1X86A

Crystal structure of the dh/ph domains of leukemia-associated rhogef in complex with rhoa
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
373
structure length
362
Chain Sequence
PPNWQQLVSREVLLGLKPCEIKRQEVINELFYTERAHVRTLKVLDQVFYQRVSREGILSPSELRKIFSNLEDILQLHIGLNEQMKAVRKRNETSVIDQIGEDLLTWFSGPGEEKLKHAAATFCSNQPFALEMIKSRQKKDSRFQTFVQDAESNPLCRRLQLKDIIPTQMQRLTKYPLLLDNIAKYTEWPTEREKVKKAADHCRQILNFVNQAVKEAENKQRLEDYQRRLDTSSLKLSEYPNVEELRNLDLTKRKMIHEGPLVWKVNRDKTIDLYTLLLEDILVLLQKQDDRLVLRCHSTFSPVIKLSTVLVRQVATDNKALFVISMSDNGAQIYELVAQTVSEKTVWQDLICRMAASVKEQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Rho guanine nucleotide exchange factor 12
publication title Structural determinants of RhoA binding and nucleotide exchange in leukemia-associated Rho guanine-nucleotide exchange factor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/membrane protein
total genus 122
structure length 362
sequence length 373
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2004-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00621 RhoGEF RhoGEF domain
A PF17838 PH_16 PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.900.10 Mainly Alpha Up-down Bundle Dbl Homology Domain; Chain A Dbl homology (DH) domain 1x86A01
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1x86A02
4Z2MB 1V88A 2YT0A 2P0HA 4HAWB 5GOWB 4ZRKA 1FHOA 5DHFB 5C6RA 4KHOA 2MDXA 3WYFB 4K2PA 2EMSA 2XQNM 1MIZB 1I2HA 2CY5A 1DDWA 1GC7A 2ZPYA 1OY2A 1V61A 1V89A 2HE7A 3ODWA 3SV1A 4KHBB 1PLSA 1XKEA 1J19A 2M38A 2DHKA 3LJUX 1U5EA 1MIXA 1EGXA 4IAPA 1V5UA 3PP2A 5KCVA 2GCJA 4KVGB 2YS3A 1W1HA 2W2XD 4HB2B 1MK7B 4YONA 4DX8A 1AWEA 3ZVRA 4HB0B 5HE1A 2DYNA 3SYXA 3ZDTA 1U27A 2KCJA 3VIAA 1X1FA 3TCAA 1Y19B 4MK0A 4WVFB 3DXCA 3VOQA 2YS1A 2EJ8A 2J0JA 2D9ZA 1XD4A 2K2UA 1WGUA 5C79A 1Q67A 1FAOA 2Y8GA 3PEGA 1X86A 1MK9B 4A6FB 5J3TA 1QC6A 2AL6A 3ULBA 3FSSA 2J0MA 1FGZA 2BCJA 4HATB 3HW2B 4A6HA 1KZ7A 3P6AA 5D27A 2DHIA 3CXBB 1DDMA 2LG1A 3AU5A 4GZUA 4IOYX 5KQ1A 2JP2A 1FOEA 3F0WA 1B55A 2X18A 4D0OA 2EC1A 2DX1A 2D4QA 2ROZB 1GG3A 1LW3A 2D10A 1FB8A 2KR9A 3TO1A 2COCA 1DBHA 5C5BB 2H7DA 4H8SA 2FJLA 5DH9B 1EF1A 2KGXB 4KHAA 1X1GA 4A5KA 1P3RA 2MKRA 3SUZA 3D8EA 5D3VA 1NTVA 2OTXA 1TJ6A 3KRXA 2EMTA 3F5RA 4F7HA 3BJIA 1WG7A 2VKIA 5D3WA 2I1KA 1ZVRA 2Y7BA 2R0DA 5CLQB 3IVFA 3M1IB 4EKUA 2I5CA 4HAYB 5DI9B 5HE2A 1ZM0A 1RRPB 2K2JA 1H10A 2YT1A 2KUPA 2I5FA 2UZRA 2Y8FA 3JV3A 4P7IA 1XODA 1WGQA 3HQCA 1PFJA 2IFSA 3SNHA 2NMBA 2E2XA 1XX0A 2P0DA 4C0AA 3CIKA 4HAUB 1W1DA 2QKLA 4GMXB 1BAKA 2DHJA 3QWMA 1X05A 1N3HA 2DKQA 1FHXA 2LOZA 3QIJA 4F7UP 4K2OA 5CLLB 3KRWA 4HB4B 5EFXA 1BTNA 1ZC3B 4WJ7A 3ODXA 4CHJA 5L81A 2J59M 4NSWA 2CY4A 3EO2A 4KAXB 4Z2NA 2DKPA 1LB1A 2RLOA 2GCLA 2CRFA 2UVMA 3OANA 3PVLA 1NU2A 1FHWA 2DLWA 4GOUA 5HE3A 1W1GA 3X23A 1U5FA 1UEFA 4D0NB 3V5WA 4EJNA 1OMWA 2LOXA 5HE0A 1KZGA 1U29A 3ULCA 3GF9A 4HHVA 4PQ0A 1UNQA 2ADZA 1UNRA 2VSZA 3D8FA 2P0FA 1BTKA 5J3YA 5D3YA 5FI1A 4XWXA 1BY1A 2DTCA 5DIFB 2Z0PA 3QBVB 1UPQA 4GN1A 2DFKA 1AQCA 1M7EA 2W2XC 1P6SA 3U7DA 3PSCA 2G35A 4DXAB 2YF0A 2UZSA 1BWNA 