 4HAWB 3KY9A 1ZM0A 4CYEA 4A6FA 2J59M 1LW3A 1EAZA 4WJ7A 5DHAB 2N0YA 2DHKA 2YRYA 4PQ0A 3ULCA 3ZDTA 2ROVA 4A6KA 5KQ4A 2CODA 3O96A 3PSCA 4HAXB 2AEHA 3A8QA 3IVFA 1V61A 2LG1A 3SUZA 1Y5OA 2KCJA 2DTCA 2YS3A 3PVLA 4HB0B 4MK0A 1FGYA 1OMWA 3P6AA 4IOYX 5LOPB 1I7AA 3LJUX 4H8SA 4HAVB 1E5WA 3PEGA 3TW1A 1MIXA 2X18A 2EJ8A 1Y19B 2YS5A 5HE3A 2GS0A 5D27A 4GN1A 2H7DA 2COCA 3PVUA 2K2JA 3OANA 1WGUA 1U5GA 5C16A 3NSUA 4D0NB 2VSZA 4IFSA 1WG7A 2UVMA 1PMSA 3FSSA 2NZ8B 5D3YA 1J19A 3SV1A 2RGNB 2W2WA 5CLLB 3F5RA 1MK7B 1NTVA 1KZ7A 4NSWA 3F0WA 4F7UP 3ZVRA 4PNKA 4P7IA 2MWNB 2DA0A 3WA0A 3GYPA 2V76A 1DROA 1FAOA 1TXDA 1X11A 3VOQA 5EFXA 2D9WA 3KRWA 1ISNA 1EVHA 1FHOA 1MIZB 2QKMA 1P5TA 1U27A 5LONB 4DX90 1NI2A 4WVFB 2D10A 2P0HA 1M7RA 2NMBA 4F7GA 1DBHA 2D2QA 1N3HA 2YSZA 1WI1A 1X1GA 2CY4A 4KHBB 4HB3B 3TVVA 2J0MA 3CXBB 3HK0A 3ODOA 2VRWB 3FEHA 2L1CA 3WYFB 1DYNA 4C0AA 1P6SA 4EMOA 4KHOA 1MPHA 4HATB 4CHJA 3V5WA 4A6FB 3TCAA 3QBVB 1I2HA 3AU4A 5C5BB 2N23A 2YS1A 3A8PA 3X23A 1V89A 1OQNA 3BJIA 2Z0OA 3N7CA 1GC7A 2DYQA 2DFKA 1ZC4B 4ZRJA 4WSFA 5DH9B 3QIJA 2W2XC 5DIFB 2XQNM 3TFMA 4EJNA 2DKPA 1X86A 1AQCA 4K2OA 4HB2B 5J3TA 2EC1A 3MPXA 3D8EA 3D8FA 1X05A 1U5DA 2OTXA 1U5FA 1RJ2A 2W2XD 3KZ1A 4MT7A 3RCPA 1ZVRA 3A98B 3QWMA 2RVBB 4NY0A 1QC6A 2I5CA 2QKLA 4GMXB 4GPTB 4HHVA 2D4QA 2DN6A 3ULBA 2RLOA 2GJYA 3BINA 1DDWA 3PZDA 1UNQA 2DHIA 2DKQA 4Z2MB 5L81A 3SO6A 4YL8A 2GCLA 5CLQB 1FOEA 2P0DA 4HAZB 1TQZA 3T06A 1K5DB 1KZGA 2ELAA 2I1JA 2LULA 2PZ1A 2J0KA 2R09A 4EKUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D9Y A;  2RNR B;  3VIA A;  1UPQ A;  1UNR A;  4DX8 A;  1OY2 A;  4KHA A;  4GMV A;  1FB8 A;  3AU5 A;  2I1K A;  1XKE A;  1B55 A;  2ROZ B;  3GYO A;  3MDB C;  1XX0 A;  1XD4 A;  2BCJ A;  4YON A;  2HTH B;  5DI9 B;  5JLJ B;  1GG3 A;  2YT1 A;  3P7Z A;  1TJ6 A;  5FI0 A;  2JP2 A;  1GC6 A;  2YT0 A;  1FGZ A;  3DXE A;  1QQG A;  2MDX A;  3M1I B;  3AJ4 A;  1MAI A;  2YF0 A;  5D3W A;  5JHH A;  5JHG A;  2DHJ A;  1XOD A;  1ZC3 B;  5FI1 A;  5J3Q A;  5C79 A;  3KSY A;  3PG7 A;  1WJM A;  2G35 A;  2D9X A;  5DHF B;  2YVC A;  4KAX B;  4DXA B;  4HDQ A;  4GXB A;  2LOX A;  1U29 A;  2Q13 A;  3ODX A;  1XR0 B;  2DX5 A;  4A6H A;  3PP2 