2D9WA

Solution structure of the ph domain of docking protein 2 from human
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
127
structure length
127
Chain Sequence
b'GSSGSSGMGDGAVKQGFLYLQQQQTFGKKWRRFGASLYGGSDCALARLELQEGPEKPRRCEAARKVIRLSDCLRVAEAGGEASSPRDTSAFFLETKERLYLLAAPAAERGDWVQAICLLAFSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Docking protein 2
publication title Solution structure of the PH domain of Docking protein 2 from human
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 12
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2005-12-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2d9wA01
1XKEA 1EGXA 3T06A 3VOQA 4DX90 3GYOA 2YS1A 3X23A 1ZSQA 3WA0A 3G9WA 5C16A 2H7EA 2ZPYA 1V5MA 2MWNB 1XX0A 2V76A 1WI1A 4ZRJA 1ZVRA 1Q67A 1J19A 1NTYA 1XCGA 1X05A 4HATB 5C5BA 5JP4A 2QKMA 1M7EA 2EMSA 5HE1A 2DKQA 5D27A 1U5DA 1Z87A 1U29A 3AJ4A 2RLOA 3N7CA 5HE3A 1V61A 3KRWA 2CODA 4A6KA 5D3WA 2DHIA 3AU5A 3SO6A 3QWMA 1UNPA 2N23A 4GMXB 1I7AA 3PZDA 4IOYX 3BJIA 1PFJA 2UZSA 1SGHA 1E5WA 1Y5OA 1FHWA 3NSUA 3PVUA 3ODXA 4HAZB 5D3XA 1FGZA 5JLJB 3HW2B 2Q13A 2D4QA 2HTHB 5CLQB 1OMWA 2N0YA 1NI2A 3ZVRA 4CHJA 2D9YA 3IVFA 5J3TA 1WG7A 3RCPA 3ODOA 4TKNA 2GCLA 2LG1A 5KQ1A 2DLWA 1P5TA 2Y8FA 1U27A 2YT0A 1W1GA 4HB3B 1PLSA 4WJ7A 1FB8A 1U2BA 5J3YA 2KGXB 2I1KA 1AQCA 1B55A 1K5DB 3CIKA 2DYQA 1BAKA 1W1HA 1DROA 2DX5A 5C6RA 4D0NB 1W1DA 4IAPA 2K2JA 2LKOA 1X86A 4K2PA 3DXCA 3PVLA 2YRYA 1EF1A 2Y8GA 4F7HA 4DX8A 2OQBA 4WVFB 3KY9A 5HE0A 1EVHA 4A6FA 2COCA 3VIAA 4DXAB 4PNKA 1MKEA 1EAZA 4HAVB 3HQCA 3SYXA 4IFSA 1ISNA 1NTVA 2K00A 2W2XD 3FSSA 4HDQA 5D3YA 4HAXB 2P8VA 1ZC4B 2DTCA 2YSZA 1DDMA 2LOXA 1U5FA 2COAA 1WJMA 2LOZA 1I2HA 3MDBC 2ADZA 2GS0A 4HB2B 1V89A 1MK7B 1WVHA 3A8QA 2UZRA 2DN6A 3BINA 2VSZA 1WJ1A 1BWNA 2K2UA 4NY0A 1P3RA 4NSWA 2EC1A 2ROZB 2CRFA 3TW1A 1FGYA 3KSYA 3OANA 3WYFB 2GCJA 2QKLA 