1X86A

Crystal structure of the dh/ph domains of leukemia-associated rhogef in complex with rhoa
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
373
structure length
362
Chain Sequence
PPNWQQLVSREVLLGLKPCEIKRQEVINELFYTERAHVRTLKVLDQVFYQRVSREGILSPSELRKIFSNLEDILQLHIGLNEQMKAVRKRNETSVIDQIGEDLLTWFSGPGEEKLKHAAATFCSNQPFALEMIKSRQKKDSRFQTFVQDAESNPLCRRLQLKDIIPTQMQRLTKYPLLLDNIAKYTEWPTEREKVKKAADHCRQILNFVNQAVKEAENKQRLEDYQRRLDTSSLKLSEYPNVEELRNLDLTKRKMIHEGPLVWKVNRDKTIDLYTLLLEDILVLLQKQDDRLVLRCHSTFSPVIKLSTVLVRQVATDNKALFVISMSDNGAQIYELVAQTVSEKTVWQDLICRMAASVKEQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Signaling protein/membrane protein
molecule keywords Rho guanine nucleotide exchange factor 12
publication title Structural determinants of RhoA binding and nucleotide exchange in leukemia-associated Rho guanine-nucleotide exchange factor.
pubmed doi rcsb
source organism Homo sapiens
total genus 122
structure length 362
sequence length 373
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2004-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00621 RhoGEF RhoGEF domain
A PF17838 PH_16 PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.900.10 Mainly Alpha Up-down Bundle Dbl Homology Domain; Chain A Dbl homology (DH) domain 1x86A01
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1x86A02
4YONA 1P5TA 3SUZA 3V5WA 1LW3A 3PEGA 2L2IA 4DX8A 4EKUA 1U5FA 5JHGA 1DBHA 5D3VA 4IOYX 4CHJA 2YS5A 2W2XD 1F5XA 2AL6A 4HDOA 3PVLA 1U29A 5DH9B 2CY5A 5C5BB 2EJ8A 4MY6A 3KY9A 2LOZA 2R09A 1V88A 3BINA 1WG7A 2YF0A 3ODXA 1V5UA 5C79A 4K2OA 1UNRA 1KZ7A 2GJYA 4CYEA 4PQ0A 1DROA 3SYXA 2DHIA 2J0MA 5J3TA 4A6KA 2K2UA 5C5BA 2IYBA 2PZ1A 2KR9A 1DYNA 1FB8A 2QKMA 1GC6A 2L1CA 4F7HA 2RLOA 1BTNA 1EVHA 3GF9A 3T06A 1RRPB 3KRXA 3D8EA 4A6FB 4IAPA 3JV3A 5FI0A 2YT0A 2DX1A 4HAWB 4F7GA 1FOEA 2DN6A 2J0JA 1LB1A 1V89A 3PP2A 3MDBC 2GS0A 2JP2A 5CLLB 4EMOA 1V5MA 5C6RA 3ULCA 1MPHA 1GG3A 2QKLA 3N7CA 4A6FA 4YL8A 3ML4A 3AJ4A 5C16A 2J59M 2DLWA 3ODOA 3PVWA 4HHVA 5JP4A 2R0DA 3DXDA 4KVGB 2GCLA 1WGQA 5GOWB 2D11A 5J3QA 5KQ4A 1B55A 2NMBA 4HB0B 1TXDA 2Z0OA 2LYDA 3O96A 2MKRA 1X1GA 2KGXB 3ODWA 2KCJA 3HK0A 2D9ZA 3SO6A 1K5GB 3KRWA 1M7EA 1MK7B 2P8VA 4HB2B 1ZM0A 4NY0A 4Z2NA 3KSYA 2LKOA 2HE7A 1BAKA 1ZSQA 3AU4A 2HTHB 1AQCA 5KQ1A 5D3XA 4PNKA 4GMXB 3DXEA 2W2WA 3QIJA 1UPRA 1SGHA 1QQGA 3LJUX 1NI2A 3TO1A 1Z87A 4NSWA 4DX90 4HATB 2UZSA 4CHMA 1DDMA 1I7AA 1WI1A 3X23A 3UZTA 1FHOA 2LOXA 4MT7A 2EMTA 2V76A 2D9VA 2P0DA 1NU2A 5HE1A 2Y8GA 1XD4A 3CXBB 2IFSA 3GYOA 3RCPA 2M38A 1J0WA 1BY1A 1GC7A 1XODA 4EJNA 2I1KA 2VKIA 2EMSA 4DBBA 5FI1A 2COCA 5KCVA 2P0HA 2YSZA 1U5DA 1UNPA 2D2QA 4HAZB 2CY4A 2DYQA 4GYVA 2DHJA 2I5FA 3NSUA 4C0AA 3D8FA 2MFQA 3P7ZA 3SNHA 5D3YA 1U27A 1UPQA 1U2BA 5HE0A 2DTCA 5J3YA 5JHHA 3U7DA 1EAZA 3TFMA 1WJMA 3FM8C 4KAXB 2AEHA 3ZVRA 3IVFA 3VIAA 4WVFB 4ZRIA 1MIXA 5DHFB 1EF1A 1WVHA 2X18A 2FJLA 2DA0A 2J0KA 1V61A 1W1GA 3D8DA 2VSZA 2CRFA 3KZ1A 5L81A 4GOUA 1MKEA 2RUKB 4BBKA 1MK9B 2UZRA 1TJ6A 1BWNA 3DXCA 4F7UP 2E2XA 2ROZB 5DHAB 4KHAA 2RGNB 5LONB 3WA0A 1PLSA 2OTXA 