A;  1W1D A;  1U5E A;  1BTK A;  1BWN A;  1WGQ A;  5HE0 A;  5JP4 A;  1V5U A;  3FM8 C;  3U7D A;  2CRF A;  4ZRI A;  1U2B A;  1NTY A;  1PLS A;  2M14 A;  2RSG A;  4HDO A;  2I5F A;  1AWE A;  4HB4 B;  1UEF A;  2Y8G A;  1W1H A;  4TYZ A;  1W1G A;  2LKO A;  4B6H A;  5C5B A;  1V5P A;  2P8V A;  4IAP A;  4L6E A;  3ML4 A;  2ELB A;  2ADZ A;  2D11 A;  1NU2 A;  1MK9 B;  2Z0P A;  1IRS A;  2DX1 A;  2Y8F A;  2KGX B;  2D9V A;  1WVH A;  4HAU B;  1X1F A;  1FHX A;  1V5M A;  3TO1 A;  2MKR A;  2AL6 A;  4K17 A;  5KCV A;  2COF A;  1H4R A;  1ZSQ A;  2D9Z A;  1RRP B;  3CIK A;  1H10 A;  5D3X A;  1KI1 B;  5J3Y A;  4TKN A;  4K81 A;  4K2P A;  3D8D A;  2HE7 A;  5HE2 A;  1M7E A;  2L2I A;  5D3V A;  2IFS A;  1EF1 A;  2EMT A;  2UZR A;  2R0D A;  2COA A;  1FHW A;  1LB1 A;  2EMS A;  1UNP A;  2UZS A;  1Z87 A;  2RUK B;  1BAK A;  4MY6 A;  1P3R A;  2M38 A;  2CAY A;  5GOW B;  1MKE A;  3G9W A;  2K2U A;  3DXC A;  1SHC A;  2J0J A;  3HQC A;  3SNH A;  2CY5 A;  4Y94 A;  1J0W A;  4A5K A;  1UPR A;  3DXD A;  4HAY B;  3HW2 B;  2KUP A;  3U8Z A;  1WJ1 A;  4Z2N A;  4CHM A;  2LYD A;  1BTN A;  5C6R A;  1XCG A;  4F7H A;  2OQB A;  2VKI A;  4XWX A;  1EGX A;  1DDM A;  3KRX A;  4KVG B;  2DYN A;  3ODW A;  1SGH A;  2E2X A;  2IYB A;  2K00 A;  5HE1 A;  1Q67 A;  2Z0Q A;  2GCJ A;  3PVW A;  2H7E A;  2ZPY A;  3SYX A;  1DDV A;  1PFJ A;  2P0F A;  5KQ1 A;  3UZT A;  2DLW A;  2MFQ A;  1V88 A;  4DBB A;  4GZU A;  2FJL A;  4ZRK A;  4BBK A;  1K5G B;  2Y7B A;  2LOZ A;  4HAW B;  3KY9 A;  1ZM0 A;  4CYE A;  4A6F A;  2J59 M;  1LW3 A;  1EAZ A;  4WJ7 A;  5DHA B;  2N0Y A;  2DHK A;  2YRY A;  4PQ0 A;  3ULC A;  3ZDT A;  2ROV A;  4A6K A;  5KQ4 A;  2COD A;  3O96 A;  3PSC A;  4HAX B;  2AEH A;  3A8Q A;  3IVF A;  1V61 A;  2LG1 A;  3SUZ A;  1Y5O A;  2KCJ A;  2DTC A;  2YS3 A;  3PVL A;  4HB0 B;  4MK0 A;  1FGY A;  1OMW A;  3P6A A;  4IOY X;  5LOP B;  1I7A A;  3LJU X;  4H8S A;  4HAV B;  1E5W A;  3PEG A;  3TW1 A;  1MIX A;  2X18 A;  2EJ8 A;  1Y19 B;  2YS5 A;  5HE3 A;  2GS0 A;  5D27 A;  4GN1 A;  2H7D A;  2COC A;  3PVU A;  2K2J A;  3OAN A;  1WGU A;  1U5G A;  5C16 A;  3NSU A;  4D0N B;  2VSZ A;  4IFS A;  1WG7 A;  2UVM A;  1PMS A;  3FSS A;  