4PQ0A 2M14A 2P0HA 2I5FA 4KHAA 2DKPA 3DXEA 1UPRA 2CAYA 2DX1A 4GXBA 3ODWA 2D9XA 3F0WA 3SV1A 1PMSA 4P7IA 5CLLB 3U8ZA 4K17A 3QIJA 1UPQA 2W2WA 1FOEA 4CYEA 1ZC3B 5JHHA 4EKUA 3SUZA 4C0AA 1GG3A 2L1CA 2HE7A 4KVGB 4YONA 4TYZA 1XR0B 3LJUX 4YL8A 2NZ8B 2KUPA 3ULBA 1V5UA 2EMTA 1H10A 4KHBB 2I1JA 1X1FA 2X18A 3DXDA 1X11A 1M7RA 4HB0B 1MIZB 4HDOA 3KRXA 4K2OA 1QQGA 1NU2A 2DFKA 3V5WA 2DHJA 3M1IB 5DHFB 1TQZA 3GYPA 1MAIA 3FEHA 2H7DA 2DA0A 2R09A 1UNRA 5JHGA 2LULA 1RJ2A 2D9WA 3TVVA 2D11A 4K81A 1XD4A 2RUKB 1MIXA 2PZ1A 1N3HA 4HAYB 2MKRA 3PP2A 1KZGA 2YS5A 3D8FA 2J59M 1IRSA 1MK9B 2M38A 4KAXB 2D9VA 5EFXA 1TJ6A 1WGUA 3AU4A 4Z2MB 4GN1A 1DYNA 3HK0A 4B6HA 3PEGA 1DDVA 1RRPB 2DHKA 2AEHA 2RGNB 5GOWB 5DIFB 3FM8C 5FI0A 5C5BB 2YS3A 4HAUB 5C79A 1Y19B 4KHOA 2RSGA 2LYDA 4MK0A 2J0KA 2JP2A 4EJNA 5KQ4A 1UNQA 3F5RA 2E2XA 3SNHA 3P6AA 2P0DA 4DBBA 2COFA 3MPXA 1U5GA 5FI1A 4CHMA 4XWXA 4A6HA 1OY2A 2R0DA 2YT1A 2Z0QA 1QC6A 5DI9B 2ROVA 2YF0A 2IFSA 2YVCA 4H8SA 2I5CA 2L2IA 5DH9B 2Y7BA 2IYBA 2MFQA 5D3VA 2RNRB 1P6SA 2AL6A 5LOPB 1BTNA 4HB4B 4L6EA 3D8DA 2Z0OA 3PSCA 4A5KA 4F7GA 3U7DA 2FJLA 4GMVA 5DHAB 1LW3A 4EMOA 2J0MA 3D8EA 5J3QA 1V88A 3CXBB 1UEFA 5LONB 1AWEA 2VKIA 2DYNA 3A8PA 1U5EA 2GJYA 1BTKA 1MPHA 2NMBA 2D10A 4WSFA 4ZRIA 1LB1A 5KCVA 3TFMA 2ELAA 1TXDA 2G35A 2KCJA 1XODA 3KZ1A 4HHVA 4MY6A 4BBKA 1K5GB 2VRWB 4GPTB 2P0FA 1J0WA 2J0JA 1DDWA 2MDXA 4Y94A 3P7ZA 3PG7A 1ZM0A 3A98B 4GZUA 3QBVB 2EJ8A 1OQNA 4A6FB 2BCJA 1KZ7A 1SHCA 1X1GA 2OTXA 2Z0PA 1WGQA 5HE2A 3PVWA 3ULCA 3ZDTA 1H4RA 2W2XC 3TO1A 1DBHA 3O96A 4ZRKA 2CY4A 1FAOA 2ELBA 2XQNM 3UZTA 4Z2NA 2D2QA 1KI1B 4F7UP 1FHXA 1V5PA 4MT7A 2RVBB 2CY5A 4HAWB 1FHOA 1GC6A 2UVMA 2D9ZA 3TCAA 3ML4A 5L81A 1GC7A
chains in the Genus database with same CATH superfamily
