1X86A

Crystal structure of the dh/ph domains of leukemia-associated rhogef in complex with rhoa
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
373
structure length
362
Chain Sequence
PPNWQQLVSREVLLGLKPCEIKRQEVINELFYTERAHVRTLKVLDQVFYQRVSREGILSPSELRKIFSNLEDILQLHIGLNEQMKAVRKRNETSVIDQIGEDLLTWFSGPGEEKLKHAAATFCSNQPFALEMIKSRQKKDSRFQTFVQDAESNPLCRRLQLKDIIPTQMQRLTKYPLLLDNIAKYTEWPTEREKVKKAADHCRQILNFVNQAVKEAENKQRLEDYQRRLDTSSLKLSEYPNVEELRNLDLTKRKMIHEGPLVWKVNRDKTIDLYTLLLEDILVLLQKQDDRLVLRCHSTFSPVIKLSTVLVRQVATDNKALFVISMSDNGAQIYELVAQTVSEKTVWQDLICRMAASVKEQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Rho guanine nucleotide exchange factor 12
publication title Structural determinants of RhoA binding and nucleotide exchange in leukemia-associated Rho guanine-nucleotide exchange factor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/membrane protein
total genus 122
structure length 362
sequence length 373
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2004-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00621 RhoGEF RhoGEF domain
A PF17838 PH_16 PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.900.10 Mainly Alpha Up-down Bundle Dbl Homology Domain; Chain A Dbl homology (DH) domain 1x86A01
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1x86A02
3FM8C 3MDBC 1OQNA 3ULBA 2NZ8B 2ADZA 5KQ1A 1LB1A 1F5XA 4BBKA 3TFMA 2LYDA 1EGXA 3SV1A 1FHWA 3PVUA 2GS0A 1TJ6A 3PSCA 1DDVA 5J3YA 2I5CA 4K2PA 2DKPA 1GC7A 2MFQA 4F7UP 1UPQA 3AU4A 4WVFB 5DHAB 3EO2A 4MT7A 2VSZA 1MIXA 5GOWB 5D3YA 2RVBB 1AQCA 4F7GA 4GOUA 4HATB 1U5FA 4A5KA 1J19A 2XQNM 3WA0A 2VRWB 3ODXA 2COCA 2DHIA 2EMSA 2DHKA 2DLWA 2H7EA 3ZDTA 2LULA 3OANA 2D4QA 1P3RA 2GCLA 2CRFA 2M14A 1U2BA 3TO1A 5KCVA 1DROA 4CHMA 2ZPYA 3SYXA 1X1FA 4HAXB 3GF9A 2P0HA 3D8EA 5D3XA 2KUPA 1UNRA 4KVGB 2COFA 2EC1A 1LW3A 1WGUA 1ZM0A 1Y5OA 3X23A 2DFKA 2I1JA 3F0WA 2CAYA 2EMTA 3DXDA 4K2OA 2YS3A 2J0JA 4A6FB 2G35A 3M1IB 4HB2B 3P7ZA 5C6RA 3F5RA 3BINA 3NSUA 2J0MA 2RGNB 1IRSA 2Y7BA 3PP2A 2UZRA 4MK0A 4HB3B 4KHOA 5DH9B 4DX8A 2IYBA 1NU2A 5JHHA 4HDQA 1WJ1A 1XODA 5J3TA 1UEFA 1WVHA 1BY1A 1V89A 2DN6A 2CODA 4KAXB 5LOPB 2OTXA 2DX1A 1XD4A 4HAYB 3WYFB 4NY0A 1DDMA 1I7AA 2D9VA 4DBBA 3HK0A 2MKRA 3RCPA 3D8FA 1OMWA 3SUZA 5KQ4A 2LOZA 5JHGA 2YVCA 5C5BA 1MAIA 4NSWA 2P8VA 2UVMA 1V5UA 1X11A 2H7DA 2PZ1A 1Q67A 4TYZA 1MK9B 5LONB 1X05A 2LKOA 5HE0A 1ISNA 1H4RA 1DDWA 2N0YA 4IFSA 5DI9B 1BTNA 2DA0A 4D0NB 1U27A 4TKNA 3D8DA 1FHXA 2DYQA 2YF0A 2RNRB 4Z2NA 5DHFB 1WGQA 1UPRA 2DX5A 2QKLA 4HB4B 5JP4A 1H10A 4ZRIA 2J59M 5FI0A 1UNQA 4HAWB 3PEGA 1U29A 1XR0B 2Z0PA 2JP2A 2D9YA 1EF1A 1FGZA 1AWEA 4HAZB 2YRYA 3SNHA 1XX0A 3T06A 1PLSA 2HE7A 1E5WA 1MKEA 3KZ1A 2KCJA 4H8SA 2DTCA 2D9WA 2MDXA 1QC6A 4GPTB 3CIKA 3MPXA 1M7EA 2VKIA 4P7IA 1ZVRA 1GC6A 4HAUB 4DX90 3VOQA 1KZGA 3PVWA 2ROVA 3TW1A 5HE3A 1KI1B 1QQGA 4ZRJA 1XCGA 2Q13A 2D10A 4ZRKA 4GN1A 5D27A 4HDOA 5FI1A 4A6FA 2D9XA 4A6KA 3FSSA 2LOXA 4EKUA 3ODWA 2V76A 3PG7A 2Z0QA 1BTKA 2NMBA 2YSZA 1DYNA 2D2QA 1BWNA 1BAKA 1GG3A 1OY2A 3TVVA 3BJIA 1XKEA 3PVLA 3AJ4A 2QKMA 2GCJA 