3G9WA 1U5GA 5JLJB 5D27A 2LULA 3PG7A 2COFA 3P6AA 1P3RA 1K5DB 4IFSA 2M14A 4KHBB 2UVMA 1SHCA 1E5WA 4GXBA 3A8PA 4TKNA 4D0NB 2YS1A 1PMSA 4GMVA 2MWNB 1OQNA 5CLQB 2DX5A 1IRSA 4ZRJA 3F0WA 5HE3A 1H10A 1QC6A 1XR0B 2OQBA 2GCJA 2DYNA 4TYZA 1M7RA 1UEFA 2D9WA 1OY2A 3TW1A 2P0FA 3SV1A 1NTYA 1XKEA 2KUPA 2K2JA 1NTVA 2ZPYA 5EFXA 4WSFA 4A6HA 3U8ZA 1X1FA 2N23A 1EGXA 1Y5OA 2N0YA 1MAIA 3AU5A 1MIZB 1FGYA 1XCGA 1FHXA 3M1IB 4ZRKA 5D3WA 3EO2A 2RVBB 2YS3A 1DDVA 4K2PA 1U5EA 3FEHA 2Y7BA 4GPTB 3ULBA 3MPXA 4K81A 2Y8FA 4HDQA 3OANA 1UNQA 3WYFB 3QWMA 3BJIA 2H7EA 4A5KA 2MDXA 4KHOA 2ROVA 5DIFB 2H7DA 2EC1A 2DFKA 1PFJA 3PZDA 2D9YA 2YT1A 1P6SA 4HB4B 1X05A 1WGUA 4DXAB 2YRYA 4Y94A 2D9XA 4HAUB 1DDWA 3HW2B 3ZDTA 2W2XC 2DKQA 5LOPB 1X86A 1FHWA 1ISNA 3PSCA 4MK0A 4L6EA 1I2HA 2D4QA 2ELAA 4HAXB 1FAOA 4HB3B 1RJ2A 1ZVRA 1OMWA 2Z0QA 4XWXA 2RSGA 3A98B 2CAYA 4Z2MB 1X11A 1W1DA 4B6HA 4K17A 1TQZA 4GZUA 1N3HA 5DI9B 2VRWB 1W1HA 1Y19B 4D0OA 3A8QA 1AWEA 3TVVA 3TCAA 2Q13A 1KI1B 3VOQA 2I5CA 1BTKA 3GYPA 3CIKA 1Q67A 2BCJA 4HAVB 1V5PA 4H8SA 3HQCA 1H4RA 2Z0PA 1FGZA 3FSSA 1ZC3B 2YVCA 1XX0A 4GN1A 2RNRB 5HE2A 2DKPA 1KZGA 2COAA 2ELBA 2XQNM 4P7IA 4HAYB 2CODA 2LG1A 1WJ1A 1ZC4B 2DHKA 3F5RA 4WJ7A 3PVUA 3QBVB 2I1JA 1J19A 2NZ8B 2K00A 2G35A 2ADZA 2D10A
chains in the Genus database with same CATH superfamily
4YONA 1P5TA 3SUZA 3V5WA 1LW3A 3PEGA 2L2IA 4DX8A 4EKUA 1U5FA 4OSNA 5JHGA 2KIEA 1DBHA 5D3VA 4IOYX 4CHJA 2YS5A 2W2XD 1F5XA 2AL6A 4HDOA 3U12A 3PVLA 1U29A 4GNKB 5I2MA 5DH9B 2CY5A 5C5BB 2EJ8A 4MY6A 3KY9A 2LOZA 2R09A 1V88A 3BINA 1WG7A 2YF0A 3ODXA 1V5UA 5C79A 4K2OA 1UNRA 1KZ7A 2GJYA 4CYEA 4PQ0A 1DROA 3SYXA 3DCXA 2DHIA 2J0MA 5J3TA 4A6KA 2K2UA 5C5BA 2IYBA 2PZ1A 2KR9A 4QXAB 1DYNA 1FB8A 2QKMA 1GC6A 2L1CA 4F7HA 2RLOA 1BTNA 1EVHA 3GF9A 3T06A 1RRPB 3KRXA 3D8EA 4A6FB 2FJUB 4IAPA 3JV3A 5FI0A 2YT0A 2DX1A 4HAWB 4F7GA 1FOEA 2DN6A 2J0JA 1LB1A 1V89A 3PP2A 3MDBC 2GS0A 2JP2A 5CLLB 4EMOA 1V5MA 5C6RA 3ULCA 1MPHA 1GG3A 2QKLA 3N7CA 4A6FA 4YL8A 3ML4A 1ZYIA 3AJ4A 5C16A 2J59M 2DLWA 3ODOA 3PVWA 4HHVA 2Z4DA 5JP4A 2R0DA 3DXDA 4KVGB 2GCLA 1WGQA 5GOWB 2D11A 5J3QA 5KQ4A 1B55A 2NMBA 4HB0B 1TXDA 2Z0OA 2LYDA 3O96A 2MKRA 1X1GA 2KGXB 3ODWA 2KCJA 3HK0A 2D9ZA 3NWDA 1MI1A 3SO6A 1K5GB 3KRWA 1M7EA 1MK7B 2P8VA 4HB2B 1ZM0A 4NY0A 4Z2NA 3KSYA 2LKOA 2HE7A 1BAKA 1ZSQA 3AU4A 2HTHB 1AQCA 5KQ1A 5D3XA 4PNKA 4GMXB 3DXEA 4L1RA 2W2WA 3QIJA 3HIEA 1UPRA 5LG4B 1SGHA 1QQGA 3LJUX 1NI2A 3FVCA 3TO1A 1Z87A 4NSWA 4DX90 4HATB 2UZSA 4CHMA 1DDMA 1I7AA 1WI1A 3X23A 3UZTA 1FHOA 4D6WA 5M4YB 2LOXA 4MT7A 2EMTA 2V76A 2D9VA 2P0DA 1NU2A 4DIXA 5HE1A 2Y8GA 1XD4A 3CXBB 2IFSA 3GYOA 3RCPA 2M38A 3NWFA 1J0WA 1BY1A 1GC7A 1XODA 4EJNA 2I1KA 2VKIA 2EMSA 4DBBA 5FI1A 2COCA 5KCVA 2P0HA 2YSZA 1U5DA 1UNPA 2D2QA 2KUQA 4HAZB 2CY4A 2DYQA 4GYVA 2DHJA 2I5FA 3NSUA 4C0AA 3D8FA 2MFQA 3P7ZA 2KR0A 3SNHA 5D3YA 1U27A 1UPQA 1U2BA 5HE0A 2DTCA 3B77A 5J3YA 5JHHA 3U7DA 1EAZA 3TFMA 4OT1A 1WJMA 3FM8C 4KAXB 2AEHA 3ZVRA 3IVFA 3VIAA 4WVFB 4ZRIA 1MIXA 5DHFB 1EF1A 1WVHA 2X18A 2FJLA 2DA0A 2Z14A 2J0KA 1V61A 1W1GA 3D8DA 2VSZA 2CRFA 3KZ1A 5L81A 4GOUA 3A58A 1MKEA 2RUKB 4BBKA 1MK9B 