1XKEA 1EGXA 3T06A 3VOQA 4DX90 3GYOA 2YS1A 3X23A 1ZSQA 3WA0A 3G9WA 5C16A 2H7EA 2ZPYA 3HIEA 1V5MA 2MWNB 1XX0A 2V76A 1WI1A 4ZRJA 1ZVRA 2GUMA 1Q67A 1J19A 1NTYA 1XCGA 1X05A 4HATB 5C5BA 2Z14A 2QKMA 5JP4A 1M7EA 2EMSA 5HE1A 2DKQA 2KR0A 5D27A 1U5DA 1Z87A 1U29A 3AJ4A 2RLOA 3A58A 3N7CA 5HE3A 1V61A 3KRWA 2CODA 4A6KA 4D6WA 5D3WA 2DHIA 3AU5A 3SO6A 3QWMA 1UNPA 4GNKB 2N23A 4GMXB 1I7AA 3PZDA 4IOYX 3BJIA 1PFJA 2UZSA 3FVCA 2R2YA 1SGHA 5I2SA 1E5WA 1Y5OA 1FHWA 3NSUA 3PVUA 3ODXA 4HAZB 5D3XA 1FGZA 5JLJB 3HW2B 2Q13A 2D4QA 2HTHB 5CLQB 1OMWA 2N0YA 1NI2A 3ZVRA 4CHJA 2D9YA 3IVFA 5J3TA 1WG7A 3RCPA 3DCXA 3ODOA 4TKNA 2GCLA 2LG1A 5KQ1A 2DLWA 1P5TA 2Y8FA 1U27A 2YT0A 1W1GA 4HB3B 1PLSA 4WJ7A 1FB8A 1U2BA 5J3YA 2KGXB 2I1KA 1AQCA 4QXAB 1B55A 1K5DB 3CIKA 2DYQA 1BAKA 1W1HA 1DROA 2DX5A 5C6RA 4D0NB 2YT2A 5LG4B 4OSNA 1W1DA 4IAPA 2K2JA 2LKOA 1X86A 4K2PA 3DXCA 3PVLA 2YRYA 1EF1A 2Y8GA 4F7HA 4DX8A 2OQBA 4WVFB 3KY9A 5HE0A 1EVHA 4A6FA 2COCA 3VIAA 4DXAB 4PNKA 1MKEA 1EAZA 4HAVB 3HQCA 3SYXA 4IFSA 4DIXA 1ISNA 1NTVA 2K00A 2W2XD 3FSSA 4HDQA 5D3YA 4HAXB 2P8VA 1ZC4B 2DTCA 2YSZA 1DDMA 2LOXA 1U5FA 2COAA 2KIEA 1MI1A 3NWDA 1WJMA 2LOZA 1I2HA 3MDBC 2ADZA 2Z13A 2GS0A 4HB2B 1V89A 3NW8A 1MK7B 1WVHA 3A8QA 2UZRA 2DN6A 3BINA 2VSZA 1WJ1A 1BWNA 2K2UA 4NY0A 1P3RA 4NSWA 2EC1A 2ROZB 2CRFA 3TW1A 1FGYA 3KSYA 3OANA 3WYFB 2GCJA 2QKLA 4PQ0A 2M14A 2P0HA 2I5FA 4KHAA 2DKPA 3DXEA 1UPRA 2CAYA 2DX1A 4GXBA 3ODWA 2D9XA 3F0WA 4GOUA 3SV1A 1PMSA 4P7IA 5CLLB 3U8ZA 4K17A 3QIJA 1UPQA 2W2WA 1FOEA 4CYEA 1ZC3B 5JHHA 4EKUA 3SUZA 4C0AA 1GG3A 2L1CA 2HE7A 4KVGB 4YONA 4TYZA 1XR0B 3LJUX 4YL8A 2NZ8B 2KUPA 2RRFA 3ULBA 1V5UA 2EMTA 1H10A 4KHBB 2I1JA 5I2MA 1X1FA 2X18A 3DXDA 1X11A 1M7RA 4HB0B 4HSIA 1MIZB 4HDOA 3KRXA 4K2OA 4QJ4B 1QQGA 1NU2A 2DFKA 1ZYIA 3V5WA 2DHJA 3M1IB 5DHFB 1TQZA 2Z4DA 3GYPA 3U12A 1MAIA 3FEHA 2H7DA 2DA0A 2R09A 3B77A 1UNRA 5JHGA 1T77A 2LULA 1RJ2A 2D9WA 3TVVA 2D11A 4K81A 1XD4A 2RUKB 1MIXA 2PZ1A 1N3HA 4HAYB 2MKRA 3PP2A 1KZGA 2YS5A 3D8FA 2J59M 1IRSA 1MK9B 2M38A 4KAXB 