4PQ0A 4KHAA 1X1GA 3U8ZA 1Z87A 2DKQA 2LG1A 4L6EA 3TCAA 1P6SA 2M38A 1Y19B 1SGHA 2AL6A 4DXAB 1U5DA 2R0DA 3QBVB 3PZDA 3GYOA 1WI1A 2KGXB 3ODOA 1FGYA 1TQZA 1P5TA 3CXBB 3DXCA 1U5EA 1W1DA 3IVFA 3KRWA 1V88A 5C79A 4F7HA 1DBHA 1FB8A 3ML4A 5D3VA 1X86A 2I5FA 3JV3A 1FAOA 1ZSQA 2AEHA 1WG7A 3V5WA 3KY9A 4GMVA 2Z0OA 1TXDA 4HAVB 4XWXA 2BCJA 1MPHA 2L1CA 4D0OA 3GYPA 1EAZA 3A98B 1UNPA 3UZTA 4K81A 4EMOA 2J0KA 1NI2A 2W2WA 4YL8A 2ELBA 4HHVA 2RSGA 2OQBA 1PFJA 3HW2B 2X18A 4GMXB 2D9ZA 2K2JA 5CLLB 5C16A 3FEHA 1K5DB 4K17A 1V5PA 5JLJB 2KR9A 3AU5A 1FOEA 2YT1A 5HE1A 2YS1A 3ZVRA 1V61A 2Y8GA 1RJ2A 1EVHA 1KZ7A 2L2IA 4YONA 2ROZB 4MY6A 3G9WA 1FHOA 2DYNA 3KRXA 5DIFB 4CHJA 2I1KA 1J0WA 2RLOA 1MK7B 2CY5A 3O96A 4C0AA 3QWMA 2R09A 2IFSA 3ULCA 3DXEA 4IAPA 3A8PA 2CY4A 4EJNA 2DHJA 4WSFA 4WJ7A 3VIAA 4Z2MB 2N23A 1RRPB 5CLQB 4GZUA 4GXBA 5EFXA 2K00A 1PMSA 4CYEA 2GJYA 1NTYA 2W2XD 1WJMA 1B55A 1MIZB 1W1HA 3U7DA 1U5GA 3HQCA 4PNKA 4HB0B 2E2XA 2YT0A 3N7CA 5HE2A 2FJLA 1ZC3B 2K2UA 1M7RA 2MWNB 5D3WA 1K5GB 2W2XC 2EJ8A 1ZC4B 5J3QA 4KHBB 3P6AA 2RUKB 4A6HA 2COAA 2ELAA 3LJUX 1I2HA 2P0FA 2YS5A 1SHCA 1N3HA 2D11A 2HTHB 3A8QA 3KSYA 2Y8FA 2P0DA 4B6HA 1W1GA 4Y94A 2UZSA 3SO6A 4IOYX 3QIJA 1NTVA 5C5BB 5L81A 1V5MA 4GYVA
chains in the Genus database with same CATH superfamily
3FM8C 3MDBC 1OQNA 3ULBA 2NZ8B 2ADZA 5KQ1A 1LB1A 1F5XA 4BBKA 3TFMA 2LYDA 2Z14A 5M4YB 1EGXA 3SV1A 1FHWA 3PVUA 2GS0A 1TJ6A 3PSCA 4DIXA 1DDVA 5J3YA 2I5CA 4K2PA 2DKPA 1GC7A 2MFQA 4F7UP 1UPQA 3AU4A 4WVFB 5DHAB 3EO2A 4MT7A 2VSZA 1MIXA 5GOWB 5D3YA 2RVBB 1AQCA 4F7GA 4GOUA 4HATB 1U5FA 4A5KA 1J19A 2XQNM 3WA0A 2VRWB 3ODXA 2COCA 2DHIA 2EMSA 2DHKA 2DLWA 2H7EA 3ZDTA 2LULA 3OANA 2D4QA 1P3RA 2GCLA 2CRFA 2M14A 1U2BA 3TO1A 5KCVA 1DROA 4CHMA 1T77A 2ZPYA 3SYXA 1X1FA 4HAXB 3GF9A 2P0HA 3D8EA 5D3XA 2KUPA 1UNRA 4KVGB 2COFA 2EC1A 1MI1A 1LW3A 1WGUA 1ZM0A 1Y5OA 3X23A 2DFKA 2I1JA 3U12A 3F0WA 2CAYA 2EMTA 3FVCA 3DXDA 4K2OA 2YS3A 2J0JA 4A6FB 2G35A 3M1IB 4HB2B 3P7ZA 5C6RA 3F5RA 3BINA 3NSUA 2J0MA 2YT2A 2RGNB 1IRSA 2Y7BA 2Z13A 3PP2A 2UZRA 4MK0A 4HB3B 4KHOA 5DH9B 4DX8A 2IYBA 1NU2A 5JHHA 4HDQA 1WJ1A 1XODA 5J3TA 1UEFA 1WVHA 1BY1A 1V89A 2DN6A 2CODA 4KAXB 5LOPB 2OTXA 4QXAB 2DX1A 1XD4A 4HAYB 3WYFB 4NY0A 3DCXA 1I7AA 1DDMA 2D9VA 4DBBA 3HK0A 2MKRA 4HSIA 3RCPA 3D8FA 1OMWA 5I2SA 3SUZA 5KQ4A 2LOZA 5JHGA 2YVCA 4QJ4B 5C5BA 1MAIA 4NSWA 2P8VA 2UVMA 1V5UA 1X11A 1ZYIA 2H7DA 2PZ1A 1Q67A 4TYZA 1MK9B 5LONB 1X05A 2K49A 2LKOA 5HE0A 1ISNA 1H4RA 1DDWA 2N0YA 4IFSA 5DI9B 1BTNA 2DA0A 3HSAA 4D0NB 1U27A 4TKNA 3D8DA 1FHXA 2DYQA 2YF0A 2RNRB 4Z2NA 5I2MA 5DHFB 1WGQA 1UPRA 2DX5A 2QKLA 4HB4B 5JP4A 1H10A 4ZRIA 2J59M 5FI0A 1UNQA 4HAWB 3PEGA 1U29A 1XR0B 2Z0PA 2JP2A 4D6WA 2D9YA 1EF1A 1FGZA 3NWAA 1AWEA 4HAZB 2YRYA 3SNHA 1XX0A 3T06A 1PLSA 2HE7A 2KR0A 1E5WA 1MKEA 3KZ1A 2KCJA 4H8SA 2DTCA 2D9WA 2MDXA 1QC6A 4GPTB 3CIKA 3MPXA 1M7EA 4OT1A 2VKIA 4P7IA 1ZVRA 1GC6A 4HAUB 4DX90 3VOQA 1KZGA 3PVWA 2ROVA 3TW1A 5HE3A 1KI1B 3NWDA 1QQGA 4ZRJA 1XCGA 2Q13A 2D10A 4ZRKA 4GN1A 2KUQA 4HDOA 5D27A 5FI1A 4A6FA 2D9XA 4A6KA 3FSSA 2LOXA 4EKUA 3OHMB 3ODWA 2V76A 3PG7A 2Z0QA 1BTKA 