2UZRA 1TJ6A 1BWNA 3DXCA 4F7UP 4HSIA 2E2XA 2ROZB 3NW8A 5IRSA 5DHAB 4KHAA 2RGNB 5LONB 3WA0A 4CSQA 1PLSA 2OTXA 3G9WA 1U5GA 2GUMA 5JLJB 5D27A 2LULA 3PG7A 2COFA 3P6AA 1P3RA 1K5DB 4IFSA 2M14A 4KHBB 2UVMA 1SHCA 1E5WA 4GXBA 3A8PA 4TKNA 4D0NB 2YS1A 1PMSA 4GMVA 2MWNB 1OQNA 5CLQB 2DX5A 1IRSA 4ZRJA 3F0WA 5HE3A 1H10A 1QC6A 1XR0B 2OQBA 2GCJA 2DYNA 4TYZA 1M7RA 1UEFA 2D9WA 1OY2A 3TW1A 2P0FA 3SV1A 1NTYA 1XKEA 2KUPA 2K2JA 2K49A 1NTVA 2ZPYA 5EFXA 4WSFA 4A6HA 3U8ZA 1X1FA 2N23A 1EGXA 1Y5OA 4QJ5B 2N0YA 1MAIA 3AU5A 1MIZB 1FGYA 1XCGA 1FHXA 3M1IB 4ZRKA 5D3WA 3EO2A 2RVBB 2YS3A 1DDVA 4K2PA 1U5EA 3FEHA 2Y7BA 4GPTB 3ULBA 3MPXA 4K81A 2Y8FA 4HDQA 3OANA 1UNQA 3WYFB 2RRFA 3QWMA 3BJIA 2H7EA 4A5KA 2MDXA 4KHOA 5I2SA 2ROVA 2NBVA 5DIFB 2H7DA 2EC1A 2DFKA 1PFJA 3PZDA 2D9YA 2YT1A 1P6SA 4HB4B 3OHMB 1X05A 1WGUA 3HSAA 4DXAB 2YT2A 2YRYA 4Y94A 2D9XA 4HAUB 1DDWA 3HW2B 3ZDTA 2W2XC 2DKQA 5LOPB 1X86A 1FHWA 1ISNA 3NWAA 3PSCA 4MK0A 4L6EA 1I2HA 2D4QA 2ELAA 4HAXB 1FAOA 4HB3B 1RJ2A 1ZVRA 1OMWA 2Z0QA 4XWXA 2RSGA 3A98B 2CAYA 4Z2MB 1X11A 1W1DA 2Z13A 4B6HA 4K17A 1TQZA 4GZUA 1N3HA 5DI9B 2KIGA 2VRWB 1W1HA 4QJ4B 1Y19B 4D0OA 3A8QA 1AWEA 3TVVA 3TCAA 2Q13A 1KI1B 3VOQA 2I5CA 1T77A 1BTKA 3GYPA 3CIKA 1Q67A 2BCJA 4HAVB 1V5PA 4H8SA 3HQCA 1H4RA 2ZKMX 2Z0PA 1FGZA 3FSSA 1ZC3B 2YVCA 1XX0A 4KHBA 4GN1A 2R2YA 2RNRB 5HE2A 2DKPA 1KZGA 2COAA 2ELBA 2XQNM 4P7IA 4HAYB 2Z59A 2CODA 2LG1A 2K8EA 1WJ1A 1ZC4B 2DHKA 3F5RA 4WJ7A 3PVUA 3QBVB 2I1JA 1J19A 2NZ8B 4QJ3B 2K00A 2G35A 2ADZA 2D10A
chains in the Genus database with same CATH topology
4YONA 1P5TA 3SUZA 3V5WA 1LW3A 3PEGA 2L2IA 4DX8A 4EKUA 1U5FA 5JHGA 1DBHA 5D3VA 4IOYX 4CHJA 2YS5A 2W2XD 1F5XA 2AL6A 4HDOA 3PVLA 1U29A 5DH9B 2CY5A 5C5BB 2EJ8A 4MY6A 3KY9A 2LOZA 2R09A 1V88A 3BINA 1WG7A 2YF0A 3ODXA 1V5UA 5C79A 4K2OA 1UNRA 1KZ7A 2GJYA 4CYEA 4PQ0A 1DROA 3SYXA 2DHIA 2J0MA 5J3TA 4A6KA 2K2UA 5C5BA 2IYBA 2PZ1A 2KR9A 1DYNA 1FB8A 2QKMA 1GC6A 2L1CA 4F7HA 2RLOA 1BTNA 1EVHA 3GF9A 3T06A 1RRPB 3KRXA 3D8EA 4A6FB 4IAPA 3JV3A 5FI0A 2YT0A 2DX1A 4HAWB 4F7GA 1FOEA 2DN6A 2J0JA 1LB1A 1V89A 3PP2A 3MDBC 2GS0A 2JP2A 5CLLB 4EMOA 1V5MA 5C6RA 3ULCA 1MPHA 1GG3A 2QKLA 3N7CA 4A6FA 4YL8A 3ML4A 3AJ4A 5C16A 2J59M 2DLWA 3ODOA 3PVWA 4HHVA 5JP4A 2R0DA 3DXDA 4KVGB 2GCLA 1WGQA 5GOWB 2D11A 5J3QA 5KQ4A 1B55A 2NMBA 4HB0B 1TXDA 2Z0OA 2LYDA 3O96A 2MKRA 1X1GA 2KGXB 3ODWA 2KCJA 3HK0A 2D9ZA 3SO6A 1K5GB 3KRWA 1M7EA 1MK7B 2P8VA 4HB2B 1ZM0A 4NY0A 4Z2NA 3KSYA 2LKOA 2HE7A 1BAKA 1ZSQA 3AU4A 2HTHB 1AQCA 5KQ1A 5D3XA 4PNKA 4GMXB 3DXEA 2W2WA 3QIJA 1UPRA 1SGHA 1QQGA 3LJUX 1NI2A 3TO1A 1Z87A 4NSWA 4DX90 4HATB 2UZSA 4CHMA 1DDMA 1I7AA 1WI1A 3X23A 3UZTA 1FHOA 2LOXA 4MT7A 2EMTA 2V76A 2D9VA 2P0DA 1NU2A 5HE1A 2Y8GA 1XD4A 3CXBB 2IFSA 3GYOA 3RCPA 2M38A 1J0WA 1BY1A 1GC7A 1XODA 4EJNA 2I1KA 2VKIA 2EMSA 4DBBA 5FI1A 2COCA 5KCVA 2P0HA 2YSZA 1U5DA 1UNPA 2D2QA 4HAZB 2CY4A 2DYQA 4GYVA 2DHJA 2I5FA 3NSUA 4C0AA 3D8FA 2MFQA 3P7ZA 3SNHA 5D3YA 1U27A 1UPQA 1U2BA 5HE0A 2DTCA 5J3YA 5JHHA 3U7DA 1EAZA 3TFMA 1WJMA 3FM8C 4KAXB 2AEHA 3ZVRA 3IVFA 3VIAA 4WVFB 4ZRIA 1MIXA 5DHFB 1EF1A 1WVHA 2X18A 2FJLA 2DA0A 