2D2QA 2MWNB 4HAXB 1IRSA 1DDVA 2OQBA 4HDOA 3TW1A 1U2BA 4B6HA 3KY9A 2D9YA 4DX90 1NTYA 2YRYA 5JHGA 2HTHB 1Z87A 4A6FA 1QQGA 4GYVA 1H4RA 3ODOA 3D8DA 2RNRB 2Z0QA 3BINA 1EVHA 4MY6A 1EAZA 2ROVA 3AJ4A 3GYOA 3T06A 2W2WA 5KQ4A 4CHMA 1UPRA 1V5PA 1J0WA 4K17A 2D9WA 4GMVA 1OQNA 3SO6A 3ML4A 1WVHA 2ELBA 1K5GB 3MDBC 1DROA 3A98B 4MT7A 1TQZA 2GS0A 1MAIA 4BBKA 1WI1A 2RVBB 2CAYA 5D3XA 3AU4A 4IFSA 2COAA 5JLJB 2P8VA 1MKEA 5C5BA 4GPTB 2D9XA 3HK0A 3P7ZA 1FGYA 2M14A 2Z0OA 1P5TA 2V76A 1XR0B 2IYBA 2LKOA 5J3QA 1WJ1A 1SGHA 2GJYA 2YSZA 2H7EA 3A8QA 2YS5A 3TFMA 4HAVB 1SHCA 1ZC4B 1ZSQA 2D11A 3PVUA 1KI1B 3KZ1A 3DXDA 1MPHA 1Y5OA 2DA0A 2LYDA 2R09A 2COFA 4NY0A 3WA0A 1F5XA 1X11A 2RGNB 4HB3B 1E5WA 4WSFA 1M7RA 1U5GA 2I1JA 1DYNA 2Q13A 2DYQA 3U8ZA 2RUKB 3PZDA 2YVCA 2D9VA 4HDQA 2LULA 2ELAA 2L1CA 4F7GA 1NI2A 4TKNA 4YL8A 2DX5A 4CYEA 1GC6A 2K00A 1WJMA 1I7AA 2L2IA 4HAZB 2N23A 1ISNA 4Y94A 4PNKA 2MFQA 5JP4A 1UNPA 3PVWA 4TYZA 3TVVA 3MPXA 3KSYA 1TXDA 3PG7A 3FEHA 2DN6A 4ZRIA 2N0YA 1U5DA 5JHHA 3DXEA 2J0KA 2NZ8B 1V5MA 2PZ1A 2RSGA 4A6KA 5DHAB 3N7CA 5LONB 5LOPB 4ZRJA 4L6EA 1RJ2A 3G9WA 5FI0A 3O96A 2AEHA 2QKMA 4DBBA 2VRWB 4GXBA 3RCPA 4EMOA 1K5DB 5C16A 3UZTA 1XCGA 3GYPA 3NSUA 1PMSA 2CODA 3FM8C 3A8PA 4K81A
chains in the Genus database with same CATH superfamily
4Z2MB 1V88A 2YT0A 2P0HA 4HAWB 5GOWB 4ZRKA 1FHOA 5DHFB 5C6RA 4KHOA 2MDXA 3WYFB 4K2PA 2K49A 4HSIA 2EMSA 2KIGA 2XQNM 3HIEA 1MIZB 1I2HA 2CY5A 1DDWA 1GC7A 2ZPYA 1OY2A 1V61A 1V89A 2KR0A 2HE7A 3ODWA 3SV1A 4KHBB 1PLSA 1XKEA 1J19A 2M38A 2DHKA 3LJUX 3NWDA 1U5EA 1MIXA 1EGXA 4IAPA 4QXAB 1V5UA 3A58A 3PP2A 5KCVA 2GCJA 4KVGB 2YS3A 1W1HA 2W2XD 4HB2B 1MK7B 4QJ4B 4YONA 4DX8A 1AWEA 2FJUB 3ZVRA 4HB0B 5HE1A 2DYNA 3SYXA 3ZDTA 1U27A 2KCJA 4L1RA 1X1FA 3TCAA 1Y19B 3VIAA 4MK0A 4WVFB 3DXCA 3VOQA 2YS1A 2EJ8A 2J0JA 5I2SA 2D9ZA 1XD4A 2K2UA 1WGUA 5C79A 2NBVA 3OHMB 1Q67A 1FAOA 2Y8GA 3PEGA 1X86A 1MK9B 4A6FB 5J3TA 1QC6A 2AL6A 3DCXA 3ULBA 3FSSA 2J0MA 1FGZA 2BCJA 4HATB 3HW2B 4A6HA 3NWFA 1KZ7A 2ZKMX 3P6AA 5D27A 2DHIA 3CXBB 1DDMA 2LG1A 3AU5A 4GZUA 4IOYX 5KQ1A 2JP2A 1FOEA 3F0WA 1B55A 2X18A 4D0OA 2EC1A 2DX1A 4D6WA 2D4QA 2ROZB 1GG3A 1LW3A 2D10A 1FB8A 2KR9A 3TO1A 2COCA 1DBHA 5C5BB 2H7DA 4H8SA 2FJLA 5DH9B 1EF1A 2KGXB 4KHAA 1X1GA 4A5KA 1P3RA 2MKRA 3SUZA 3D8EA 5D3VA 1NTVA 2OTXA 1TJ6A 3KRXA 2EMTA 3F5RA 4F7HA 3BJIA 1WG7A 2VKIA 5D3WA 2I1KA 1ZVRA 2Y7BA 2R0DA 5CLQB 3IVFA 3M1IB 4EKUA 2I5CA 4OT1A 2Z13A 4HAYB 2KUQA 5DI9B 5HE2A 1ZM0A 1RRPB 2K2JA 1H10A 2YT1A 2KUPA 2I5FA 2UZRA 2Y8FA 3JV3A 4P7IA 5M4YB 1XODA 1WGQA 3HQCA 1PFJA 2IFSA 3SNHA 2NMBA 4DIXA 2E2XA 1XX0A 2KIEA 2P0DA 4C0AA 3CIKA 4HAUB 2Z4DA 1W1DA 4QJ5B 2QKLA 4GMXB 1BAKA 2DHJA 3QWMA 1X05A 1N3HA 2DKQA 1FHXA 2LOZA 3QIJA 4F7UP 4K2OA 5CLLB 3KRWA 4HB4B 5EFXA 1BTNA 1ZC3B 4WJ7A 3ODXA 4CHJA 5L81A 2J59M 4NSWA 2CY4A 3EO2A 4KAXB 4Z2NA 2DKPA 2RRFA 1LB1A 2RLOA 1T77A 2GCLA 2CRFA 2UVMA 3OANA 3PVLA 1NU2A 4OSNA 1FHWA 2DLWA 4GOUA 4KHBA 5HE3A 1W1GA 3X23A 1U5FA 1UEFA 4D0NB 4QJ3B 3V5WA 4EJNA 1OMWA 2LOXA 5HE0A 1ZYIA 1KZGA 1U29A 3ULCA 3GF9A 4HHVA 4PQ0A 1UNQA 2ADZA 1UNRA 2VSZA 3D8FA 2P0FA 1BTKA 5J3YA 