2NMBA 2YSZA 1DYNA 2D2QA 1BWNA 1BAKA 1GG3A 1OY2A 3TVVA 3BJIA 1XKEA 3PVLA 3AJ4A 2QKMA 2GCJA 4PQ0A 4KHAA 1X1GA 3U8ZA 1Z87A 2DKQA 3HIEA 2GUMA 2LG1A 4L6EA 3TCAA 1P6SA 4QJ5B 3A58A 2M38A 1Y19B 3NWFA 1SGHA 2AL6A 4DXAB 1U5DA 2R0DA 3QBVB 3PZDA 2FJUB 2K8EA 3GYOA 1WI1A 2KGXB 3ODOA 1FGYA 1TQZA 1P5TA 3CXBB 3DXCA 1U5EA 1W1DA 3IVFA 3KRWA 1V88A 5C79A 4F7HA 1DBHA 1FB8A 2KIGA 3ML4A 5D3VA 1X86A 2I5FA 3JV3A 1FAOA 1ZSQA 2AEHA 1WG7A 3V5WA 3KY9A 4GMVA 2Z0OA 2Z59A 4GNKB 2KIEA 1TXDA 4HAVB 4XWXA 2ZKMX 2BCJA 1MPHA 2L1CA 4OSNA 4D0OA 3GYPA 1EAZA 3A98B 1UNPA 3UZTA 4K81A 4EMOA 2J0KA 1NI2A 2W2WA 4YL8A 2ELBA 4HHVA 4QJ3B 2RSGA 2OQBA 1PFJA 3HW2B 2X18A 4GMXB 2D9ZA 2K2JA 4CSQA 5CLLB 5IRSA 3B77A 5C16A 3FEHA 1K5DB 4K17A 1V5PA 2NBVA 5JLJB 2KR9A 3AU5A 1FOEA 2YT1A 4L1RA 5HE1A 2YS1A 3ZVRA 2RRFA 1V61A 2Y8GA 2Z4DA 1RJ2A 1EVHA 1KZ7A 2L2IA 4YONA 2ROZB 4MY6A 3G9WA 1FHOA 2DYNA 3KRXA 5DIFB 4CHJA 2I1KA 1J0WA 2RLOA 1MK7B 2CY5A 3O96A 4C0AA 3QWMA 2R09A 2IFSA 3ULCA 3DXEA 4IAPA 3A8PA 2CY4A 4EJNA 2DHJA 4WSFA 4WJ7A 3VIAA 4Z2MB 2N23A 1RRPB 5CLQB 4GZUA 4GXBA 5EFXA 2K00A 1PMSA 4CYEA 2GJYA 5LG4B 1NTYA 2W2XD 1WJMA 1B55A 1MIZB 1W1HA 3U7DA 1U5GA 3HQCA 4PNKA 4HB0B 2E2XA 3NW8A 2YT0A 2R2YA 3N7CA 5HE2A 2FJLA 1ZC3B 2K2UA 1M7RA 2MWNB 5D3WA 1K5GB 2W2XC 2EJ8A 1ZC4B 5J3QA 4KHBB 3P6AA 2RUKB 4A6HA 2COAA 2ELAA 3LJUX 1I2HA 2P0FA 2YS5A 1SHCA 1N3HA 2D11A 4KHBA 2HTHB 3A8QA 3KSYA 2Y8FA 2P0DA 4B6HA 1W1GA 4Y94A 2UZSA 3SO6A 4IOYX 3QIJA 1NTVA 5C5BB 5L81A 1V5MA 4GYVA
chains in the Genus database with same CATH topology
3FM8C 3MDBC 1OQNA 3ULBA 2NZ8B 2ADZA 5KQ1A 1LB1A 1F5XA 4BBKA 3TFMA 2LYDA 1EGXA 3SV1A 1FHWA 3PVUA 2GS0A 1TJ6A 3PSCA 1DDVA 5J3YA 2I5CA 4K2PA 2DKPA 1GC7A 2MFQA 4F7UP 1UPQA 3AU4A 4WVFB 5DHAB 3EO2A 4MT7A 2VSZA 1MIXA 5GOWB 5D3YA 2RVBB 1AQCA 4F7GA 4GOUA 4HATB 1U5FA 4A5KA 1J19A 2XQNM 3WA0A 2VRWB 3ODXA 2COCA 2DHIA 2EMSA 2DHKA 2DLWA 2H7EA 3ZDTA 2LULA 3OANA 2D4QA 1P3RA 2GCLA 2CRFA 2M14A 1U2BA 3TO1A 5KCVA 1DROA 4CHMA 2ZPYA 3SYXA 1X1FA 4HAXB 3GF9A 2P0HA 3D8EA 5D3XA 2KUPA 1UNRA 4KVGB 2COFA 2EC1A 1LW3A 1WGUA 1ZM0A 1Y5OA 3X23A 2DFKA 2I1JA 3F0WA 2CAYA 2EMTA 3DXDA 4K2OA 2YS3A 2J0JA 4A6FB 2G35A 3M1IB 4HB2B 3P7ZA 5C6RA 3F5RA 3BINA 3NSUA 2J0MA 2RGNB 1IRSA 2Y7BA 3PP2A 2UZRA 4MK0A 4HB3B 4KHOA 5DH9B 4DX8A 2IYBA 1NU2A 5JHHA 4HDQA 1WJ1A 1XODA 5J3TA 1UEFA 1WVHA 1BY1A 1V89A 2DN6A 2CODA 4KAXB 5LOPB 2OTXA 2DX1A 1XD4A 4HAYB 3WYFB 4NY0A 1DDMA 1I7AA 2D9VA 4DBBA 3HK0A 2MKRA 3RCPA 3D8FA 1OMWA 3SUZA 5KQ4A 2LOZA 5JHGA 2YVCA 5C5BA 1MAIA 4NSWA 2P8VA 2UVMA 1V5UA 1X11A 2H7DA 2PZ1A 1Q67A 4TYZA 1MK9B 5LONB 1X05A 2LKOA 5HE0A 1ISNA 1H4RA 1DDWA 2N0YA 4IFSA 5DI9B 1BTNA 2DA0A 4D0NB 1U27A 4TKNA 3D8DA 1FHXA 2DYQA 2YF0A 2RNRB 4Z2NA 5DHFB 1WGQA 1UPRA 2DX5A 2QKLA 4HB4B 5JP4A 1H10A 4ZRIA 2J59M 5FI0A 1UNQA 4HAWB 3PEGA 1U29A 1XR0B 2Z0PA 2JP2A 2D9YA 1EF1A 1FGZA 1AWEA 4HAZB 2YRYA 3SNHA 1XX0A 3T06A 1PLSA 2HE7A 1E5WA 1MKEA 3KZ1A 2KCJA 4H8SA 2DTCA 2D9WA 2MDXA 1QC6A 4GPTB 3CIKA 3MPXA 1M7EA 2VKIA 4P7IA 1ZVRA 1GC6A 4HAUB 4DX90 3VOQA 1KZGA 3PVWA 2ROVA 3TW1A 5HE3A 1KI1B 1QQGA 4ZRJA 1XCGA 2Q13A 2D10A 4ZRKA 4GN1A 