2D9VA 5EFXA 1TJ6A 1WGUA 3AU4A 4Z2MB 2Z59A 4GN1A 1DYNA 3HK0A 4OT1A 4B6HA 3PEGA 1DDVA 2K8EA 1RRPB 2DHKA 2AEHA 2RGNB 5GOWB 5DIFB 3FM8C 5FI0A 5C5BB 2YS3A 4HAUB 5C79A 1Y19B 4KHOA 2RSGA 2LYDA 4QJ3B 2K49A 4MK0A 2J0KA 2JP2A 4EJNA 2FJUB 5KQ4A 1UNQA 3F5RA 2E2XA 3SNHA 3P6AA 2P0DA 4DBBA 3NWAA 2COFA 3MPXA 4L1RA 1U5GA 3NWFA 5FI1A 4CSQA 4CHMA 4XWXA 4A6HA 1OY2A 2R0DA 2YT1A 2Z0QA 1QC6A 5DI9B 2ROVA 2YF0A 2IFSA 2YVCA 4H8SA 2I5CA 2L2IA 5DH9B 2Y7BA 2IYBA 2MFQA 5D3VA 2RNRB 1P6SA 2AL6A 5LOPB 1BTNA 4HB4B 4L6EA 3D8DA 2NBVA 2Z0OA 3PSCA 4A5KA 4F7GA 3U7DA 2FJLA 4GMVA 5DHAB 1LW3A 4EMOA 2J0MA 3D8EA 5J3QA 1V88A 3CXBB 1UEFA 5LONB 1AWEA 2VKIA 2DYNA 3A8PA 4QJ5B 1U5EA 2GJYA 1BTKA 5M4YB 1MPHA 2NMBA 2D10A 4WSFA 4ZRIA 1LB1A 5KCVA 3TFMA 2ELAA 1TXDA 2G35A 2KCJA 1XODA 2KUQA 5IRSA 3HSAA 3KZ1A 4HHVA 4MY6A 2KIGA 1K5GB 4BBKA 2VRWB 4GPTB 2P0FA 1J0WA 2J0JA 1DDWA 2MDXA 4Y94A 3P7ZA 3PG7A 1ZM0A 3A98B 4GZUA 3QBVB 2EJ8A 1OQNA 4A6FB 2BCJA 1KZ7A 1SHCA 1X1GA 4KHBA 2OTXA 2Z0PA 1WGQA 5HE2A 3PVWA 3ULCA 3ZDTA 1H4RA 3OHMB 2W2XC 3TO1A 1DBHA 3O96A 4ZRKA 2CY4A 1FAOA 2ELBA 2XQNM 3UZTA 4Z2NA 2D2QA 1KI1B 4F7UP 1FHXA 1V5PA 2ZKMX 4MT7A 2RVBB 2CY5A 4HAWB 1FHOA 1GC6A 2UVMA 2D9ZA 3TCAA 3ML4A 5L81A 1GC7A
chains in the Genus database with same CATH topology
1XKEA 1EGXA 3T06A 3VOQA 4DX90 3GYOA 2YS1A 3X23A 1ZSQA 3WA0A 3G9WA 5C16A 2H7EA 2ZPYA 1V5MA 2MWNB 1XX0A 2V76A 1WI1A 4ZRJA 1ZVRA 1Q67A 1J19A 1NTYA 1XCGA 1X05A 4HATB 5C5BA 5JP4A 2QKMA 1M7EA 2EMSA 5HE1A 2DKQA 5D27A 1U5DA 1Z87A 1U29A 3AJ4A 2RLOA 3N7CA 5HE3A 1V61A 3KRWA 2CODA 4A6KA 5D3WA 2DHIA 3AU5A 3SO6A 3QWMA 1UNPA 2N23A 4GMXB 1I7AA 3PZDA 4IOYX 3BJIA 1PFJA 2UZSA 1SGHA 1E5WA 1Y5OA 1FHWA 3NSUA 3PVUA 3ODXA 4HAZB 5D3XA 1FGZA 5JLJB 3HW2B 2Q13A 2D4QA 2HTHB 5CLQB 1OMWA 2N0YA 1NI2A 3ZVRA 4CHJA 2D9YA 3IVFA 5J3TA 1WG7A 3RCPA 3ODOA 4TKNA 2GCLA 2LG1A 5KQ1A 2DLWA 1P5TA 2Y8FA 1U27A 2YT0A 