2NZ8 B;  5D3Y A;  1J19 A;  3SV1 A;  2RGN B;  2W2W A;  5CLL B;  3F5R A;  1MK7 B;  1NTV A;  1KZ7 A;  4NSW A;  3F0W A;  4F7U P;  3ZVR A;  4PNK A;  4P7I A;  2MWN B;  2DA0 A;  3WA0 A;  3GYP A;  2V76 A;  1DRO A;  1FAO A;  1TXD A;  1X11 A;  3VOQ A;  5EFX A;  2D9W A;  3KRW A;  1ISN A;  1EVH A;  1FHO A;  1MIZ B;  2QKM A;  1P5T A;  1U27 A;  5LON B;  4DX9 0;  1NI2 A;  4WVF B;  2D10 A;  2P0H A;  1M7R A;  2NMB A;  4F7G A;  1DBH A;  2D2Q A;  1N3H A;  2YSZ A;  1WI1 A;  1X1G A;  2CY4 A;  4KHB B;  4HB3 B;  3TVV A;  2J0M A;  3CXB B;  3HK0 A;  3ODO A;  2VRW B;  3FEH A;  2L1C A;  3WYF B;  1DYN A;  4C0A A;  1P6S A;  4EMO A;  4KHO A;  1MPH A;  4HAT B;  4CHJ A;  3V5W A;  4A6F B;  3TCA A;  3QBV B;  1I2H A;  3AU4 A;  5C5B B;  2N23 A;  2YS1 A;  3A8P A;  3X23 A;  1V89 A;  1OQN A;  3BJI A;  2Z0O A;  3N7C A;  1GC7 A;  2DYQ A;  2DFK A;  1ZC4 B;  4ZRJ A;  4WSF A;  5DH9 B;  3QIJ A;  2W2X C;  5DIF B;  2XQN M;  3TFM A;  4EJN A;  2DKP A;  1X86 A;  1AQC A;  4K2O A;  4HB2 B;  5J3T A;  2EC1 A;  3MPX A;  3D8E A;  3D8F A;  1X05 A;  1U5D A;  2OTX A;  1U5F A;  1RJ2 A;  2W2X D;  3KZ1 A;  4MT7 A;  3RCP A;  1ZVR A;  3A98 B;  3QWM A;  2RVB B;  4NY0 A;  1QC6 A;  2I5C A;  2QKL A;  4GMX B;  4GPT B;  4HHV A;  2D4Q A;  2DN6 A;  3ULB A;  2RLO A;  2GJY A;  3BIN A;  1DDW A;  3PZD A;  1UNQ A;  2DHI A;  2DKQ A;  4Z2M B;  5L81 A;  3SO6 A;  4YL8 A;  2GCL A;  5CLQ B;  1FOE A;  2P0D A;  4HAZ B;  1TQZ A;  3T06 A;  1K5D B;  1KZG A;  2ELA A;  2I1J A;  2LUL A;  2PZ1 A;  2J0K A;  2R09 A;  4EKU A; 
#chains in the Genus database with same CATH topology
 4DIX A;  2D9Y A;  2RNR B;  3VIA A;  1UPQ A;  1UNR A;  4DX8 A;  1OY2 A;  4KHA A;  4GMV A;  1FB8 A;  3AU5 A;  2I1K A;  4D6W A;  1XKE A;  1B55 A;  2ROZ B;  3GYO A;  3MDB C;  1XX0 A;  1XD4 A;  2BCJ A;  4YON A;  2HTH B;  5DI9 B;  5JLJ B;  1GG3 A;  2YT1 A;  3P7Z A;  1TJ6 A;  5FI0 A;  2JP2 A;  1GC6 A;  2YT0 A;  1FGZ A;  3DXE A;  2RRF A;  1QQG A;  2MDX A;  3M1I B;  3AJ4 A;  1MAI A;  2YF0 A;  5D3W A;  5JHH A;  5JHG A;  2DHJ A;  1XOD A;  1ZC3 B;  4GOU A;  5FI1 A;  5J3Q A;  5C79 A;  3KSY A;  3PG7 A;  1WJM A;  2G35 A;  2D9X A;  5DHF B;  2YVC A;  4KAX B;  1T77 A;  