2J0KA 1V61A 1W1GA 3D8DA 2VSZA 2CRFA 3KZ1A 5L81A 4GOUA 1MKEA 2RUKB 4BBKA 1MK9B 2UZRA 1TJ6A 1BWNA 3DXCA 4F7UP 2E2XA 2ROZB 5DHAB 4KHAA 2RGNB 5LONB 3WA0A 1PLSA 2OTXA 3G9WA 1U5GA 5JLJB 5D27A 2LULA 3PG7A 2COFA 3P6AA 1P3RA 1K5DB 4IFSA 2M14A 4KHBB 2UVMA 1SHCA 1E5WA 4GXBA 3A8PA 4TKNA 4D0NB 2YS1A 1PMSA 4GMVA 2MWNB 1OQNA 5CLQB 2DX5A 1IRSA 4ZRJA 3F0WA 5HE3A 1H10A 1QC6A 1XR0B 2OQBA 2GCJA 2DYNA 4TYZA 1M7RA 1UEFA 2D9WA 1OY2A 3TW1A 2P0FA 3SV1A 1NTYA 1XKEA 2KUPA 2K2JA 1NTVA 2ZPYA 5EFXA 4WSFA 4A6HA 3U8ZA 1X1FA 2N23A 1EGXA 1Y5OA 2N0YA 1MAIA 3AU5A 1MIZB 1FGYA 1XCGA 1FHXA 3M1IB 4ZRKA 5D3WA 3EO2A 2RVBB 2YS3A 1DDVA 4K2PA 1U5EA 3FEHA 2Y7BA 4GPTB 3ULBA 3MPXA 4K81A 2Y8FA 4HDQA 3OANA 1UNQA 3WYFB 3QWMA 3BJIA 2H7EA 4A5KA 2MDXA 4KHOA 2ROVA 5DIFB 2H7DA 2EC1A 2DFKA 1PFJA 3PZDA 2D9YA 2YT1A 1P6SA 4HB4B 1X05A 1WGUA 4DXAB 2YRYA 4Y94A 2D9XA 4HAUB 1DDWA 3HW2B 3ZDTA 2W2XC 2DKQA 5LOPB 1X86A 1FHWA 1ISNA 3PSCA 4MK0A 4L6EA 1I2HA 2D4QA 2ELAA 4HAXB 1FAOA 4HB3B 1RJ2A 1ZVRA 1OMWA 2Z0QA 4XWXA 2RSGA 3A98B 2CAYA 4Z2MB 1X11A 1W1DA 4B6HA 4K17A 1TQZA 4GZUA 1N3HA 5DI9B 2VRWB 1W1HA 1Y19B 4D0OA 3A8QA 1AWEA 3TVVA 3TCAA 2Q13A 1KI1B 3VOQA 2I5CA 1BTKA 3GYPA 3CIKA 1Q67A 2BCJA 4HAVB 1V5PA 4H8SA 3HQCA 1H4RA 2Z0PA 1FGZA 3FSSA 1ZC3B 2YVCA 1XX0A 4GN1A 2RNRB 5HE2A 2DKPA 1KZGA 2COAA 2ELBA 2XQNM 4P7IA 4HAYB 2CODA 2LG1A 1WJ1A 1ZC4B 2DHKA 3F5RA 4WJ7A 3PVUA 3QBVB 2I1JA 1J19A 2NZ8B 2K00A 2G35A 2ADZA 2D10A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YON A;  1P5T A;  3SUZ A;  3V5W A;  1LW3 A;  3PEG A;  2L2I A;  4DX8 A;  4EKU A;  1U5F A;  5JHG A;  1DBH A;  5D3V A;  4IOY X;  4CHJ A;  2YS5 A;  2W2X D;  1F5X A;  2AL6 A;  4HDO A;  3PVL A;  1U29 A;  5DH9 B;  2CY5 A;  5C5B B;  2EJ8 A;  4MY6 A;  3KY9 A;  2LOZ A;  2R09 A;  1V88 A;  3BIN A;  1WG7 A;  2YF0 A;  3ODX A;  1V5U A;  5C79 A;  4K2O A;  1UNR A;  1KZ7 A;  2GJY A;  4CYE A;  4PQ0 A;  1DRO A;  3SYX A;  2DHI A;  2J0M A;  5J3T A;  4A6K A;  2K2U A;  5C5B A;  2IYB A;  2PZ1 A;  2KR9 A;  1DYN A;  1FB8 A;  2QKM A;  1GC6 A;  2L1C A;  4F7H A;  2RLO A;  1BTN A;  1EVH A;  3GF9 A;  3T06 A;  1RRP B;  3KRX A;  3D8E A;  4A6F B;  4IAP A;  3JV3 A;  5FI0 A;  2YT0 A;  2DX1 A;  4HAW B;  4F7G A;  1FOE A;  2DN6 A;  2J0J A;  1LB1 A;  1V89 A;  3PP2 A;  3MDB C;  2GS0 A;  2JP2 A;  5CLL B;  4EMO A;  1V5M A;  5C6R A;  3ULC A;  1MPH A;  1GG3 A;  2QKL A;  3N7C A;  4A6F A;  4YL8 A;  3ML4 A;  3AJ4 A;  5C16 A;  2J59 M;  2DLW A;  3ODO A;  3PVW A;  4HHV A;  5JP4 A;  2R0D A;  3DXD A;  4KVG B;  2GCL A;  1WGQ A;  5GOW B;  2D11 A;  5J3Q A;  5KQ4 A;  1B55 A;  2NMB A;  4HB0 B;  1TXD A;  2Z0O A;  2LYD A;  3O96 A;  2MKR A;  1X1G A;  2KGX B;  3ODW A;  2KCJ A;  3HK0 A;  2D9Z A;  3SO6 A;  1K5G B;  3KRW A;  1M7E A;  1MK7 B;  2P8V A;  4HB2 B;  1ZM0 A;  4NY0 A;  4Z2N A;  3KSY A;  2LKO A;  2HE7 A;  1BAK A;  1ZSQ A;  3AU4 A;  2HTH B;  1AQC A;  5KQ1 A;  5D3X A;  4PNK A;  4GMX B;  3DXE A;  2W2W A;  3QIJ A;  1UPR A;  1SGH A;  1QQG A;  3LJU X;  1NI2 A;  3TO1 A;  1Z87 A;  4NSW A;  4DX9 0;  4HAT B;  2UZS A;  4CHM A;  1DDM A;  1I7A A;  1WI1 A;  3X23 A;  3UZT