1W1GA 4HB3B 1PLSA 4WJ7A 1FB8A 1U2BA 5J3YA 2KGXB 2I1KA 1AQCA 1B55A 1K5DB 3CIKA 2DYQA 1BAKA 1W1HA 1DROA 2DX5A 5C6RA 4D0NB 1W1DA 4IAPA 2K2JA 2LKOA 1X86A 4K2PA 3DXCA 3PVLA 2YRYA 1EF1A 2Y8GA 4F7HA 4DX8A 2OQBA 4WVFB 3KY9A 5HE0A 1EVHA 4A6FA 2COCA 3VIAA 4DXAB 4PNKA 1MKEA 1EAZA 4HAVB 3HQCA 3SYXA 4IFSA 1ISNA 1NTVA 2K00A 2W2XD 3FSSA 4HDQA 5D3YA 4HAXB 2P8VA 1ZC4B 2DTCA 2YSZA 1DDMA 2LOXA 1U5FA 2COAA 1WJMA 2LOZA 1I2HA 3MDBC 2ADZA 2GS0A 4HB2B 1V89A 1MK7B 1WVHA 3A8QA 2UZRA 2DN6A 3BINA 2VSZA 1WJ1A 1BWNA 2K2UA 4NY0A 1P3RA 4NSWA 2EC1A 2ROZB 2CRFA 3TW1A 1FGYA 3KSYA 3OANA 3WYFB 2GCJA 2QKLA 4PQ0A 2M14A 2P0HA 2I5FA 4KHAA 2DKPA 3DXEA 1UPRA 2CAYA 2DX1A 4GXBA 3ODWA 2D9XA 3F0WA 3SV1A 1PMSA 4P7IA 5CLLB 3U8ZA 4K17A 3QIJA 1UPQA 2W2WA 1FOEA 4CYEA 1ZC3B 5JHHA 4EKUA 3SUZA 4C0AA 1GG3A 2L1CA 2HE7A 4KVGB 4YONA 4TYZA 1XR0B 3LJUX 4YL8A 2NZ8B 2KUPA 3ULBA 1V5UA 2EMTA 1H10A 4KHBB 2I1JA 1X1FA 2X18A 3DXDA 1X11A 1M7RA 4HB0B 1MIZB 4HDOA 3KRXA 4K2OA 1QQGA 1NU2A 2DFKA 3V5WA 2DHJA 3M1IB 5DHFB 1TQZA 3GYPA 1MAIA 3FEHA 2H7DA 2DA0A 2R09A 1UNRA 5JHGA 2LULA 1RJ2A 2D9WA 3TVVA 2D11A 4K81A 1XD4A 2RUKB 1MIXA 2PZ1A 1N3HA 4HAYB 2MKRA 3PP2A 1KZGA 2YS5A 3D8FA 2J59M 1IRSA 1MK9B 2M38A 4KAXB 2D9VA 5EFXA 1TJ6A 1WGUA 3AU4A 4Z2MB 4GN1A 1DYNA 3HK0A 4B6HA 3PEGA 1DDVA 1RRPB 2DHKA 2AEHA 2RGNB 5GOWB 5DIFB 3FM8C 5FI0A 5C5BB 2YS3A 4HAUB 5C79A 1Y19B 4KHOA 2RSGA 2LYDA 4MK0A 2J0KA 2JP2A 4EJNA 5KQ4A 1UNQA 3F5RA 2E2XA 3SNHA 3P6AA 2P0DA 4DBBA 2COFA 3MPXA 1U5GA 5FI1A 4CHMA 4XWXA 4A6HA 1OY2A 2R0DA 2YT1A 2Z0QA 1QC6A 5DI9B 2ROVA 2YF0A 2IFSA 2YVCA 4H8SA 2I5CA 2L2IA 5DH9B 2Y7BA 2IYBA 2MFQA 5D3VA 2RNRB 1P6SA 2AL6A 5LOPB 1BTNA 4HB4B 4L6EA 3D8DA 2Z0OA 3PSCA 4A5KA 4F7GA 3U7DA 2FJLA 4GMVA 5DHAB 1LW3A 4EMOA 2J0MA 3D8EA 5J3QA 1V88A 3CXBB 1UEFA 5LONB 1AWEA 2VKIA 2DYNA 3A8PA 1U5EA 2GJYA 1BTKA 1MPHA 2NMBA 2D10A 4WSFA 4ZRIA 1LB1A 5KCVA 3TFMA 2ELAA 