4OSN A;  4DXA B;  4HDQ A;  4GXB A;  2LOX A;  1U29 A;  2Q13 A;  3ODX A;  1XR0 B;  2DX5 A;  4A6H A;  3PP2 A;  1W1D A;  1U5E A;  1BTK A;  1BWN A;  1WGQ A;  5HE0 A;  5JP4 A;  1V5U A;  3FM8 C;  3U7D A;  2CRF A;  4ZRI A;  5LG4 B;  1U2B A;  1NTY A;  1PLS A;  2M14 A;  2RSG A;  4HDO A;  2I5F A;  1AWE A;  4HB4 B;  1UEF A;  2Y8G A;  1W1H A;  4TYZ A;  1W1G A;  2LKO A;  4B6H A;  5C5B A;  1V5P A;  2Z59 A;  2P8V A;  4IAP A;  4L6E A;  3ML4 A;  2ELB A;  2ADZ A;  4L1R A;  2D11 A;  1NU2 A;  1MK9 B;  2Z0P A;  1IRS A;  2DX1 A;  2Y8F A;  2KGX B;  2D9V A;  3HIE A;  1WVH A;  4HAU B;  1X1F A;  1FHX A;  1V5M A;  3TO1 A;  2MKR A;  2AL6 A;  4K17 A;  5KCV A;  2COF A;  1H4R A;  1ZSQ A;  4HSI A;  2D9Z A;  1RRP B;  3CIK A;  1H10 A;  5D3X A;  1KI1 B;  5J3Y A;  2KUQ A;  4TKN A;  4K81 A;  4K2P A;  3D8D A;  2HE7 A;  5HE2 A;  2NBV A;  1M7E A;  2L2I A;  5D3V A;  3HSA A;  2IFS A;  1EF1 A;  2EMT A;  2UZR A;  2R0D A;  2COA A;  1FHW A;  1LB1 A;  2EMS A;  1UNP A;  2UZS A;  1Z87 A;  2RUK B;  1BAK A;  4MY6 A;  1P3R A;  2M38 A;  2CAY A;  5GOW B;  1MKE A;  3G9W A;  2K2U A;  3DXC A;  4OT1 A;  2GUM A;  1SHC A;  2J0J A;  3HQC A;  3SNH A;  2CY5 A;  4Y94 A;  1J0W A;  4A5K A;  1UPR A;  3DXD A;  4HAY B;  3HW2 B;  2KUP A;  2KR0 A;  3U8Z A;  1WJ1 A;  4Z2N A;  4CHM A;  2LYD A;  1BTN A;  4QJ4 B;  5I2S A;  5C6R A;  1XCG A;  4F7H A;  2OQB A;  2VKI A;  3NW8 A;  4XWX A;  1EGX A;  1DDM A;  3KRX A;  4KVG B;  2DYN A;  5I2M A;  3ODW A;  1SGH A;  2E2X A;  2IYB A;  2K00 A;  5HE1 A;  1Q67 A;  2Z0Q A;  2GCJ A;  3PVW A;  2H7E A;  2ZPY A;  3SYX A;  1DDV A;  1PFJ A;  2P0F A;  5KQ1 A;  3UZT A;  2DLW A;  4QJ3 B;  2MFQ A;  1V88 A;  4DBB A;  4KHB A;  4GZU A;  2FJL A;  4ZRK A;  4BBK A;  5M4Y B;  1K5G B;  2Y7B A;  2LOZ A;  4HAW B;  3KY9 A;  1ZM0 A;  4CYE A;  4A6F A;  2J59 M;  1LW3 A;  2Z14 A;  1EAZ A;  4WJ7 A;  5DHA B;  2N0Y A;  2DHK A;  2YRY A;  4PQ0 A;  3ULC A;  3ZDT A;  2ROV A;  4A6K A;  5KQ4 A;  2COD A;  3O96 A;  3PSC A;  4HAX B;  2YT2 A;  2AEH A;  3A8Q A;  3DCX A;  2R2Y A;  3IVF A;  1V61 A;  2LG1 A;  3SUZ A;  1Y5O A;  2KCJ A;  2DTC A;  2YS3 A;  3PVL A;  4HB0 B;  4MK0 A;  1FGY A;  1OMW A;  3P6A A;  4IOY