5D3YA 5FI1A 4XWXA 1BY1A 2DTCA 5DIFB 2Z0PA 3QBVB 1UPQA 4GN1A 2DFKA 1AQCA 1M7EA 2W2XC 1P6SA 2YT2A 3U7DA 3PSCA 2G35A 4DXAB 2YF0A 2UZSA 1BWNA 2D2QA 2MWNB 3NW8A 4HAXB 1IRSA 1MI1A 1DDVA 2OQBA 4HDOA 3TW1A 1U2BA 4B6HA 3KY9A 2D9YA 4DX90 1NTYA 2YRYA 5JHGA 2HTHB 1Z87A 4A6FA 1QQGA 4GYVA 1H4RA 3ODOA 3D8DA 2RNRB 2Z0QA 3BINA 1EVHA 4MY6A 1EAZA 2ROVA 3AJ4A 3GYOA 3T06A 2W2WA 5KQ4A 4CHMA 1UPRA 1V5PA 1J0WA 4K17A 2D9WA 4GMVA 1OQNA 3SO6A 3ML4A 1WVHA 2ELBA 1K5GB 2K8EA 3MDBC 1DROA 3A98B 3B77A 3NWAA 4MT7A 1TQZA 2GS0A 1MAIA 4BBKA 1WI1A 2RVBB 2CAYA 4GNKB 3AU4A 5D3XA 4IFSA 2COAA 5JLJB 2P8VA 1MKEA 5C5BA 4GPTB 2D9XA 3HK0A 3P7ZA 1FGYA 2M14A 2Z0OA 1P5TA 2V76A 3U12A 1XR0B 2IYBA 2LKOA 5J3QA 1WJ1A 1SGHA 2GJYA 2YSZA 2H7EA 5LG4B 3A8QA 2YS5A 3TFMA 4HAVB 1SHCA 1ZC4B 1ZSQA 2D11A 3PVUA 1KI1B 3KZ1A 3DXDA 1MPHA 1Y5OA 5IRSA 2DA0A 2LYDA 2R09A 2COFA 4NY0A 3WA0A 1F5XA 1X11A 2RGNB 4HB3B 1E5WA 2GUMA 4WSFA 1M7RA 1U5GA 2Z14A 2I1JA 1DYNA 2Q13A 2DYQA 3U8ZA 2RUKB 3PZDA 2YVCA 2D9VA 4HDQA 2LULA 2ELAA 2L1CA 4F7GA 1NI2A 4TKNA 4YL8A 2DX5A 4CYEA 1GC6A 3HSAA 5I2MA 2K00A 1WJMA 1I7AA 2L2IA 4HAZB 2N23A 1ISNA 4CSQA 4Y94A 4PNKA 2MFQA 5JP4A 1UNPA 3PVWA 4TYZA 3TVVA 3MPXA 3KSYA 1TXDA 3PG7A 3FEHA 2DN6A 4ZRIA 2N0YA 2Z59A 1U5DA 5JHHA 3DXEA 2J0KA 2NZ8B 1V5MA 2PZ1A 2RSGA 4A6KA 5DHAB 3N7CA 5LONB 5LOPB 4ZRJA 4L6EA 1RJ2A 3G9WA 5FI0A 3O96A 3FVCA 2AEHA 2QKMA 4DBBA 2VRWB 4GXBA 3RCPA 4EMOA 1K5DB 5C16A 2R2YA 3UZTA 1XCGA 3GYPA 3NSUA 1PMSA 2CODA 3FM8C 3A8PA 4K81A
chains in the Genus database with same CATH topology
4Z2MB 1V88A 2YT0A 2P0HA 4HAWB 5GOWB 4ZRKA 1FHOA 5DHFB 5C6RA 4KHOA 2MDXA 3WYFB 4K2PA 2EMSA 2XQNM 1MIZB 1I2HA 2CY5A 1DDWA 1GC7A 2ZPYA 1OY2A 1V61A 1V89A 2HE7A 3ODWA 3SV1A 4KHBB 1PLSA 1XKEA 1J19A 2M38A 2DHKA 3LJUX 1U5EA 1MIXA 1EGXA 4IAPA 1V5UA 3PP2A 5KCVA 2GCJA 4KVGB 2YS3A 1W1HA 2W2XD 4HB2B 1MK7B 4YONA 4DX8A 1AWEA 3ZVRA 4HB0B 5HE1A 2DYNA 3SYXA 3ZDTA 1U27A 2KCJA 3VIAA 1X1FA 3TCAA 1Y19B 4MK0A 4WVFB 3DXCA 3VOQA 2YS1A 2EJ8A 2J0JA 2D9ZA 1XD4A 2K2UA 1WGUA 5C79A 1Q67A 1FAOA 2Y8GA 3PEGA 1X86A 1MK9B 4A6FB 5J3TA 1QC6A 2AL6A 3ULBA 3FSSA 2J0MA 1FGZA 2BCJA 4HATB 3HW2B 4A6HA 1KZ7A 3P6AA 5D27A 2DHIA 3CXBB 1DDMA 2LG1A 3AU5A 4GZUA 4IOYX 5KQ1A 2JP2A 1FOEA 3F0WA 1B55A 2X18A 4D0OA 2EC1A 2DX1A 2D4QA 2ROZB 1GG3A 1LW3A 2D10A 1FB8A 2KR9A 3TO1A 2COCA 1DBHA 5C5BB 2H7DA 4H8SA 2FJLA 5DH9B 1EF1A 2KGXB 4KHAA 1X1GA 4A5KA 1P3RA 2MKRA 3SUZA 3D8EA 5D3VA 1NTVA 2OTXA 1TJ6A 3KRXA 2EMTA 3F5RA 4F7HA 3BJIA 1WG7A 2VKIA 5D3WA 2I1KA 1ZVRA 2Y7BA 2R0DA 5CLQB 3IVFA 3M1IB 4EKUA 2I5CA 4HAYB 5DI9B 5HE2A 1ZM0A 1RRPB 2K2JA 1H10A 2YT1A 2KUPA 2I5FA 2UZRA 2Y8FA 3JV3A 4P7IA 1XODA 1WGQA 3HQCA 1PFJA 2IFSA 3SNHA 2NMBA 2E2XA 1XX0A 2P0DA 4C0AA 3CIKA 4HAUB 1W1DA 2QKLA 4GMXB 1BAKA 2DHJA 3QWMA 1X05A 1N3HA 2DKQA 1FHXA 2LOZA 3QIJA 4F7UP 4K2OA 5CLLB 3KRWA 4HB4B 5EFXA 1BTNA 1ZC3B 4WJ7A 3ODXA 4CHJA 5L81A 2J59M 4NSWA 2CY4A 3EO2A 4KAXB 4Z2NA 2DKPA 1LB1A 2RLOA 2GCLA 2CRFA 2UVMA 3OANA 3PVLA 1NU2A 1FHWA 2DLWA 4GOUA 5HE3A 1W1GA 3X23A 1U5FA 1UEFA 4D0NB 3V5WA 4EJNA 1OMWA 2LOXA 5HE0A 1KZGA 1U29A 3ULCA 3GF9A 4HHVA 4PQ0A 1UNQA 