1TXDA 2G35A 2KCJA 1XODA 3KZ1A 4HHVA 4MY6A 4BBKA 1K5GB 2VRWB 4GPTB 2P0FA 1J0WA 2J0JA 1DDWA 2MDXA 4Y94A 3P7ZA 3PG7A 1ZM0A 3A98B 4GZUA 3QBVB 2EJ8A 1OQNA 4A6FB 2BCJA 1KZ7A 1SHCA 1X1GA 2OTXA 2Z0PA 1WGQA 5HE2A 3PVWA 3ULCA 3ZDTA 1H4RA 2W2XC 3TO1A 1DBHA 3O96A 4ZRKA 2CY4A 1FAOA 2ELBA 2XQNM 3UZTA 4Z2NA 2D2QA 1KI1B 4F7UP 1FHXA 1V5PA 4MT7A 2RVBB 2CY5A 4HAWB 1FHOA 1GC6A 2UVMA 2D9ZA 3TCAA 3ML4A 5L81A 1GC7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XKE A;  1EGX A;  3T06 A;  3VOQ A;  4DX9 0;  3GYO A;  2YS1 A;  3X23 A;  1ZSQ A;  3WA0 A;  3G9W A;  5C16 A;  2H7E A;  2ZPY A;  1V5M A;  2MWN B;  1XX0 A;  2V76 A;  1WI1 A;  4ZRJ A;  1ZVR A;  1Q67 A;  1J19 A;  1NTY A;  1XCG A;  1X05 A;  4HAT B;  5C5B A;  5JP4 A;  2QKM A;  1M7E A;  2EMS A;  5HE1 A;  2DKQ A;  5D27 A;  1U5D A;  1Z87 A;  1U29 A;  3AJ4 A;  2RLO A;  3N7C A;  5HE3 A;  1V61 A;  3KRW A;  2COD A;  4A6K A;  5D3W A;  2DHI A;  3AU5 A;  3SO6 A;  3QWM A;  1UNP A;  2N23 A;  4GMX B;  1I7A A;  3PZD A;  4IOY X;  3BJI A;  1PFJ A;  2UZS A;  1SGH A;  1E5W A;  1Y5O A;  1FHW A;  3NSU A;  3PVU A;  3ODX A;  4HAZ B;  5D3X A;  1FGZ A;  5JLJ B;  3HW2 B;  2Q13 A;  2D4Q A;  2HTH B;  5CLQ B;  1OMW A;  2N0Y A;  1NI2 A;  3ZVR A;  4CHJ A;  2D9Y A;  3IVF A;  5J3T A;  1WG7 A;  3RCP A;  3ODO A;  4TKN A;  2GCL A;  2LG1 A;  5KQ1 A;  2DLW A;  1P5T A;  2Y8F A;  1U27 A;  2YT0 A;  1W1G A;  4HB3 B;  1PLS A;  4WJ7 A;  1FB8 A;  1U2B A;  5J3Y A;  2KGX B;  2I1K A;  1AQC A;  1B55 A;  1K5D B;  3CIK A;  2DYQ A;  1BAK A;  1W1H A;  1DRO A;  2DX5 A;  5C6R A;  4D0N B;  1W1D A;  4IAP A;  2K2J A;  2LKO A;  1X86 A;  4K2P A;  3DXC A;  3PVL A;  2YRY A;  1EF1 A;  2Y8G A;  4F7H A;  4DX8 A;  2OQB A;  4WVF B;  3KY9 A;  5HE0 A;  1EVH A;  4A6F A;  2COC A;  3VIA A;  4DXA B;  4PNK A;  1MKE A;  1EAZ A;  4HAV B;  3HQC A;  3SYX A;  4IFS A;  1ISN A;  1NTV A;  2K00 A;  