A;  1FHO A;  2LOX A;  4MT7 A;  2EMT A;  2V76 A;  2D9V A;  2P0D A;  1NU2 A;  5HE1 A;  2Y8G A;  1XD4 A;  3CXB B;  2IFS A;  3GYO A;  3RCP A;  2M38 A;  1J0W A;  1BY1 A;  1GC7 A;  1XOD A;  4EJN A;  2I1K A;  2VKI A;  2EMS A;  4DBB A;  5FI1 A;  2COC A;  5KCV A;  2P0H A;  2YSZ A;  1U5D A;  1UNP A;  2D2Q A;  4HAZ B;  2CY4 A;  2DYQ A;  4GYV A;  2DHJ A;  2I5F A;  3NSU A;  4C0A A;  3D8F A;  2MFQ A;  3P7Z A;  3SNH A;  5D3Y A;  1U27 A;  1UPQ A;  1U2B A;  5HE0 A;  2DTC A;  5J3Y A;  5JHH A;  3U7D A;  1EAZ A;  3TFM A;  1WJM A;  3FM8 C;  4KAX B;  2AEH A;  3ZVR A;  3IVF A;  3VIA A;  4WVF B;  4ZRI A;  1MIX A;  5DHF B;  1EF1 A;  1WVH A;  2X18 A;  2FJL A;  2DA0 A;  2J0K A;  1V61 A;  1W1G A;  3D8D A;  2VSZ A;  2CRF A;  3KZ1 A;  5L81 A;  4GOU A;  1MKE A;  2RUK B;  4BBK A;  1MK9 B;  2UZR A;  1TJ6 A;  1BWN A;  3DXC A;  4F7U P;  2E2X A;  2ROZ B;  5DHA B;  4KHA A;  2RGN B;  5LON B;  3WA0 A;  1PLS A;  2OTX A;  3G9W A;  1U5G A;  5JLJ B;  5D27 A;  2LUL A;  3PG7 A;  2COF A;  3P6A A;  1P3R A;  1K5D B;  4IFS A;  2M14 A;  4KHB B;  2UVM A;  1SHC A;  1E5W A;  4GXB A;  3A8P A;  4TKN A;  4D0N B;  2YS1 A;  1PMS A;  4GMV A;  2MWN B;  1OQN A;  5CLQ B;  2DX5 A;  1IRS A;  4ZRJ A;  3F0W A;  5HE3 A;  1H10 A;  1QC6 A;  1XR0 B;  2OQB A;  2GCJ A;  2DYN A;  4TYZ A;  1M7R A;  1UEF A;  2D9W A;  1OY2 A;  3TW1 A;  2P0F A;  3SV1 A;  1NTY A;  1XKE A;  2KUP A;  2K2J A;  1NTV A;  2ZPY A;  5EFX A;  4WSF A;  4A6H A;  3U8Z A;  1X1F A;  2N23 A;  1EGX A;  1Y5O A;  2N0Y A;  1MAI A;  3AU5 A;  1MIZ B;  1FGY A;  1XCG A;  1FHX A;  3M1I B;  4ZRK A;  5D3W A;  3EO2 A;  2RVB B;  2YS3 A;  1DDV A;  4K2P A;  1U5E A;  3FEH A;  2Y7B A;  4GPT B;  3ULB A;  3MPX A;  4K81 A;  2Y8F A;  4HDQ A;  3OAN A;  1UNQ A;  3WYF B;  3QWM A;  3BJI A;  2H7E A;  4A5K A;  2MDX A;  4KHO A;  2ROV A;  5DIF B;  2H7D A;  2EC1 A;  2DFK A;  1PFJ A;  3PZD A;  2D9Y A;  2YT1 A;  1P6S A;  4HB4 B;  1X05 A;  1WGU A;  4DXA B;  2YRY A;  4Y94 A;  2D9X A;  4HAU B;  1DDW A;  3HW2 B;  3ZDT A;  2W2X C;  2DKQ A;  5LOP B;  1X86 A;  1FHW A;  1ISN A;  3PSC A;  4MK0 A;  4L6E A;  1I2H A;  2D4Q A;  2ELA A;  4HAX B;  1FAO A;  4HB3 B;  1RJ2 A;  1ZVR A;  1OMW A;  2Z0Q A;  4XWX A;  2RSG A;  3A98 B;  2CAY A;  4Z2M B;  1X11 A;  1W1D A;  4B6H A;  4K17 A;  1TQZ A;  4GZU A;  1N3H A;  5DI9 B;  2VRW B;  1W1H A;  1Y19 B;  4D0O A;  3A8Q A;  1AWE A;  3TVV A;  3TCA A;  2Q13 A;  1KI1 B;  3VOQ A;  2I5C A;  1BTK A;  3GYP A;  3CIK A;  1Q67 A;  2BCJ A;  4HAV B;  1V5P A;  4H8S A;  3HQC A;  1H4R A;  2Z0P A;  1FGZ A;  3FSS A;  1ZC3 B;  2YVC A;  1XX0 A;  4GN1 A;  2RNR B;  5HE2 A;  2DKP A;  1KZG A;  2COA A;  2ELB A;  2XQN M;  4P7I A;  4HAY B;  2COD A;  2LG1 A;  1WJ1 A;  1ZC4 B;  2DHK A;  3F5R A;  4WJ7 A;  3PVU A;  3QBV B;  2I1J A;  1J19 A;  2NZ8 B;  2K00 A;  2G35 A;  2ADZ A;  2D10 A; 
#chains in the Genus database with same CATH topology