X;  5LOP B;  1I7A A;  3LJU X;  4H8S A;  1MI1 A;  4HAV B;  1E5W A;  3PEG A;  2KIE A;  3TW1 A;  1MIX A;  2X18 A;  2EJ8 A;  1Y19 B;  2YS5 A;  5HE3 A;  2Z4D A;  4QXA B;  2GS0 A;  5D27 A;  4GN1 A;  2H7D A;  3FVC A;  2COC A;  3PVU A;  2K2J A;  3OAN A;  1WGU A;  1U5G A;  5C16 A;  3NSU A;  4D0N B;  2VSZ A;  4IFS A;  1WG7 A;  2UVM A;  1PMS A;  3FSS A;  2NZ8 B;  5D3Y A;  1J19 A;  3SV1 A;  2RGN B;  2W2W A;  5CLL B;  3F5R A;  2K8E A;  1MK7 B;  3U12 A;  1NTV A;  1KZ7 A;  4NSW A;  3F0W A;  4F7U P;  3ZVR A;  4PNK A;  4P7I A;  2MWN B;  2DA0 A;  3WA0 A;  3GYP A;  2V76 A;  1DRO A;  1FAO A;  1TXD A;  1X11 A;  3VOQ A;  5EFX A;  2D9W A;  3KRW A;  1ISN A;  1EVH A;  1FHO A;  1MIZ B;  2QKM A;  1P5T A;  1U27 A;  5LON B;  4DX9 0;  1NI2 A;  4WVF B;  2D10 A;  2P0H A;  1M7R A;  2NMB A;  4F7G A;  1DBH A;  2D2Q A;  1N3H A;  4CSQ A;  2YSZ A;  1WI1 A;  3NWF A;  1X1G A;  2CY4 A;  4KHB B;  4HB3 B;  3TVV A;  2J0M A;  3CXB B;  3HK0 A;  3ODO A;  4QJ5 B;  2VRW B;  3FEH A;  2L1C A;  3WYF B;  1DYN A;  4C0A A;  1P6S A;  4EMO A;  4KHO A;  1MPH A;  4HAT B;  4CHJ A;  3V5W A;  4A6F B;  3TCA A;  3QBV B;  1I2H A;  3AU4 A;  5C5B B;  2N23 A;  2YS1 A;  3A8P A;  3X23 A;  1V89 A;  1OQN A;  3BJI A;  2Z0O A;  3N7C A;  1GC7 A;  2DYQ A;  2DFK A;  1ZC4 B;  4ZRJ A;  4WSF A;  3NWA A;  5DH9 B;  3QIJ A;  2W2X C;  5DIF B;  2XQN M;  3TFM A;  4EJN A;  2DKP A;  1X86 A;  2ZKM X;  1AQC A;  1ZYI A;  4K2O A;  4HB2 B;  5J3T A;  2EC1 A;  3MPX A;  3D8E A;  3D8F A;  4GNK B;  1X05 A;  1U5D A;  2OTX A;  1U5F A;  1RJ2 A;  2KIG A;  2W2X D;  3KZ1 A;  4MT7 A;  3RCP A;  1ZVR A;  3A98 B;  3QWM A;  2RVB B;  3NWD A;  4NY0 A;  5IRS A;  1QC6 A;  2I5C A;  2QKL A;  4GMX B;  4GPT B;  3OHM B;  4HHV A;  2D4Q A;  2DN6 A;  3ULB A;  2RLO A;  2GJY A;  3BIN A;  2K49 A;  1DDW A;  3PZD A;  2Z13 A;  1UNQ A;  2DHI A;  2DKQ A;  3A58 A;  4Z2M B;  5L81 A;  3SO6 A;  4YL8 A;  2GCL A;  5CLQ B;  1FOE A;  2P0D A;  3B77 A;  2FJU B;  4HAZ B;  1TQZ A;  3T06 A;  1K5D B;  1KZG A;  2ELA A;  2I1J A;  2LUL A;  2PZ1 A;  2J0K A;  2R09 A;  4EKU A; 
#chains in the Genus database with same CATH homology