2ADZA 1UNRA 2VSZA 3D8FA 2P0FA 1BTKA 5J3YA 5D3YA 5FI1A 4XWXA 1BY1A 2DTCA 5DIFB 2Z0PA 3QBVB 1UPQA 4GN1A 2DFKA 1AQCA 1M7EA 2W2XC 1P6SA 3U7DA 3PSCA 2G35A 4DXAB 2YF0A 2UZSA 1BWNA 2D2QA 2MWNB 4HAXB 1IRSA 1DDVA 2OQBA 4HDOA 3TW1A 1U2BA 4B6HA 3KY9A 2D9YA 4DX90 1NTYA 2YRYA 5JHGA 2HTHB 1Z87A 4A6FA 1QQGA 4GYVA 1H4RA 3ODOA 3D8DA 2RNRB 2Z0QA 3BINA 1EVHA 4MY6A 1EAZA 2ROVA 3AJ4A 3GYOA 3T06A 2W2WA 5KQ4A 4CHMA 1UPRA 1V5PA 1J0WA 4K17A 2D9WA 4GMVA 1OQNA 3SO6A 3ML4A 1WVHA 2ELBA 1K5GB 3MDBC 1DROA 3A98B 4MT7A 1TQZA 2GS0A 1MAIA 4BBKA 1WI1A 2RVBB 2CAYA 5D3XA 3AU4A 4IFSA 2COAA 5JLJB 2P8VA 1MKEA 5C5BA 4GPTB 2D9XA 3HK0A 3P7ZA 1FGYA 2M14A 2Z0OA 1P5TA 2V76A 1XR0B 2IYBA 2LKOA 5J3QA 1WJ1A 1SGHA 2GJYA 2YSZA 2H7EA 3A8QA 2YS5A 3TFMA 4HAVB 1SHCA 1ZC4B 1ZSQA 2D11A 3PVUA 1KI1B 3KZ1A 3DXDA 1MPHA 1Y5OA 2DA0A 2LYDA 2R09A 2COFA 4NY0A 3WA0A 1F5XA 1X11A 2RGNB 4HB3B 1E5WA 4WSFA 1M7RA 1U5GA 2I1JA 1DYNA 2Q13A 2DYQA 3U8ZA 2RUKB 3PZDA 2YVCA 2D9VA 4HDQA 2LULA 2ELAA 2L1CA 4F7GA 1NI2A 4TKNA 4YL8A 2DX5A 4CYEA 1GC6A 2K00A 1WJMA 1I7AA 2L2IA 4HAZB 2N23A 1ISNA 4Y94A 4PNKA 2MFQA 5JP4A 1UNPA 3PVWA 4TYZA 3TVVA 3MPXA 3KSYA 1TXDA 3PG7A 3FEHA 2DN6A 4ZRIA 2N0YA 1U5DA 5JHHA 3DXEA 2J0KA 2NZ8B 1V5MA 2PZ1A 2RSGA 4A6KA 5DHAB 3N7CA 5LONB 5LOPB 4ZRJA 4L6EA 1RJ2A 3G9WA 5FI0A 3O96A 2AEHA 2QKMA 4DBBA 2VRWB 4GXBA 3RCPA 4EMOA 1K5DB 5C16A 3UZTA 1XCGA 3GYPA 3NSUA 1PMSA 2CODA 3FM8C 3A8PA 4K81A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Z2M B;  1V88 A;  2YT0 A;  2P0H A;  4HAW B;  5GOW B;  4ZRK A;  1FHO A;  5DHF B;  5C6R A;  4KHO A;  2MDX A;  3WYF B;  4K2P A;  2EMS A;  2XQN M;  1MIZ B;  1I2H A;  2CY5 A;  1DDW A;  1GC7 A;  2ZPY A;  1OY2 A;  1V61 A;  1V89 A;  2HE7 A;  3ODW A;  3SV1 A;  4KHB B;  1PLS A;  1XKE A;  1J19 A;  2M38 A;  2DHK A;  3LJU X;  1U5E A;  1MIX A;  1EGX A;  4IAP A;  1V5U A;  3PP2 A;  5KCV A;  2GCJ A;  4KVG B;  2YS3 A;  1W1H A;  2W2X D;  4HB2 B;  1MK7 B;  4YON A;  4DX8 A;  1AWE A;  3ZVR A;  4HB0 B;  5HE1 A;  2DYN A;  3SYX A;  3ZDT A;  1U27 A;  2KCJ A;  3VIA A;  1X1F A;  3TCA A;  1Y19 B;  4MK0 A;  4WVF B;  3DXC A;  3VOQ A;  2YS1 A;  2EJ8 A;  2J0J A;  2D9Z A;  1XD4 A;  2K2U A;  1WGU A;  5C79 A;  1Q67 A;  1FAO A;  2Y8G A;  3PEG A;  1X86 A;  1MK9 B;  4A6F B;  5J3T A;  1QC6 A;  2AL6 A;  3ULB A;  3FSS A;  2J0M A;  1FGZ A;  2BCJ A;  4HAT B;  3HW2 B;  4A6H A;  1KZ7 A;  3P6A A;  5D27 A;  2DHI A;  3CXB B;  1DDM A;  2LG1 A;  3AU5 A;  4GZU A;  4IOY X;  5KQ1 A;  2JP2 A;  1FOE A;  3F0W A;  1B55 A;  2X18 A;  4D0O A;  2EC1 A;  2DX1 A;  2D4Q A;  2ROZ B;  1GG3 A;  1LW3 A;  2D10 A;  1FB8 A;  2KR9 A;  3TO1 A;  2COC A;  1DBH A;  5C5B B;  2H7D A;  4H8S A;  2FJL A;  5DH9 B;  1EF1 A;  2KGX B;  4KHA A;  1X1G A;  4A5K A;  1P3R A;  2MKR A;  3SUZ A;  3D8E A;  5D3V A;  1NTV A;  2OTX A;  1TJ6 A;  3KRX A;  2EMT A;  3F5R A;  4F7H A;  3BJI A;  1WG7 A;  2VKI A;  5D3W A;  2I1K A;  1ZVR A;  2Y7B A;  2R0D A;  5CLQ B;  3IVF A;  3M1I B;  4EKU A;  2I5C A;  4HAY B;  5DI9 B;  5HE2 A;  1ZM0 A;  1RRP B;  2K2J A;  1H10 A;  2YT1 A;  2KUP A;  2I5F A;  2UZR A;  2Y8F A;  3JV3 A;  