 4YON A;  1P5T A;  3SUZ A;  3V5W A;  1LW3 A;  3PEG A;  2L2I A;  4DX8 A;  4EKU A;  1U5F A;  4OSN A;  5JHG A;  2KIE A;  1DBH A;  5D3V A;  4IOY X;  4CHJ A;  2YS5 A;  2W2X D;  1F5X A;  2AL6 A;  4HDO A;  3U12 A;  3PVL A;  1U29 A;  4GNK B;  5I2M A;  5DH9 B;  2CY5 A;  5C5B B;  2EJ8 A;  4MY6 A;  3KY9 A;  2LOZ A;  2R09 A;  1V88 A;  3BIN A;  1WG7 A;  2YF0 A;  3ODX A;  1V5U A;  5C79 A;  4K2O A;  1UNR A;  1KZ7 A;  2GJY A;  4CYE A;  4PQ0 A;  1DRO A;  3SYX A;  3DCX A;  2DHI A;  2J0M A;  5J3T A;  4A6K A;  2K2U A;  5C5B A;  2IYB A;  2PZ1 A;  2KR9 A;  4QXA B;  1DYN A;  1FB8 A;  2QKM A;  1GC6 A;  2L1C A;  4F7H A;  2RLO A;  1BTN A;  1EVH A;  3GF9 A;  3T06 A;  1RRP B;  3KRX A;  3D8E A;  4A6F B;  2FJU B;  4IAP A;  3JV3 A;  5FI0 A;  2YT0 A;  2DX1 A;  4HAW B;  4F7G A;  1FOE A;  2DN6 A;  2J0J A;  1LB1 A;  1V89 A;  3PP2 A;  3MDB C;  2GS0 A;  2JP2 A;  5CLL B;  4EMO A;  1V5M A;  5C6R A;  3ULC A;  1MPH A;  1GG3 A;  2QKL A;  3N7C A;  4A6F A;  4YL8 A;  3ML4 A;  1ZYI A;  3AJ4 A;  5C16 A;  2J59 M;  2DLW A;  3ODO A;  3PVW A;  4HHV A;  2Z4D A;  5JP4 A;  2R0D A;  3DXD A;  4KVG B;  2GCL A;  1WGQ A;  5GOW B;  2D11 A;  5J3Q A;  5KQ4 A;  1B55 A;  2NMB A;  4HB0 B;  1TXD A;  2Z0O A;  2LYD A;  3O96 A;  2MKR A;  1X1G A;  2KGX B;  3ODW A;  2KCJ A;  3HK0 A;  2D9Z A;  3NWD A;  1MI1 A;  3SO6 A;  1K5G B;  3KRW A;  1M7E A;  1MK7 B;  2P8V A;  4HB2 B;  1ZM0 A;  4NY0 A;  4Z2N A;  3KSY A;  2LKO A;  2HE7 A;  1BAK A;  1ZSQ A;  3AU4 A;  2HTH B;  1AQC A;  5KQ1 A;  5D3X A;  4PNK A;  4GMX B;  3DXE A;  4L1R A;  2W2W A;  3QIJ A;  3HIE A;  1UPR A;  5LG4 B;  1SGH A;  1QQG A;  3LJU X;  1NI2 A;  3FVC A;  3TO1 A;  1Z87 A;  4NSW A;  4DX9 0;  4HAT B;  2UZS A;  4CHM A;  1DDM A;  1I7A A;  1WI1 A;  3X23 A;  3UZT A;  1FHO A;  4D6W A;  5M4Y B;  2LOX A;  4MT7 A;  2EMT A;  2V76 A;  2D9V A;  2P0D A;  1NU2 A;  4DIX A;  5HE1 A;  2Y8G A;  1XD4 A;  3CXB B;  2IFS A;  3GYO A;  3RCP A;  2M38 A;  3NWF A;  1J0W A;  1BY1 A;  1GC7 A;  1XOD A;  4EJN A;  2I1K A;  2VKI A;  2EMS A;  4DBB A;  5FI1 A;  2COC A;  5KCV A;  2P0H A;  2YSZ A;  1U5D A;  1UNP A;  2D2Q A;  2KUQ A;  4HAZ B;  2CY4 A;  2DYQ A;  4GYV A;  2DHJ A;  2I5F A;  3NSU A;  4C0A A;  3D8F A;  2MFQ A;  3P7Z A;  2KR0 A;  3SNH A;  5D3Y A;  1U27 A;  1UPQ A;  1U2B A;  5HE0 A;  2DTC A;  3B77 A;  5J3Y A;  5JHH A;  3U7D A;  1EAZ A;  3TFM A;  4OT1 A;  1WJM A;  3FM8 C;  4KAX B;  2AEH A;  3ZVR A;  3IVF A;  3VIA A;  4WVF B;  4ZRI A;  1MIX A;  5DHF B;  1EF1 A;  1WVH A;  2X18 A;  2FJL A;  2DA0 A;  2Z14 A;  2J0K A;  1V61 A;  1W1G A;  3D8D A;  2VSZ A;  2CRF A;  3KZ1 A;  5L81 A;  4GOU A;  3A58 A;  1MKE A;  2RUK B;  4BBK A;  1MK9 B;  2UZR A;  1TJ6 A;  1BWN A;  3DXC A;  4F7U P;  4HSI A;  2E2X A;  2ROZ B;  3NW8 A;  5IRS A;  5DHA B;  4KHA A;  2RGN B;  5LON B;  3WA0 A;  4CSQ A;  1PLS A;  2OTX A;  3G9W A;  1U5G A;  2GUM A;  5JLJ B;  5D27 A;  2LUL A;  3PG7 A;  2COF A;  3P6A A;  1P3R A;  1K5D B;  4IFS A;  2M14 A;  4KHB B;  2UVM A;  1SHC A;  1E5W A;  4GXB A;  3A8P A;  4TKN A;  4D0N B;  2YS1 A;  1PMS A;  4GMV A;  2MWN B;  1OQN A;  5CLQ B;  2DX5 A;  1IRS A;  4ZRJ A;  3F0W A;  5HE3 A;  1H10 A;  1QC6 A;  1XR0 B;  2OQB A;  2GCJ A;  2DYN A;  4TYZ A;  1M7R A;  1UEF A;  2D9W A;  1OY2 A;  3TW1 A;  2P0F A;  3SV1 A;  1NTY A;  1XKE