5D27A 4HDOA 5FI1A 4A6FA 2D9XA 4A6KA 3FSSA 2LOXA 4EKUA 3ODWA 2V76A 3PG7A 2Z0QA 1BTKA 2NMBA 2YSZA 1DYNA 2D2QA 1BWNA 1BAKA 1GG3A 1OY2A 3TVVA 3BJIA 1XKEA 3PVLA 3AJ4A 2QKMA 2GCJA 4PQ0A 4KHAA 1X1GA 3U8ZA 1Z87A 2DKQA 2LG1A 4L6EA 3TCAA 1P6SA 2M38A 1Y19B 1SGHA 2AL6A 4DXAB 1U5DA 2R0DA 3QBVB 3PZDA 3GYOA 1WI1A 2KGXB 3ODOA 1FGYA 1TQZA 1P5TA 3CXBB 3DXCA 1U5EA 1W1DA 3IVFA 3KRWA 1V88A 5C79A 4F7HA 1DBHA 1FB8A 3ML4A 5D3VA 1X86A 2I5FA 3JV3A 1FAOA 1ZSQA 2AEHA 1WG7A 3V5WA 3KY9A 4GMVA 2Z0OA 1TXDA 4HAVB 4XWXA 2BCJA 1MPHA 2L1CA 4D0OA 3GYPA 1EAZA 3A98B 1UNPA 3UZTA 4K81A 4EMOA 2J0KA 1NI2A 2W2WA 4YL8A 2ELBA 4HHVA 2RSGA 2OQBA 1PFJA 3HW2B 2X18A 4GMXB 2D9ZA 2K2JA 5CLLB 5C16A 3FEHA 1K5DB 4K17A 1V5PA 5JLJB 2KR9A 3AU5A 1FOEA 2YT1A 5HE1A 2YS1A 3ZVRA 1V61A 2Y8GA 1RJ2A 1EVHA 1KZ7A 2L2IA 4YONA 2ROZB 4MY6A 3G9WA 1FHOA 2DYNA 3KRXA 5DIFB 4CHJA 2I1KA 1J0WA 2RLOA 1MK7B 2CY5A 3O96A 4C0AA 3QWMA 2R09A 2IFSA 3ULCA 3DXEA 4IAPA 3A8PA 2CY4A 4EJNA 2DHJA 4WSFA 4WJ7A 3VIAA 4Z2MB 2N23A 1RRPB 5CLQB 4GZUA 4GXBA 5EFXA 2K00A 1PMSA 4CYEA 2GJYA 1NTYA 2W2XD 1WJMA 1B55A 1MIZB 1W1HA 3U7DA 1U5GA 3HQCA 4PNKA 4HB0B 2E2XA 2YT0A 3N7CA 5HE2A 2FJLA 1ZC3B 2K2UA 1M7RA 2MWNB 5D3WA 1K5GB 2W2XC 2EJ8A 1ZC4B 5J3QA 4KHBB 3P6AA 2RUKB 4A6HA 2COAA 2ELAA 3LJUX 1I2HA 2P0FA 2YS5A 1SHCA 1N3HA 2D11A 2HTHB 3A8QA 3KSYA 2Y8FA 2P0DA 4B6HA 1W1GA 4Y94A 2UZSA 3SO6A 4IOYX 3QIJA 1NTVA 5C5BB 5L81A 1V5MA 4GYVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FM8 C;  3MDB C;  1OQN A;  3ULB A;  2NZ8 B;  2ADZ A;  5KQ1 A;  1LB1 A;  1F5X A;  4BBK A;  3TFM A;  2LYD A;  1EGX A;  3SV1 A;  1FHW A;  3PVU A;  2GS0 A;  1TJ6 A;  3PSC A;  1DDV A;  5J3Y A;  2I5C A;  4K2P A;  2DKP A;  1GC7 A;  2MFQ A;  4F7U P;  1UPQ A;  3AU4 A;  4WVF B;  5DHA B;  3EO2 A;  4MT7 A;  2VSZ A;  1MIX A;  5GOW B;  5D3Y A;  2RVB B;  1AQC A;  4F7G A;  4GOU A;  4HAT B;  1U5F A;  4A5K A;  1J19 A;  2XQN M;  3WA0 A;  2VRW B;  3ODX A;  2COC A;  2DHI A;  2EMS A;  2DHK A;  2DLW A;  2H7E A;  3ZDT A;  2LUL A;  3OAN A;  2D4Q A;  1P3R A;  2GCL A;  2CRF A;  2M14 A;  1U2B A;  3TO1 A;  5KCV A;  1DRO A;  4CHM A;  2ZPY A;  3SYX A;  1X1F A;  4HAX B;  3GF9 A;  2P0H A;  3D8E A;  5D3X A;  2KUP A;  1UNR A;  4KVG B;  2COF A;  2EC1 A;  1LW3 A;  1WGU A;  1ZM0 A;  1Y5O A;  3X23 A;  2DFK A;  2I1J A;  3F0W A;  2CAY A;  2EMT A;  3DXD A;  4K2O A;  2YS3 A;  2J0J A;  4A6F B;  2G35 A;  3M1I B;  4HB2 B;  3P7Z A;  5C6R A;  3F5R A;  3BIN A;  3NSU A;  2J0M A;  2RGN B;  1IRS A;  2Y7B A;  3PP2 A;  2UZR A;  4MK0 A;  4HB3 B;  4KHO A;  5DH9 B;  4DX8 A;  2IYB A;  1NU2 A;  5JHH A;  4HDQ A;  1WJ1 A;  1XOD A;  5J3T A;  1UEF A;  1WVH A;  1BY1 A;  1V89 A;  2DN6 A;  2COD A;  4KAX B;  5LOP B;  2OTX A;  2DX1 A;  1XD4 A;  4HAY B;  3WYF B;  4NY0 A;  1DDM A;  1I7A A;  2D9V A;  4DBB A;  3HK0 A;  2MKR A;  3RCP A;  3D8F A;  1OMW A;  3SUZ A;  5KQ4 A;  2LOZ A;  5JHG A;  2YVC A;  5C5B A;  1MAI A;  4NSW A;  2P8V A;  2UVM A;  1V5U A;  1X11 A;  2H7D A;  2PZ1 A;  1Q67 A;  4TYZ A;  1MK9 B;  5LON B;  1X05 A;  2LKO A;  5HE0 A;  1ISN A;  1H4R A;  1DDW A;  2N0Y A;  4IFS A;  