4P7I A;  1XOD A;  1WGQ A;  3HQC A;  1PFJ A;  2IFS A;  3SNH A;  2NMB A;  2E2X A;  1XX0 A;  2P0D A;  4C0A A;  3CIK A;  4HAU B;  1W1D A;  2QKL A;  4GMX B;  1BAK A;  2DHJ A;  3QWM A;  1X05 A;  1N3H A;  2DKQ A;  1FHX A;  2LOZ A;  3QIJ A;  4F7U P;  4K2O A;  5CLL B;  3KRW A;  4HB4 B;  5EFX A;  1BTN A;  1ZC3 B;  4WJ7 A;  3ODX A;  4CHJ A;  5L81 A;  2J59 M;  4NSW A;  2CY4 A;  3EO2 A;  4KAX B;  4Z2N A;  2DKP A;  1LB1 A;  2RLO A;  2GCL A;  2CRF A;  2UVM A;  3OAN A;  3PVL A;  1NU2 A;  1FHW A;  2DLW A;  4GOU A;  5HE3 A;  1W1G A;  3X23 A;  1U5F A;  1UEF A;  4D0N B;  3V5W A;  4EJN A;  1OMW A;  2LOX A;  5HE0 A;  1KZG A;  1U29 A;  3ULC A;  3GF9 A;  4HHV A;  4PQ0 A;  1UNQ A;  2ADZ A;  1UNR A;  2VSZ A;  3D8F A;  2P0F A;  1BTK A;  5J3Y A;  5D3Y A;  5FI1 A;  4XWX A;  1BY1 A;  2DTC A;  5DIF B;  2Z0P A;  3QBV B;  1UPQ A;  4GN1 A;  2DFK A;  1AQC A;  1M7E A;  2W2X C;  1P6S A;  3U7D A;  3PSC A;  2G35 A;  4DXA B;  2YF0 A;  2UZS A;  1BWN A;  2D2Q A;  2MWN B;  4HAX B;  1IRS A;  1DDV A;  2OQB A;  4HDO A;  3TW1 A;  1U2B A;  4B6H A;  3KY9 A;  2D9Y A;  4DX9 0;  1NTY A;  2YRY A;  5JHG A;  2HTH B;  1Z87 A;  4A6F A;  1QQG A;  4GYV A;  1H4R A;  3ODO A;  3D8D A;  2RNR B;  2Z0Q A;  3BIN A;  1EVH A;  4MY6 A;  1EAZ A;  2ROV A;  3AJ4 A;  3GYO A;  3T06 A;  2W2W A;  5KQ4 A;  4CHM A;  1UPR A;  1V5P A;  1J0W A;  4K17 A;  2D9W A;  4GMV A;  1OQN A;  3SO6 A;  3ML4 A;  1WVH A;  2ELB A;  1K5G B;  3MDB C;  1DRO A;  3A98 B;  4MT7 A;  1TQZ A;  2GS0 A;  1MAI A;  4BBK A;  1WI1 A;  2RVB B;  2CAY A;  5D3X A;  3AU4 A;  4IFS A;  2COA A;  5JLJ B;  2P8V A;  1MKE A;  5C5B A;  4GPT B;  2D9X A;  3HK0 A;  3P7Z A;  1FGY A;  2M14 A;  2Z0O A;  1P5T A;  2V76 A;  1XR0 B;  2IYB A;  2LKO A;  5J3Q A;  1WJ1 A;  1SGH A;  2GJY A;  2YSZ A;  2H7E A;  3A8Q A;  2YS5 A;  3TFM A;  4HAV B;  1SHC A;  1ZC4 B;  1ZSQ A;  2D11 A;  3PVU A;  1KI1 B;  3KZ1 A;  3DXD A;  1MPH A;  1Y5O A;  2DA0 A;  2LYD A;  2R09 A;  2COF A;  4NY0 A;  3WA0 A;  1F5X A;  1X11 A;  2RGN B;  4HB3 B;  1E5W A;  4WSF A;  1M7R A;  1U5G A;  2I1J A;  1DYN A;  2Q13 A;  2DYQ A;  3U8Z A;  2RUK B;  3PZD A;  2YVC A;  2D9V A;  4HDQ A;  2LUL A;  2ELA A;  2L1C A;  4F7G A;  1NI2 A;  4TKN A;  4YL8 A;  2DX5 A;  4CYE A;  1GC6 A;  2K00 A;  1WJM A;  1I7A A;  2L2I A;  4HAZ B;  2N23 A;  1ISN A;  4Y94 A;  4PNK A;  2MFQ A;  5JP4 A;  1UNP A;  3PVW A;  4TYZ A;  3TVV A;  3MPX A;  3KSY A;  1TXD A;  3PG7 A;  3FEH A;  2DN6 A;  4ZRI A;  2N0Y A;  1U5D A;  5JHH A;  3DXE A;  2J0K A;  2NZ8 B;  1V5M A;  2PZ1 A;  2RSG A;  4A6K A;  5DHA B;  3N7C A;  5LON B;  5LOP B;  4ZRJ A;  4L6E A;  1RJ2 A;  3G9W A;  5FI0 A;  3O96 A;  2AEH A;  2QKM A;  4DBB A;  2VRW B;  4GXB A;  3RCP A;  4EMO A;  1K5D B;  5C16 A;  3UZT A;  1XCG A;  3GYP A;  3NSU A;  1PMS A;  2COD A;  3FM8 C;  3A8P A;  4K81 A; 
#chains in the Genus database with same CATH topology