 2D9Y A;  2RNR B;  3VIA A;  1UPQ A;  1UNR A;  4DX8 A;  1OY2 A;  4KHA A;  4GMV A;  1FB8 A;  3AU5 A;  2I1K A;  1XKE A;  1B55 A;  2ROZ B;  3GYO A;  3MDB C;  1XX0 A;  1XD4 A;  2BCJ A;  4YON A;  2HTH B;  5DI9 B;  5JLJ B;  1GG3 A;  2YT1 A;  3P7Z A;  1TJ6 A;  5FI0 A;  2JP2 A;  1GC6 A;  2YT0 A;  1FGZ A;  3DXE A;  1QQG A;  2MDX A;  3M1I B;  3AJ4 A;  1MAI A;  2YF0 A;  5D3W A;  5JHH A;  5JHG A;  2DHJ A;  1XOD A;  1ZC3 B;  5FI1 A;  5J3Q A;  5C79 A;  3KSY A;  3PG7 A;  1WJM A;  2G35 A;  2D9X A;  5DHF B;  2YVC A;  4KAX B;  4DXA B;  4HDQ A;  4GXB A;  2LOX A;  1U29 A;  2Q13 A;  3ODX A;  1XR0 B;  2DX5 A;  4A6H A;  3PP2 A;  1W1D A;  1U5E A;  1BTK A;  1BWN A;  1WGQ A;  5HE0 A;  5JP4 A;  1V5U A;  3FM8 C;  3U7D A;  2CRF A;  4ZRI A;  1U2B A;  1NTY A;  1PLS A;  2M14 A;  2RSG A;  4HDO A;  2I5F A;  1AWE A;  4HB4 B;  1UEF A;  2Y8G A;  1W1H A;  4TYZ A;  1W1G A;  2LKO A;  4B6H A;  5C5B A;  1V5P A;  2P8V A;  4IAP A;  4L6E A;  3ML4 A;  2ELB A;  2ADZ A;  2D11 A;  1NU2 A;  1MK9 B;  2Z0P A;  1IRS A;  2DX1 A;  2Y8F A;  2KGX B;  2D9V A;  1WVH A;  4HAU B;  1X1F A;  1FHX A;  1V5M A;  3TO1 A;  2MKR A;  2AL6 A;  4K17 A;  5KCV A;  2COF A;  1H4R A;  1ZSQ A;  2D9Z A;  1RRP B;  3CIK A;  1H10 A;  5D3X A;  1KI1 B;  5J3Y A;  4TKN A;  4K81 A;  4K2P A;  3D8D A;  2HE7 A;  5HE2 A;  1M7E A;  2L2I A;  5D3V A;  2IFS A;  1EF1 A;  2EMT A;  2UZR A;  2R0D A;  2COA A;  1FHW A;  1LB1 A;  2EMS A;  1UNP A;  2UZS A;  1Z87 A;  2RUK B;  1BAK A;  4MY6 A;  1P3R A;  2M38 A;  2CAY A;  5GOW B;  1MKE A;  3G9W A;  2K2U A;  3DXC A;  1SHC A;  2J0J A;  3HQC A;  3SNH A;  2CY5 A;  4Y94 A;  1J0W A;  4A5K A;  1UPR A;  3DXD A;  4HAY B;  3HW2 B;  2KUP A;  3U8Z A;  1WJ1 A;  4Z2N A;  4CHM A;  2LYD A;  1BTN A;  5C6R A;  1XCG A;  4F7H A;  2OQB A;  2VKI A;  4XWX A;  1EGX A;  1DDM A;  3KRX A;  4KVG B;  2DYN A;  3ODW A;  1SGH A;  2E2X A;  2IYB A;  2K00 A;  5HE1 A;  1Q67 A;  2Z0Q A;  2GCJ A;  3PVW A;  2H7E A;  2ZPY A;  3SYX A;  1DDV A;  1PFJ A;  2P0F A;  5KQ1 A;  3UZT A;  2DLW A;  2MFQ A;  1V88 A;  4DBB A;  4GZU A;  2FJL A;  4ZRK A;  4BBK A;  1K5G B;  2Y7B A;  2LOZ A;  4HAW B;  3KY9 A;  1ZM0 A;  4CYE A;  4A6F A;  2J59 M;  1LW3 A;  1EAZ A;  4WJ7 A;  5DHA B;  2N0Y A;  