5DI9 B;  1BTN A;  2DA0 A;  4D0N B;  1U27 A;  4TKN A;  3D8D A;  1FHX A;  2DYQ A;  2YF0 A;  2RNR B;  4Z2N A;  5DHF B;  1WGQ A;  1UPR A;  2DX5 A;  2QKL A;  4HB4 B;  5JP4 A;  1H10 A;  4ZRI A;  2J59 M;  5FI0 A;  1UNQ A;  4HAW B;  3PEG A;  1U29 A;  1XR0 B;  2Z0P A;  2JP2 A;  2D9Y A;  1EF1 A;  1FGZ A;  1AWE A;  4HAZ B;  2YRY A;  3SNH A;  1XX0 A;  3T06 A;  1PLS A;  2HE7 A;  1E5W A;  1MKE A;  3KZ1 A;  2KCJ A;  4H8S A;  2DTC A;  2D9W A;  2MDX A;  1QC6 A;  4GPT B;  3CIK A;  3MPX A;  1M7E A;  2VKI A;  4P7I A;  1ZVR A;  1GC6 A;  4HAU B;  4DX9 0;  3VOQ A;  1KZG A;  3PVW A;  2ROV A;  3TW1 A;  5HE3 A;  1KI1 B;  1QQG A;  4ZRJ A;  1XCG A;  2Q13 A;  2D10 A;  4ZRK A;  4GN1 A;  5D27 A;  4HDO A;  5FI1 A;  4A6F A;  2D9X A;  4A6K A;  3FSS A;  2LOX A;  4EKU A;  3ODW A;  2V76 A;  3PG7 A;  2Z0Q A;  1BTK A;  2NMB A;  2YSZ A;  1DYN A;  2D2Q A;  1BWN A;  1BAK A;  1GG3 A;  1OY2 A;  3TVV A;  3BJI A;  1XKE A;  3PVL A;  3AJ4 A;  2QKM A;  2GCJ A;  4PQ0 A;  4KHA A;  1X1G A;  3U8Z A;  1Z87 A;  2DKQ A;  2LG1 A;  4L6E A;  3TCA A;  1P6S A;  2M38 A;  1Y19 B;  1SGH A;  2AL6 A;  4DXA B;  1U5D A;  2R0D A;  3QBV B;  3PZD A;  3GYO A;  1WI1 A;  2KGX B;  3ODO A;  1FGY A;  1TQZ A;  1P5T A;  3CXB B;  3DXC A;  1U5E A;  1W1D A;  3IVF A;  3KRW A;  1V88 A;  5C79 A;  4F7H A;  1DBH A;  1FB8 A;  3ML4 A;  5D3V A;  1X86 A;  2I5F A;  3JV3 A;  1FAO A;  1ZSQ A;  2AEH A;  1WG7 A;  3V5W A;  3KY9 A;  4GMV A;  2Z0O A;  1TXD A;  4HAV B;  4XWX A;  2BCJ A;  1MPH A;  2L1C A;  4D0O A;  3GYP A;  1EAZ A;  3A98 B;  1UNP A;  3UZT A;  4K81 A;  4EMO A;  2J0K A;  1NI2 A;  2W2W A;  4YL8 A;  2ELB A;  4HHV A;  2RSG A;  2OQB A;  1PFJ A;  3HW2 B;  2X18 A;  4GMX B;  2D9Z A;  2K2J A;  5CLL B;  5C16 A;  3FEH A;  1K5D B;  4K17 A;  1V5P A;  5JLJ B;  2KR9 A;  3AU5 A;  1FOE A;  2YT1 A;  5HE1 A;  2YS1 A;  3ZVR A;  1V61 A;  2Y8G A;  1RJ2 A;  1EVH A;  1KZ7 A;  2L2I A;  4YON A;  2ROZ B;  4MY6 A;  3G9W A;  1FHO A;  2DYN A;  3KRX A;  5DIF B;  4CHJ A;  2I1K A;  1J0W A;  2RLO A;  1MK7 B;  2CY5 A;  3O96 A;  4C0A A;  3QWM A;  2R09 A;  2IFS A;  3ULC A;  3DXE A;  4IAP A;  3A8P A;  2CY4 A;  4EJN A;  2DHJ A;  4WSF A;  4WJ7 A;  3VIA A;  4Z2M B;  2N23 A;  1RRP B;  5CLQ B;  4GZU A;  4GXB A;  5EFX A;  2K00 A;  1PMS A;  4CYE A;  2GJY A;  1NTY A;  2W2X D;  1WJM A;  1B55 A;  1MIZ B;  1W1H A;  3U7D A;  1U5G A;  3HQC A;  4PNK A;  4HB0 B;  2E2X A;  2YT0 A;  3N7C A;  5HE2 A;  2FJL A;  1ZC3 B;  2K2U A;  1M7R A;  2MWN B;  5D3W A;  1K5G B;  2W2X C;  2EJ8 A;  1ZC4 B;  5J3Q A;  4KHB B;  3P6A A;  2RUK B;  4A6H A;  2COA A;  2ELA A;  3LJU X;  1I2H A;  2P0F A;  2YS5 A;  1SHC A;  1N3H A;  2D11 A;  2HTH B;  3A8Q A;  3KSY A;  2Y8F A;  2P0D A;  4B6H A;  1W1G A;  4Y94 A;  2UZS A;  3SO6 A;  4IOY X;  3QIJ A;  1NTV A;  5C5B B;  5L81 A;  1V5M A;  4GYV A; 
#chains in the Genus database with same CATH topology