 4Z2M B;  1V88 A;  2YT0 A;  2P0H A;  4HAW B;  5GOW B;  4ZRK A;  1FHO A;  5DHF B;  5C6R A;  4KHO A;  2MDX A;  3WYF B;  4K2P A;  2K49 A;  4HSI A;  2EMS A;  2KIG A;  2XQN M;  3HIE A;  1MIZ B;  1I2H A;  2CY5 A;  1DDW A;  1GC7 A;  2ZPY A;  1OY2 A;  1V61 A;  1V89 A;  2KR0 A;  2HE7 A;  3ODW A;  3SV1 A;  4KHB B;  1PLS A;  1XKE A;  1J19 A;  2M38 A;  2DHK A;  3LJU X;  3NWD A;  1U5E A;  1MIX A;  1EGX A;  4IAP A;  4QXA B;  1V5U A;  3A58 A;  3PP2 A;  5KCV A;  2GCJ A;  4KVG B;  2YS3 A;  1W1H A;  2W2X D;  4HB2 B;  1MK7 B;  4QJ4 B;  4YON A;  4DX8 A;  1AWE A;  2FJU B;  3ZVR A;  4HB0 B;  5HE1 A;  2DYN A;  3SYX A;  3ZDT A;  1U27 A;  2KCJ A;  4L1R A;  1X1F A;  3TCA A;  1Y19 B;  3VIA A;  4MK0 A;  4WVF B;  3DXC A;  3VOQ A;  2YS1 A;  2EJ8 A;  2J0J A;  5I2S A;  2D9Z A;  1XD4 A;  2K2U A;  1WGU A;  5C79 A;  2NBV A;  3OHM B;  1Q67 A;  1FAO A;  2Y8G A;  3PEG A;  1X86 A;  1MK9 B;  4A6F B;  5J3T A;  1QC6 A;  2AL6 A;  3DCX A;  3ULB A;  3FSS A;  2J0M A;  1FGZ A;  2BCJ A;  4HAT B;  3HW2 B;  4A6H A;  3NWF A;  1KZ7 A;  2ZKM X;  3P6A A;  5D27 A;  2DHI A;  3CXB B;  1DDM A;  2LG1 A;  3AU5 A;  4GZU A;  4IOY X;  5KQ1 A;  2JP2 A;  1FOE A;  3F0W A;  1B55 A;  2X18 A;  4D0O A;  2EC1 A;  2DX1 A;  4D6W A;  2D4Q A;  2ROZ B;  1GG3 A;  1LW3 A;  2D10 A;  1FB8 A;  2KR9 A;  3TO1 A;  2COC A;  1DBH A;  5C5B B;  2H7D A;  4H8S A;  2FJL A;  5DH9 B;  1EF1 A;  2KGX B;  4KHA A;  1X1G A;  4A5K A;  1P3R A;  2MKR A;  3SUZ A;  3D8E A;  5D3V A;  1NTV A;  2OTX A;  1TJ6 A;  3KRX A;  2EMT A;  3F5R A;  4F7H A;  3BJI A;  1WG7 A;  2VKI A;  5D3W A;  2I1K A;  1ZVR A;  2Y7B A;  2R0D A;  5CLQ B;  3IVF A;  3M1I B;  4EKU A;  2I5C A;  4OT1 A;  2Z13 A;  4HAY B;  2KUQ A;  5DI9 B;  5HE2 A;  1ZM0 A;  1RRP B;  2K2J A;  1H10 A;  2YT1 A;  2KUP A;  2I5F A;  2UZR A;  2Y8F A;  3JV3 A;  4P7I A;  5M4Y B;  1XOD A;  1WGQ A;  3HQC A;  1PFJ A;  2IFS A;  3SNH A;  2NMB A;  4DIX A;  2E2X A;  1XX0 A;  2KIE A;  2P0D A;  4C0A A;  3CIK A;  4HAU B;  2Z4D A;  1W1D A;  4QJ5 B;  2QKL A;  4GMX B;  1BAK A;  2DHJ A;  3QWM A;  1X05 A;  1N3H A;  2DKQ A;  1FHX A;  2LOZ A;  3QIJ A;  4F7U P;  4K2O A;  5CLL B;  3KRW A;  4HB4 B;  5EFX A;  1BTN A;  1ZC3 B;  4WJ7 A;  3ODX A;  4CHJ A;  5L81 A;  2J59 M;  4NSW A;  2CY4 A;  3EO2 A;  4KAX B;  4Z2N A;  2DKP A;  2RRF A;  1LB1 A;  2RLO A;  1T77 A;  2GCL A;  2CRF A;  2UVM A;  3OAN A;  3PVL A;  1NU2 A;  4OSN A;  1FHW A;  2DLW A;  4GOU A;  4KHB A;  5HE3 A;  1W1G A;  3X23 A;  1U5F A;  1UEF A;  4D0N B;  4QJ3 B;  3V5W A;  4EJN A;  1OMW A;  2LOX A;  5HE0 A;  1ZYI A;  1KZG A;  1U29 A;  3ULC A;  3GF9 A;  4HHV A;  4PQ0 A;  1UNQ A;  2ADZ A;  1UNR A;  2VSZ A;  3D8F A;  2P0F A;  1BTK A;  5J3Y A;  5D3Y A;  5FI1 A;  4XWX A;  1BY1 A;  2DTC A;  5DIF B;  2Z0P A;  3QBV B;  1UPQ A;  4GN1 A;  2DFK A;  1AQC A;  1M7E A;  2W2X C;  1P6S A;  2YT2 A;  3U7D A;  3PSC A;  2G35 A;  4DXA B;  2YF0 A;  2UZS A;  1BWN A;  2D2Q A;  2MWN B;  3NW8 A;  4HAX B;  1IRS A;  1MI1 A;  1DDV A;  2OQB A;  4HDO A;  3TW1 A;  1U2B A;  4B6H A;  3KY9 A;  2D9Y A;  4DX9 0;  1NTY A;  2YRY A;  5JHG A;  2HTH B;  1Z87 A;  4A6F A;  1QQG A;  4GYV A;  1H4R A;  3ODO A;  3D8D A;  2RNR B;  2Z0Q A;  3BIN A;  1EVH A;  4MY6 A;  1EAZ A;  2ROV A;  3AJ4 A;  3GYO A;  3T06 A;  2W2W A;  5KQ4 A;  4CHM A;  1UPR A;  1V5P