2DHK A;  2YRY A;  4PQ0 A;  3ULC A;  3ZDT A;  2ROV A;  4A6K A;  5KQ4 A;  2COD A;  3O96 A;  3PSC A;  4HAX B;  2AEH A;  3A8Q A;  3IVF A;  1V61 A;  2LG1 A;  3SUZ A;  1Y5O A;  2KCJ A;  2DTC A;  2YS3 A;  3PVL A;  4HB0 B;  4MK0 A;  1FGY A;  1OMW A;  3P6A A;  4IOY X;  5LOP B;  1I7A A;  3LJU X;  4H8S A;  4HAV B;  1E5W A;  3PEG A;  3TW1 A;  1MIX A;  2X18 A;  2EJ8 A;  1Y19 B;  2YS5 A;  5HE3 A;  2GS0 A;  5D27 A;  4GN1 A;  2H7D A;  2COC A;  3PVU A;  2K2J A;  3OAN A;  1WGU A;  1U5G A;  5C16 A;  3NSU A;  4D0N B;  2VSZ A;  4IFS A;  1WG7 A;  2UVM A;  1PMS A;  3FSS A;  2NZ8 B;  5D3Y A;  1J19 A;  3SV1 A;  2RGN B;  2W2W A;  5CLL B;  3F5R A;  1MK7 B;  1NTV A;  1KZ7 A;  4NSW A;  3F0W A;  4F7U P;  3ZVR A;  4PNK A;  4P7I A;  2MWN B;  2DA0 A;  3WA0 A;  3GYP A;  2V76 A;  1DRO A;  1FAO A;  1TXD A;  1X11 A;  3VOQ A;  5EFX A;  2D9W A;  3KRW A;  1ISN A;  1EVH A;  1FHO A;  1MIZ B;  2QKM A;  1P5T A;  1U27 A;  5LON B;  4DX9 0;  1NI2 A;  4WVF B;  2D10 A;  2P0H A;  1M7R A;  2NMB A;  4F7G A;  1DBH A;  2D2Q A;  1N3H A;  2YSZ A;  1WI1 A;  1X1G A;  2CY4 A;  4KHB B;  4HB3 B;  3TVV A;  2J0M A;  3CXB B;  3HK0 A;  3ODO A;  2VRW B;  3FEH A;  2L1C A;  3WYF B;  1DYN A;  4C0A A;  1P6S A;  4EMO A;  4KHO A;  1MPH A;  4HAT B;  4CHJ A;  3V5W A;  4A6F B;  3TCA A;  3QBV B;  1I2H A;  3AU4 A;  5C5B B;  2N23 A;  2YS1 A;  3A8P A;  3X23 A;  1V89 A;  1OQN A;  3BJI A;  2Z0O A;  3N7C A;  1GC7 A;  2DYQ A;  2DFK A;  1ZC4 B;  4ZRJ A;  4WSF A;  5DH9 B;  3QIJ A;  2W2X C;  5DIF B;  2XQN M;  3TFM A;  4EJN A;  2DKP A;  1X86 A;  1AQC A;  4K2O A;  4HB2 B;  5J3T A;  2EC1 A;  3MPX A;  3D8E A;  3D8F A;  1X05 A;  1U5D A;  2OTX A;  1U5F A;  1RJ2 A;  2W2X D;  3KZ1 A;  4MT7 A;  3RCP A;  1ZVR A;  3A98 B;  3QWM A;  2RVB B;  4NY0 A;  1QC6 A;  2I5C A;  2QKL A;  4GMX B;  4GPT B;  4HHV A;  2D4Q A;  2DN6 A;  3ULB A;  2RLO A;  2GJY A;  3BIN A;  1DDW A;  3PZD A;  1UNQ A;  2DHI A;  2DKQ A;  4Z2M B;  5L81 A;  3SO6 A;  4YL8 A;  2GCL A;  5CLQ B;  1FOE A;  2P0D A;  4HAZ B;  1TQZ A;  3T06 A;  1K5D B;  1KZG A;  2ELA A;  2I1J A;  2LUL A;  2PZ1 A;  2J0K A;  2R09 A;  4EKU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...