 3FM8 C;  3MDB C;  1OQN A;  3ULB A;  2NZ8 B;  2ADZ A;  5KQ1 A;  1LB1 A;  1F5X A;  4BBK A;  3TFM A;  2LYD A;  2Z14 A;  5M4Y B;  1EGX A;  3SV1 A;  1FHW A;  3PVU A;  2GS0 A;  1TJ6 A;  3PSC A;  4DIX A;  1DDV A;  5J3Y A;  2I5C A;  4K2P A;  2DKP A;  1GC7 A;  2MFQ A;  4F7U P;  1UPQ A;  3AU4 A;  4WVF B;  5DHA B;  3EO2 A;  4MT7 A;  2VSZ A;  1MIX A;  5GOW B;  5D3Y A;  2RVB B;  1AQC A;  4F7G A;  4GOU A;  4HAT B;  1U5F A;  4A5K A;  1J19 A;  2XQN M;  3WA0 A;  2VRW B;  3ODX A;  2COC A;  2DHI A;  2EMS A;  2DHK A;  2DLW A;  2H7E A;  3ZDT A;  2LUL A;  3OAN A;  2D4Q A;  1P3R A;  2GCL A;  2CRF A;  2M14 A;  1U2B A;  3TO1 A;  5KCV A;  1DRO A;  4CHM A;  1T77 A;  2ZPY A;  3SYX A;  1X1F A;  4HAX B;  3GF9 A;  2P0H A;  3D8E A;  5D3X A;  2KUP A;  1UNR A;  4KVG B;  2COF A;  2EC1 A;  1MI1 A;  1LW3 A;  1WGU A;  1ZM0 A;  1Y5O A;  3X23 A;  2DFK A;  2I1J A;  3U12 A;  3F0W A;  2CAY A;  2EMT A;  3FVC A;  3DXD A;  4K2O A;  2YS3 A;  2J0J A;  4A6F B;  2G35 A;  3M1I B;  4HB2 B;  3P7Z A;  5C6R A;  3F5R A;  3BIN A;  3NSU A;  2J0M A;  2YT2 A;  2RGN B;  1IRS A;  2Y7B A;  2Z13 A;  3PP2 A;  2UZR A;  4MK0 A;  4HB3 B;  4KHO A;  5DH9 B;  4DX8 A;  2IYB A;  1NU2 A;  5JHH A;  4HDQ A;  1WJ1 A;  1XOD A;  5J3T A;  1UEF A;  1WVH A;  1BY1 A;  1V89 A;  2DN6 A;  2COD A;  4KAX B;  5LOP B;  2OTX A;  4QXA B;  2DX1 A;  1XD4 A;  4HAY B;  3WYF B;  4NY0 A;  3DCX A;  1I7A A;  1DDM A;  2D9V A;  4DBB A;  3HK0 A;  2MKR A;  4HSI A;  3RCP A;  3D8F A;  1OMW A;  5I2S A;  3SUZ A;  5KQ4 A;  2LOZ A;  5JHG A;  2YVC A;  4QJ4 B;  5C5B A;  1MAI A;  4NSW A;  2P8V A;  2UVM A;  1V5U A;  1X11 A;  1ZYI A;  2H7D A;  2PZ1 A;  1Q67 A;  4TYZ A;  1MK9 B;  5LON B;  1X05 A;  2K49 A;  2LKO A;  5HE0 A;  1ISN A;  1H4R A;  1DDW A;  2N0Y A;  4IFS A;  5DI9 B;  1BTN A;  2DA0 A;  3HSA A;  4D0N B;  1U27 A;  4TKN A;  3D8D A;  1FHX A;  2DYQ A;  2YF0 A;  2RNR B;  4Z2N A;  5I2M A;  5DHF B;  1WGQ A;  1UPR A;  2DX5 A;  2QKL A;  4HB4 B;  5JP4 A;  1H10 A;  4ZRI A;  2J59 M;  5FI0 A;  1UNQ A;  4HAW B;  3PEG A;  1U29 A;  1XR0 B;  2Z0P A;  2JP2 A;  4D6W A;  2D9Y A;  1EF1 A;  1FGZ A;  3NWA A;  1AWE A;  4HAZ B;  2YRY A;  3SNH A;  1XX0 A;  3T06 A;  1PLS A;  2HE7 A;  2KR0 A;  1E5W A;  1MKE A;  3KZ1 A;  2KCJ A;  4H8S A;  2DTC A;  2D9W A;  2MDX A;  1QC6 A;  4GPT B;  3CIK A;  3MPX A;  1M7E A;  4OT1 A;  2VKI A;  4P7I A;  1ZVR A;  1GC6 A;  4HAU B;  4DX9 0;  3VOQ A;  1KZG A;  3PVW A;  2ROV A;  3TW1 A;  5HE3 A;  1KI1 B;  3NWD A;  1QQG A;  4ZRJ A;  1XCG A;  2Q13 A;  2D10 A;  4ZRK A;  4GN1 A;  2KUQ A;  4HDO A;  5D27 A;  5FI1 A;  4A6F A;  2D9X A;  4A6K A;  3FSS A;  2LOX A;  4EKU A;  3OHM B;  3ODW A;  2V76 A;  3PG7 A;  2Z0Q A;  1BTK A;  2NMB A;  2YSZ A;  1DYN A;  2D2Q A;  1BWN A;  1BAK A;  1GG3 A;  1OY2 A;  3TVV A;  3BJI A;  1XKE A;  3PVL A;  3AJ4 A;  2QKM A;  2GCJ A;  4PQ0 A;  4KHA A;  1X1G A;  3U8Z A;  1Z87 A;  2DKQ A;  3HIE A;  2GUM A;  2LG1 A;  4L6E A;  3TCA A;  1P6S A;  4QJ5 B;  3A58 A;  2M38 A;  1Y19 B;  3NWF A;  1SGH A;  2AL6 A;  4DXA B;  1U5D A;  2R0D A;  3QBV B;  3PZD A;  2FJU B;  2K8E A;  3GYO A;  1WI1 A;  2KGX B;  3ODO A;  1FGY A;  1TQZ A;  1P5T A;  3CXB B;  3DXC A;  1U5E A;  1W1D A;  3IVF A;  3KRW A;  1V88 A;  5C79 A;  4F7H A;  1DBH A;  1FB8 A;  2KIG A;  3ML4 A;  5D3V A;  1X86 A;  2I5F