A;  2KUP A;  2K2J A;  2K49 A;  1NTV A;  2ZPY A;  5EFX A;  4WSF A;  4A6H A;  3U8Z A;  1X1F A;  2N23 A;  1EGX A;  1Y5O A;  4QJ5 B;  2N0Y A;  1MAI A;  3AU5 A;  1MIZ B;  1FGY A;  1XCG A;  1FHX A;  3M1I B;  4ZRK A;  5D3W A;  3EO2 A;  2RVB B;  2YS3 A;  1DDV A;  4K2P A;  1U5E A;  3FEH A;  2Y7B A;  4GPT B;  3ULB A;  3MPX A;  4K81 A;  2Y8F A;  4HDQ A;  3OAN A;  1UNQ A;  3WYF B;  2RRF A;  3QWM A;  3BJI A;  2H7E A;  4A5K A;  2MDX A;  4KHO A;  5I2S A;  2ROV A;  2NBV A;  5DIF B;  2H7D A;  2EC1 A;  2DFK A;  1PFJ A;  3PZD A;  2D9Y A;  2YT1 A;  1P6S A;  4HB4 B;  3OHM B;  1X05 A;  1WGU A;  3HSA A;  4DXA B;  2YT2 A;  2YRY A;  4Y94 A;  2D9X A;  4HAU B;  1DDW A;  3HW2 B;  3ZDT A;  2W2X C;  2DKQ A;  5LOP B;  1X86 A;  1FHW A;  1ISN A;  3NWA A;  3PSC A;  4MK0 A;  4L6E A;  1I2H A;  2D4Q A;  2ELA A;  4HAX B;  1FAO A;  4HB3 B;  1RJ2 A;  1ZVR A;  1OMW A;  2Z0Q A;  4XWX A;  2RSG A;  3A98 B;  2CAY A;  4Z2M B;  1X11 A;  1W1D A;  2Z13 A;  4B6H A;  4K17 A;  1TQZ A;  4GZU A;  1N3H A;  5DI9 B;  2KIG A;  2VRW B;  1W1H A;  4QJ4 B;  1Y19 B;  4D0O A;  3A8Q A;  1AWE A;  3TVV A;  3TCA A;  2Q13 A;  1KI1 B;  3VOQ A;  2I5C A;  1T77 A;  1BTK A;  3GYP A;  3CIK A;  1Q67 A;  2BCJ A;  4HAV B;  1V5P A;  4H8S A;  3HQC A;  1H4R A;  2ZKM X;  2Z0P A;  1FGZ A;  3FSS A;  1ZC3 B;  2YVC A;  1XX0 A;  4KHB A;  4GN1 A;  2R2Y A;  2RNR B;  5HE2 A;  2DKP A;  1KZG A;  2COA A;  2ELB A;  2XQN M;  4P7I A;  4HAY B;  2Z59 A;  2COD A;  2LG1 A;  2K8E A;  1WJ1 A;  1ZC4 B;  2DHK A;  3F5R A;  4WJ7 A;  3PVU A;  3QBV B;  2I1J A;  1J19 A;  2NZ8 B;  4QJ3 B;  2K00 A;  2G35 A;  2ADZ A;  2D10 A; 
#chains in the Genus database with same CATH homology
 4YON A;  1P5T A;  3SUZ A;  3V5W A;  1LW3 A;  3PEG A;  2L2I A;  4DX8 A;  4EKU A;  1U5F A;  5JHG A;  1DBH A;  5D3V A;  4IOY X;  4CHJ A;  2YS5 A;  2W2X D;  1F5X A;  2AL6 A;  4HDO A;  3PVL A;  1U29 A;  5DH9 B;  2CY5 A;  5C5B B;  2EJ8 A;  4MY6 A;  3KY9 A;  2LOZ A;  2R09 A;  1V88 A;  3BIN A;  1WG7 A;  2YF0 A;  3ODX A;  1V5U A;  5C79 A;  4K2O A;  1UNR A;  1KZ7 A;  2GJY A;  4CYE A;  4PQ0 A;  1DRO A;  3SYX A;  2DHI A;  2J0M A;  5J3T A;  4A6K A;  2K2U A;  5C5B A;  2IYB A;  2PZ1 A;  2KR9 A;  1DYN A;  1FB8 A;  2QKM A;  1GC6 A;  2L1C A;  4F7H A;  2RLO A;  1BTN A;  1EVH A;  3GF9 A;  3T06 A;  1RRP B;  3KRX A;  3D8E A;  4A6F B;  4IAP A;  3JV3 A;  5FI0 A;  2YT0 A;  2DX1 A;  4HAW B;  4F7G A;  1FOE A;  2DN6 A;  2J0J A;  1LB1 A;  1V89 A;  3PP2 A;  3MDB C;  2GS0 A;  2JP2 A;  5CLL B;  4EMO A;  1V5M A;  5C6R A;  3ULC A;  1MPH A;  1GG3 A;  2QKL A;  3N7C A;  4A6F A;  4YL8 A;  3ML4 A;  3AJ4 A;  5C16 A;  2J59 M;  2DLW A;  3ODO A;  3PVW A;  4HHV A;  5JP4 A;  2R0D A;  3DXD A;  4KVG B;  2GCL A;  1WGQ A;  5GOW B;  2D11 A;  5J3Q A;  5KQ4 A;  1B55 A;  2NMB A;  4HB0 B;  1TXD A;  2Z0O A;  2LYD A;  3O96 A;  2MKR A;  1X1G A;  2KGX B;  3ODW A;  2KCJ A;  3HK0 A;  2D9Z A;  3SO6 A;  1K5G B;  3KRW A;  1M7E A;  1MK7 B;  2P8V A;  4HB2 B;  1ZM0 A;  4NY0 A;  4Z2N A;  3KSY A;  2LKO A;  2HE7 A;  1BAK A;  1ZSQ A;  3AU4 A;  2HTH B;  1AQC A;  5KQ1 A;  5D3X A;  