2W2X D;  3FSS A;  4HDQ A;  5D3Y A;  4HAX B;  2P8V A;  1ZC4 B;  2DTC A;  2YSZ A;  1DDM A;  2LOX A;  1U5F A;  2COA A;  1WJM A;  2LOZ A;  1I2H A;  3MDB C;  2ADZ A;  2GS0 A;  4HB2 B;  1V89 A;  1MK7 B;  1WVH A;  3A8Q A;  2UZR A;  2DN6 A;  3BIN A;  2VSZ A;  1WJ1 A;  1BWN A;  2K2U A;  4NY0 A;  1P3R A;  4NSW A;  2EC1 A;  2ROZ B;  2CRF A;  3TW1 A;  1FGY A;  3KSY A;  3OAN A;  3WYF B;  2GCJ A;  2QKL A;  4PQ0 A;  2M14 A;  2P0H A;  2I5F A;  4KHA A;  2DKP A;  3DXE A;  1UPR A;  2CAY A;  2DX1 A;  4GXB A;  3ODW A;  2D9X A;  3F0W A;  3SV1 A;  1PMS A;  4P7I A;  5CLL B;  3U8Z A;  4K17 A;  3QIJ A;  1UPQ A;  2W2W A;  1FOE A;  4CYE A;  1ZC3 B;  5JHH A;  4EKU A;  3SUZ A;  4C0A A;  1GG3 A;  2L1C A;  2HE7 A;  4KVG B;  4YON A;  4TYZ A;  1XR0 B;  3LJU X;  4YL8 A;  2NZ8 B;  2KUP A;  3ULB A;  1V5U A;  2EMT A;  1H10 A;  4KHB B;  2I1J A;  1X1F A;  2X18 A;  3DXD A;  1X11 A;  1M7R A;  4HB0 B;  1MIZ B;  4HDO A;  3KRX A;  4K2O A;  1QQG A;  1NU2 A;  2DFK A;  3V5W A;  2DHJ A;  3M1I B;  5DHF B;  1TQZ A;  3GYP A;  1MAI A;  3FEH A;  2H7D A;  2DA0 A;  2R09 A;  1UNR A;  5JHG A;  2LUL A;  1RJ2 A;  2D9W A;  3TVV A;  2D11 A;  4K81 A;  1XD4 A;  2RUK B;  1MIX A;  2PZ1 A;  1N3H A;  4HAY B;  2MKR A;  3PP2 A;  1KZG A;  2YS5 A;  3D8F A;  2J59 M;  1IRS A;  1MK9 B;  2M38 A;  4KAX B;  2D9V A;  5EFX A;  1TJ6 A;  1WGU A;  3AU4 A;  4Z2M B;  4GN1 A;  1DYN A;  3HK0 A;  4B6H A;  3PEG A;  1DDV A;  1RRP B;  2DHK A;  2AEH A;  2RGN B;  5GOW B;  5DIF B;  3FM8 C;  5FI0 A;  5C5B B;  2YS3 A;  4HAU B;  5C79 A;  1Y19 B;  4KHO A;  2RSG A;  2LYD A;  4MK0 A;  2J0K A;  2JP2 A;  4EJN A;  5KQ4 A;  1UNQ A;  3F5R A;  2E2X A;  3SNH A;  3P6A A;  2P0D A;  4DBB A;  2COF A;  3MPX A;  1U5G A;  5FI1 A;  4CHM A;  4XWX A;  4A6H A;  1OY2 A;  2R0D A;  2YT1 A;  2Z0Q A;  1QC6 A;  5DI9 B;  2ROV A;  2YF0 A;  2IFS A;  2YVC A;  4H8S A;  2I5C A;  