A;  3JV3 A;  1FAO A;  1ZSQ A;  2AEH A;  1WG7 A;  3V5W A;  3KY9 A;  4GMV A;  2Z0O A;  2Z59 A;  4GNK B;  2KIE A;  1TXD A;  4HAV B;  4XWX A;  2ZKM X;  2BCJ A;  1MPH A;  2L1C A;  4OSN A;  4D0O A;  3GYP A;  1EAZ A;  3A98 B;  1UNP A;  3UZT A;  4K81 A;  4EMO A;  2J0K A;  1NI2 A;  2W2W A;  4YL8 A;  2ELB A;  4HHV A;  4QJ3 B;  2RSG A;  2OQB A;  1PFJ A;  3HW2 B;  2X18 A;  4GMX B;  2D9Z A;  2K2J A;  4CSQ A;  5CLL B;  5IRS A;  3B77 A;  5C16 A;  3FEH A;  1K5D B;  4K17 A;  1V5P A;  2NBV A;  5JLJ B;  2KR9 A;  3AU5 A;  1FOE A;  2YT1 A;  4L1R A;  5HE1 A;  2YS1 A;  3ZVR A;  2RRF A;  1V61 A;  2Y8G A;  2Z4D A;  1RJ2 A;  1EVH A;  1KZ7 A;  2L2I A;  4YON A;  2ROZ B;  4MY6 A;  3G9W A;  1FHO A;  2DYN A;  3KRX A;  5DIF B;  4CHJ A;  2I1K A;  1J0W A;  2RLO A;  1MK7 B;  2CY5 A;  3O96 A;  4C0A A;  3QWM A;  2R09 A;  2IFS A;  3ULC A;  3DXE A;  4IAP A;  3A8P A;  2CY4 A;  4EJN A;  2DHJ A;  4WSF A;  4WJ7 A;  3VIA A;  4Z2M B;  2N23 A;  1RRP B;  5CLQ B;  4GZU A;  4GXB A;  5EFX A;  2K00 A;  1PMS A;  4CYE A;  2GJY A;  5LG4 B;  1NTY A;  2W2X D;  1WJM A;  1B55 A;  1MIZ B;  1W1H A;  3U7D A;  1U5G A;  3HQC A;  4PNK A;  4HB0 B;  2E2X A;  3NW8 A;  2YT0 A;  2R2Y A;  3N7C A;  5HE2 A;  2FJL A;  1ZC3 B;  2K2U A;  1M7R A;  2MWN B;  5D3W A;  1K5G B;  2W2X C;  2EJ8 A;  1ZC4 B;  5J3Q A;  4KHB B;  3P6A A;  2RUK B;  4A6H A;  2COA A;  2ELA A;  3LJU X;  1I2H A;  2P0F A;  2YS5 A;  1SHC A;  1N3H A;  2D11 A;  4KHB A;  2HTH B;  3A8Q A;  3KSY A;  2Y8F A;  2P0D A;  4B6H A;  1W1G A;  4Y94 A;  2UZS A;  3SO6 A;  4IOY X;  3QIJ A;  1NTV A;  5C5B B;  5L81 A;  1V5M A;  4GYV A; 
#chains in the Genus database with same CATH homology
 3FM8 C;  3MDB C;  1OQN A;  3ULB A;  2NZ8 B;  2ADZ A;  5KQ1 A;  1LB1 A;  1F5X A;  4BBK A;  3TFM A;  2LYD A;  1EGX A;  3SV1 A;  1FHW A;  3PVU A;  2GS0 A;  1TJ6 A;  3PSC A;  1DDV A;  5J3Y A;  2I5C A;  4K2P A;  2DKP A;  1GC7 A;  2MFQ A;  4F7U P;  1UPQ A;  3AU4 A;  4WVF B;  5DHA B;  3EO2 A;  4MT7 A;  2VSZ A;  1MIX A;  5GOW B;  5D3Y A;  2RVB B;  1AQC A;  4F7G A;  4GOU A;  4HAT B;  1U5F A;  4A5K A;  1J19 A;  2XQN M;  3WA0 A;  2VRW B;  3ODX A;  2COC A;  2DHI A;  2EMS A;  2DHK A;  2DLW A;  2H7E A;  3ZDT A;  2LUL A;  3OAN A;  2D4Q A;  1P3R A;  2GCL A;  2CRF A;  2M14 A;  1U2B A;  3TO1 A;  5KCV A;  1DRO A;  4CHM A;  2ZPY A;  3SYX A;  1X1F A;  4HAX B;  3GF9 A;  2P0H A;  3D8E A;  5D3X A;  2KUP A;  1UNR A;  4KVG B;  2COF A;  2EC1 A;  1LW3 A;  1WGU A;  1ZM0 A;  1Y5O A;  3X23 A;  2DFK A;  2I1J A;  3F0W A;  2CAY A;  2EMT A;  3DXD A;  4K2O A;  2YS3 A;  2J0J A;  4A6F B;  2G35 A;  3M1I B;  4HB2 B;  3P7Z A;  5C6R A;  3F5R A;  3BIN A;  3NSU A;  2J0M A;  2RGN B;  1IRS A;  2Y7B A;  3PP2 A;  2UZR A;  4MK0 A;  4HB3 B;  4KHO A;  5DH9 B;  4DX8 A;  2IYB A;  1NU2 A;  5JHH A;  4HDQ A;  1WJ1 A;  1XOD A;  5J3T A;  1UEF A;  1WVH A;  1BY1 A;  1V89 A;  2DN6 A;  2COD A;  4KAX B;  5LOP B;  2OTX A;  2DX1 A;  1XD4 A;  4HAY B;  3WYF B;  4NY0 A;  1DDM A;  1I7A A;  2D9V A;  4DBB A;  3HK0 A;  2MKR A;  3RCP A;  3D8F A;  1OMW A;  3SUZ A;  5KQ4 A;  2LOZ A;  5JHG