4PNK A;  4GMX B;  3DXE A;  2W2W A;  3QIJ A;  1UPR A;  1SGH A;  1QQG A;  3LJU X;  1NI2 A;  3TO1 A;  1Z87 A;  4NSW A;  4DX9 0;  4HAT B;  2UZS A;  4CHM A;  1DDM A;  1I7A A;  1WI1 A;  3X23 A;  3UZT A;  1FHO A;  2LOX A;  4MT7 A;  2EMT A;  2V76 A;  2D9V A;  2P0D A;  1NU2 A;  5HE1 A;  2Y8G A;  1XD4 A;  3CXB B;  2IFS A;  3GYO A;  3RCP A;  2M38 A;  1J0W A;  1BY1 A;  1GC7 A;  1XOD A;  4EJN A;  2I1K A;  2VKI A;  2EMS A;  4DBB A;  5FI1 A;  2COC A;  5KCV A;  2P0H A;  2YSZ A;  1U5D A;  1UNP A;  2D2Q A;  4HAZ B;  2CY4 A;  2DYQ A;  4GYV A;  2DHJ A;  2I5F A;  3NSU A;  4C0A A;  3D8F A;  2MFQ A;  3P7Z A;  3SNH A;  5D3Y A;  1U27 A;  1UPQ A;  1U2B A;  5HE0 A;  2DTC A;  5J3Y A;  5JHH A;  3U7D A;  1EAZ A;  3TFM A;  1WJM A;  3FM8 C;  4KAX B;  2AEH A;  3ZVR A;  3IVF A;  3VIA A;  4WVF B;  4ZRI A;  1MIX A;  5DHF B;  1EF1 A;  1WVH A;  2X18 A;  2FJL A;  2DA0 A;  2J0K A;  1V61 A;  1W1G A;  3D8D A;  2VSZ A;  2CRF A;  3KZ1 A;  5L81 A;  4GOU A;  1MKE A;  2RUK B;  4BBK A;  1MK9 B;  2UZR A;  1TJ6 A;  1BWN A;  3DXC A;  4F7U P;  2E2X A;  2ROZ B;  5DHA B;  4KHA A;  2RGN B;  5LON B;  3WA0 A;  1PLS A;  2OTX A;  3G9W A;  1U5G A;  5JLJ B;  5D27 A;  2LUL A;  3PG7 A;  2COF A;  3P6A A;  1P3R A;  1K5D B;  4IFS A;  2M14 A;  4KHB B;  2UVM A;  1SHC A;  1E5W A;  4GXB A;  3A8P A;  4TKN A;  4D0N B;  2YS1 A;  1PMS A;  4GMV A;  2MWN B;  1OQN A;  5CLQ B;  2DX5 A;  1IRS A;  4ZRJ A;  3F0W A;  5HE3 A;  1H10 A;  1QC6 A;  1XR0 B;  2OQB A;  2GCJ A;  2DYN A;  4TYZ A;  1M7R A;  1UEF A;  2D9W A;  1OY2 A;  3TW1 A;  2P0F A;  3SV1 A;  1NTY A;  1XKE A;  2KUP A;  2K2J A;  1NTV A;  2ZPY A;  5EFX A;  4WSF A;  4A6H A;  3U8Z A;  1X1F A;  2N23 A;  1EGX A;  1Y5O A;  2N0Y A;  1MAI A;  3AU5 A;  1MIZ B;  1FGY A;  1XCG A;  1FHX A;  3M1I B;  4ZRK A;  5D3W A;  3EO2 A;  2RVB B;  2YS3 A;  1DDV A;  4K2P A;  1U5E A;  3FEH A;  2Y7B A;  4GPT B;  3ULB A;  3MPX A;  4K81 A;  2Y8F A;  4HDQ A;  3OAN A;  1UNQ A;  3WYF B;  3QWM A;  3BJI A;  2H7E A;  4A5K A;  2MDX A;  4KHO A;  2ROV A;  5DIF B;  2H7D A;  2EC1 A;  2DFK A;  1PFJ A;  3PZD A;  2D9Y A;  2YT1 A;  1P6S A;  4HB4 B;  1X05 A;  1WGU A;  4DXA B;  2YRY A;  4Y94 A;  2D9X A;  4HAU B;  1DDW A;  3HW2 B;  3ZDT A;  2W2X C;  2DKQ A;  5LOP B;  1X86 A;  1FHW A;  1ISN A;  3PSC A;  4MK0 A;  4L6E A;  1I2H A;  2D4Q A;  2ELA A;  4HAX B;  1FAO A;  4HB3 B;  1RJ2 A;  1ZVR A;  1OMW A;  2Z0Q A;  4XWX A;  2RSG A;  3A98 B;  2CAY A;  4Z2M B;  1X11 A;  1W1D A;  4B6H A;  4K17 A;  1TQZ A;  4GZU A;  1N3H A;  5DI9 B;  2VRW B;  1W1H A;  1Y19 B;  4D0O A;  3A8Q A;  1AWE A;  3TVV A;  3TCA A;  2Q13 A;  1KI1 B;  3VOQ A;  2I5C A;  1BTK A;  3GYP A;  3CIK A;  1Q67 A;  2BCJ A;  4HAV B;  1V5P A;  4H8S A;  3HQC A;  1H4R A;  2Z0P A;  1FGZ A;  3FSS A;  1ZC3 B;  2YVC A;  1XX0 A;  4GN1 A;  2RNR B;  5HE2 A;  2DKP A;  1KZG A;  2COA A;  2ELB A;  2XQN M;  4P7I A;  4HAY B;  2COD A;  2LG1 A;  1WJ1 A;  1ZC4 B;  2DHK A;  3F5R A;  4WJ7 A;  3PVU A;  3QBV B;  2I1J A;  1J19 A;  2NZ8 B;  2K00 A;  2G35 A;  2ADZ A;  2D10 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...