A;  1J0W A;  4K17 A;  2D9W A;  4GMV A;  1OQN A;  3SO6 A;  3ML4 A;  1WVH A;  2ELB A;  1K5G B;  2K8E A;  3MDB C;  1DRO A;  3A98 B;  3B77 A;  3NWA A;  4MT7 A;  1TQZ A;  2GS0 A;  1MAI A;  4BBK A;  1WI1 A;  2RVB B;  2CAY A;  4GNK B;  3AU4 A;  5D3X A;  4IFS A;  2COA A;  5JLJ B;  2P8V A;  1MKE A;  5C5B A;  4GPT B;  2D9X A;  3HK0 A;  3P7Z A;  1FGY A;  2M14 A;  2Z0O A;  1P5T A;  2V76 A;  3U12 A;  1XR0 B;  2IYB A;  2LKO A;  5J3Q A;  1WJ1 A;  1SGH A;  2GJY A;  2YSZ A;  2H7E A;  5LG4 B;  3A8Q A;  2YS5 A;  3TFM A;  4HAV B;  1SHC A;  1ZC4 B;  1ZSQ A;  2D11 A;  3PVU A;  1KI1 B;  3KZ1 A;  3DXD A;  1MPH A;  1Y5O A;  5IRS A;  2DA0 A;  2LYD A;  2R09 A;  2COF A;  4NY0 A;  3WA0 A;  1F5X A;  1X11 A;  2RGN B;  4HB3 B;  1E5W A;  2GUM A;  4WSF A;  1M7R A;  1U5G A;  2Z14 A;  2I1J A;  1DYN A;  2Q13 A;  2DYQ A;  3U8Z A;  2RUK B;  3PZD A;  2YVC A;  2D9V A;  4HDQ A;  2LUL A;  2ELA A;  2L1C A;  4F7G A;  1NI2 A;  4TKN A;  4YL8 A;  2DX5 A;  4CYE A;  1GC6 A;  3HSA A;  5I2M A;  2K00 A;  1WJM A;  1I7A A;  2L2I A;  4HAZ B;  2N23 A;  1ISN A;  4CSQ A;  4Y94 A;  4PNK A;  2MFQ A;  5JP4 A;  1UNP A;  3PVW A;  4TYZ A;  3TVV A;  3MPX A;  3KSY A;  1TXD A;  3PG7 A;  3FEH A;  2DN6 A;  4ZRI A;  2N0Y A;  2Z59 A;  1U5D A;  5JHH A;  3DXE A;  2J0K A;  2NZ8 B;  1V5M A;  2PZ1 A;  2RSG A;  4A6K A;  5DHA B;  3N7C A;  5LON B;  5LOP B;  4ZRJ A;  4L6E A;  1RJ2 A;  3G9W A;  5FI0 A;  3O96 A;  3FVC A;  2AEH A;  2QKM A;  4DBB A;  2VRW B;  4GXB A;  3RCP A;  4EMO A;  1K5D B;  5C16 A;  2R2Y A;  3UZT A;  1XCG A;  3GYP A;  3NSU A;  1PMS A;  2COD A;  3FM8 C;  3A8P A;  4K81 A; 
#chains in the Genus database with same CATH homology
 4Z2M B;  1V88 A;  2YT0 A;  2P0H A;  4HAW B;  5GOW B;  4ZRK A;  1FHO A;  5DHF B;  5C6R A;  4KHO A;  2MDX A;  3WYF B;  4K2P A;  2EMS A;  2XQN M;  1MIZ B;  1I2H A;  2CY5 A;  1DDW A;  1GC7 A;  2ZPY A;  1OY2 A;  1V61 A;  1V89 A;  2HE7 A;  3ODW A;  3SV1 A;  4KHB B;  1PLS A;  1XKE A;  1J19 A;  2M38 A;  2DHK A;  3LJU X;  1U5E A;  1MIX A;  1EGX A;  4IAP A;  1V5U A;  3PP2 A;  5KCV A;  2GCJ A;  4KVG B;  2YS3 A;  1W1H A;  2W2X D;  4HB2 B;  1MK7 B;  4YON A;  4DX8 A;  1AWE A;  3ZVR A;  4HB0 B;  5HE1 A;  2DYN A;  3SYX A;  3ZDT A;  1U27 A;  2KCJ A;  3VIA A;  1X1F A;  3TCA A;  1Y19 B;  4MK0 A;  4WVF B;  3DXC A;  3VOQ A;  2YS1 A;  2EJ8 A;  2J0J A;  2D9Z A;  1XD4 A;  2K2U A;  1WGU A;  5C79 A;  1Q67 A;  1FAO A;  2Y8G A;  3PEG A;  1X86 A;  1MK9 B;  4A6F B;  5J3T A;  1QC6 A;  2AL6 A;  3ULB A;  3FSS A;  2J0M A;  1FGZ A;  2BCJ A;  4HAT B;  3HW2 B;  4A6H A;  1KZ7 A;  3P6A A;  5D27 A;  2DHI A;  3CXB B;  1DDM A;  2LG1 A;  3AU5 A;  4GZU A;  4IOY X;  5KQ1 A;  2JP2 A;  1FOE A;  3F0W A;  1B55 A;  2X18 A;  4D0O A;  2EC1 A;  2DX1 A;  2D4Q A;  2ROZ B;  1GG3 A;  1LW3 A;  2D10 A;  1FB8 A;  2KR9 A;  3TO1 A;  2COC A;  1DBH A;  5C5B B;  2H7D A;  4H8S A;  2FJL A;  5DH9 B;  1EF1 A;  2KGX B;  4KHA A;  1X1G A;  4A5K A;  1P3R A;  2MKR A;  3SUZ A;  3D8E A;  5D3V A;  1NTV A;  2OTX A;  1TJ6 A;  3KRX A;  2EMT A;  3F5R A;  4F7H A;  3BJI A;  1WG7 A;  2VKI A;  5D3W