A;  2YVC A;  5C5B A;  1MAI A;  4NSW A;  2P8V A;  2UVM A;  1V5U A;  1X11 A;  2H7D A;  2PZ1 A;  1Q67 A;  4TYZ A;  1MK9 B;  5LON B;  1X05 A;  2LKO A;  5HE0 A;  1ISN A;  1H4R A;  1DDW A;  2N0Y A;  4IFS A;  5DI9 B;  1BTN A;  2DA0 A;  4D0N B;  1U27 A;  4TKN A;  3D8D A;  1FHX A;  2DYQ A;  2YF0 A;  2RNR B;  4Z2N A;  5DHF B;  1WGQ A;  1UPR A;  2DX5 A;  2QKL A;  4HB4 B;  5JP4 A;  1H10 A;  4ZRI A;  2J59 M;  5FI0 A;  1UNQ A;  4HAW B;  3PEG A;  1U29 A;  1XR0 B;  2Z0P A;  2JP2 A;  2D9Y A;  1EF1 A;  1FGZ A;  1AWE A;  4HAZ B;  2YRY A;  3SNH A;  1XX0 A;  3T06 A;  1PLS A;  2HE7 A;  1E5W A;  1MKE A;  3KZ1 A;  2KCJ A;  4H8S A;  2DTC A;  2D9W A;  2MDX A;  1QC6 A;  4GPT B;  3CIK A;  3MPX A;  1M7E A;  2VKI A;  4P7I A;  1ZVR A;  1GC6 A;  4HAU B;  4DX9 0;  3VOQ A;  1KZG A;  3PVW A;  2ROV A;  3TW1 A;  5HE3 A;  1KI1 B;  1QQG A;  4ZRJ A;  1XCG A;  2Q13 A;  2D10 A;  4ZRK A;  4GN1 A;  5D27 A;  4HDO A;  5FI1 A;  4A6F A;  2D9X A;  4A6K A;  3FSS A;  2LOX A;  4EKU A;  3ODW A;  2V76 A;  3PG7 A;  2Z0Q A;  1BTK A;  2NMB A;  2YSZ A;  1DYN A;  2D2Q A;  1BWN A;  1BAK A;  1GG3 A;  1OY2 A;  3TVV A;  3BJI A;  1XKE A;  3PVL A;  3AJ4 A;  2QKM A;  2GCJ A;  4PQ0 A;  4KHA A;  1X1G A;  3U8Z A;  1Z87 A;  2DKQ A;  2LG1 A;  4L6E A;  3TCA A;  1P6S A;  2M38 A;  1Y19 B;  1SGH A;  2AL6 A;  4DXA B;  1U5D A;  2R0D A;  3QBV B;  3PZD A;  3GYO A;  1WI1 A;  2KGX B;  3ODO A;  1FGY A;  1TQZ A;  1P5T A;  3CXB B;  3DXC A;  1U5E A;  1W1D A;  3IVF A;  3KRW A;  1V88 A;  5C79 A;  4F7H A;  1DBH A;  1FB8 A;  3ML4 A;  5D3V A;  1X86 A;  2I5F A;  3JV3 A;  1FAO A;  1ZSQ A;  2AEH A;  1WG7 A;  3V5W A;  3KY9 A;  4GMV A;  2Z0O A;  1TXD A;  4HAV B;  4XWX A;  2BCJ A;  1MPH A;  2L1C A;  4D0O A;  3GYP A;  1EAZ A;  3A98 B;  1UNP A;  3UZT A;  4K81 A;  4EMO A;  2J0K A;  1NI2 A;  2W2W A;  4YL8 A;  2ELB A;  4HHV A;  2RSG A;  2OQB A;  1PFJ A;  3HW2 B;  2X18 A;  4GMX B;  2D9Z A;  2K2J A;  5CLL B;  5C16 A;  3FEH A;  1K5D B;  4K17 A;  1V5P A;  5JLJ B;  2KR9 A;  3AU5 A;  1FOE A;  2YT1 A;  5HE1 A;  2YS1 A;  3ZVR A;  1V61 A;  2Y8G A;  1RJ2 A;  1EVH A;  1KZ7 A;  2L2I A;  4YON A;  2ROZ B;  4MY6 A;  3G9W A;  1FHO A;  2DYN A;  3KRX A;  5DIF B;  4CHJ A;  2I1K A;  1J0W A;  2RLO A;  1MK7 B;  2CY5 A;  3O96 A;  4C0A A;  3QWM A;  2R09 A;  2IFS A;  3ULC A;  3DXE A;  4IAP A;  3A8P A;  2CY4 A;  4EJN A;  2DHJ A;  4WSF A;  4WJ7 A;  3VIA A;  4Z2M B;  2N23 A;  1RRP B;  5CLQ B;  4GZU A;  4GXB A;  5EFX A;  2K00 A;  1PMS A;  4CYE A;  2GJY A;  1NTY A;  2W2X D;  1WJM A;  1B55 A;  1MIZ B;  1W1H A;  3U7D A;  1U5G A;  3HQC A;  4PNK A;  4HB0 B;  2E2X A;  2YT0 A;  3N7C A;  5HE2 A;  2FJL A;  1ZC3 B;  2K2U A;  1M7R A;  2MWN B;  5D3W A;  1K5G B;  2W2X C;  2EJ8 A;  1ZC4 B;  5J3Q A;  4KHB B;  3P6A A;  2RUK B;  4A6H A;  2COA A;  2ELA A;  3LJU X;  1I2H A;  2P0F A;  2YS5 A;  1SHC A;  1N3H A;  2D11 A;  2HTH B;  3A8Q A;  3KSY A;  2Y8F A;  2P0D A;  4B6H A;  1W1G A;  4Y94 A;  2UZS A;  3SO6 A;  4IOY X;  3QIJ A;  1NTV A;  5C5B B;  5L81 A;  1V5M A;  4GYV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...