A;  2I1K A;  1ZVR A;  2Y7B A;  2R0D A;  5CLQ B;  3IVF A;  3M1I B;  4EKU A;  2I5C A;  4HAY B;  5DI9 B;  5HE2 A;  1ZM0 A;  1RRP B;  2K2J A;  1H10 A;  2YT1 A;  2KUP A;  2I5F A;  2UZR A;  2Y8F A;  3JV3 A;  4P7I A;  1XOD A;  1WGQ A;  3HQC A;  1PFJ A;  2IFS A;  3SNH A;  2NMB A;  2E2X A;  1XX0 A;  2P0D A;  4C0A A;  3CIK A;  4HAU B;  1W1D A;  2QKL A;  4GMX B;  1BAK A;  2DHJ A;  3QWM A;  1X05 A;  1N3H A;  2DKQ A;  1FHX A;  2LOZ A;  3QIJ A;  4F7U P;  4K2O A;  5CLL B;  3KRW A;  4HB4 B;  5EFX A;  1BTN A;  1ZC3 B;  4WJ7 A;  3ODX A;  4CHJ A;  5L81 A;  2J59 M;  4NSW A;  2CY4 A;  3EO2 A;  4KAX B;  4Z2N A;  2DKP A;  1LB1 A;  2RLO A;  2GCL A;  2CRF A;  2UVM A;  3OAN A;  3PVL A;  1NU2 A;  1FHW A;  2DLW A;  4GOU A;  5HE3 A;  1W1G A;  3X23 A;  1U5F A;  1UEF A;  4D0N B;  3V5W A;  4EJN A;  1OMW A;  2LOX A;  5HE0 A;  1KZG A;  1U29 A;  3ULC A;  3GF9 A;  4HHV A;  4PQ0 A;  1UNQ A;  2ADZ A;  1UNR A;  2VSZ A;  3D8F A;  2P0F A;  1BTK A;  5J3Y A;  5D3Y A;  5FI1 A;  4XWX A;  1BY1 A;  2DTC A;  5DIF B;  2Z0P A;  3QBV B;  1UPQ A;  4GN1 A;  2DFK A;  1AQC A;  1M7E A;  2W2X C;  1P6S A;  3U7D A;  3PSC A;  2G35 A;  4DXA B;  2YF0 A;  2UZS A;  1BWN A;  2D2Q A;  2MWN B;  4HAX B;  1IRS A;  1DDV A;  2OQB A;  4HDO A;  3TW1 A;  1U2B A;  4B6H A;  3KY9 A;  2D9Y A;  4DX9 0;  1NTY A;  2YRY A;  5JHG A;  2HTH B;  1Z87 A;  4A6F A;  1QQG A;  4GYV A;  1H4R A;  3ODO A;  3D8D A;  2RNR B;  2Z0Q A;  3BIN A;  1EVH A;  4MY6 A;  1EAZ A;  2ROV A;  3AJ4 A;  3GYO A;  3T06 A;  2W2W A;  5KQ4 A;  4CHM A;  1UPR A;  1V5P A;  1J0W A;  4K17 A;  2D9W A;  4GMV A;  1OQN A;  3SO6 A;  3ML4 A;  1WVH A;  2ELB A;  1K5G B;  3MDB C;  1DRO A;  3A98 B;  4MT7 A;  1TQZ A;  2GS0 A;  1MAI A;  4BBK A;  1WI1 A;  2RVB B;  2CAY A;  5D3X A;  3AU4 A;  4IFS A;  2COA A;  5JLJ B;  2P8V A;  1MKE A;  5C5B A;  4GPT B;  2D9X A;  3HK0 A;  3P7Z A;  1FGY A;  2M14 A;  2Z0O A;  1P5T A;  2V76 A;  1XR0 B;  2IYB A;  2LKO A;  5J3Q A;  1WJ1 A;  1SGH A;  2GJY A;  2YSZ A;  2H7E A;  3A8Q A;  2YS5 A;  3TFM A;  4HAV B;  1SHC A;  1ZC4 B;  1ZSQ A;  2D11 A;  3PVU A;  1KI1 B;  3KZ1 A;  3DXD A;  1MPH A;  1Y5O A;  2DA0 A;  2LYD A;  2R09 A;  2COF A;  4NY0 A;  3WA0 A;  1F5X A;  1X11 A;  2RGN B;  4HB3 B;  1E5W A;  4WSF A;  1M7R A;  1U5G A;  2I1J A;  1DYN A;  2Q13 A;  2DYQ A;  3U8Z A;  2RUK B;  3PZD A;  2YVC A;  2D9V A;  4HDQ A;  2LUL A;  2ELA A;  2L1C A;  4F7G A;  1NI2 A;  4TKN A;  4YL8 A;  2DX5 A;  4CYE A;  1GC6 A;  2K00 A;  1WJM A;  1I7A A;  2L2I A;  4HAZ B;  2N23 A;  1ISN A;  4Y94 A;  4PNK A;  2MFQ A;  5JP4 A;  1UNP A;  3PVW A;  4TYZ A;  3TVV A;  3MPX A;  3KSY A;  1TXD A;  3PG7 A;  3FEH A;  2DN6 A;  4ZRI A;  2N0Y A;  1U5D A;  5JHH A;  3DXE A;  2J0K A;  2NZ8 B;  1V5M A;  2PZ1 A;  2RSG A;  4A6K A;  5DHA B;  3N7C A;  5LON B;  5LOP B;  4ZRJ A;  4L6E A;  1RJ2 A;  3G9W A;  5FI0 A;  3O96 A;  2AEH A;  2QKM A;  4DBB A;  2VRW B;  4GXB A;  3RCP A;  4EMO A;  1K5D B;  5C16 A;  3UZT A;  1XCG A;  3GYP A;  3NSU A;  1PMS A;  2COD A;  3FM8 C;  3A8P A;  4K81 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...