2L2I A;  5DH9 B;  2Y7B A;  2IYB A;  2MFQ A;  5D3V A;  2RNR B;  1P6S A;  2AL6 A;  5LOP B;  1BTN A;  4HB4 B;  4L6E A;  3D8D A;  2Z0O A;  3PSC A;  4A5K A;  4F7G A;  3U7D A;  2FJL A;  4GMV A;  5DHA B;  1LW3 A;  4EMO A;  2J0M A;  3D8E A;  5J3Q A;  1V88 A;  3CXB B;  1UEF A;  5LON B;  1AWE A;  2VKI A;  2DYN A;  3A8P A;  1U5E A;  2GJY A;  1BTK A;  1MPH A;  2NMB A;  2D10 A;  4WSF A;  4ZRI A;  1LB1 A;  5KCV A;  3TFM A;  2ELA A;  1TXD A;  2G35 A;  2KCJ A;  1XOD A;  3KZ1 A;  4HHV A;  4MY6 A;  4BBK A;  1K5G B;  2VRW B;  4GPT B;  2P0F A;  1J0W A;  2J0J A;  1DDW A;  2MDX A;  4Y94 A;  3P7Z A;  3PG7 A;  1ZM0 A;  3A98 B;  4GZU A;  3QBV B;  2EJ8 A;  1OQN A;  4A6F B;  2BCJ A;  1KZ7 A;  1SHC A;  1X1G A;  2OTX A;  2Z0P A;  1WGQ A;  5HE2 A;  3PVW A;  3ULC A;  3ZDT A;  1H4R A;  2W2X C;  3TO1 A;  1DBH A;  3O96 A;  4ZRK A;  2CY4 A;  1FAO A;  2ELB A;  2XQN M;  3UZT A;  4Z2N A;  2D2Q A;  1KI1 B;  4F7U P;  1FHX A;  1V5P A;  4MT7 A;  2RVB B;  2CY5 A;  4HAW B;  1FHO A;  1GC6 A;  2UVM A;  2D9Z A;  3TCA A;  3ML4 A;  5L81 A;  1GC7 A; 
#chains in the Genus database with same CATH topology
 1XKE A;  1EGX A;  3T06 A;  3VOQ A;  4DX9 0;  3GYO A;  2YS1 A;  3X23 A;  1ZSQ A;  3WA0 A;  3G9W A;  5C16 A;  2H7E A;  2ZPY A;  3HIE A;  1V5M A;  2MWN B;  1XX0 A;  2V76 A;  1WI1 A;  4ZRJ A;  1ZVR A;  2GUM A;  1Q67 A;  1J19 A;  1NTY A;  1XCG A;  1X05 A;  4HAT B;  5C5B A;  2Z14 A;  2QKM A;  5JP4 A;  1M7E A;  2EMS A;  5HE1 A;  2DKQ A;  2KR0 A;  5D27 A;  1U5D A;  1Z87 A;  1U29 A;  3AJ4 A;  2RLO A;  3A58 A;  3N7C A;  5HE3 A;  1V61 A;  3KRW A;  2COD A;  4A6K A;  4D6W A;  5D3W A;  2DHI A;  3AU5 A;  3SO6 A;  3QWM A;  1UNP A;  4GNK B;  2N23 A;  4GMX B;  1I7A A;  3PZD A;  4IOY X;  3BJI A;  1PFJ A;  2UZS A;  3FVC A;  2R2Y A;  1SGH A;  5I2S A;  1E5W A;  1Y5O A;  1FHW A;  3NSU A;  3PVU A;  3ODX A;  4HAZ B;  5D3X A;  1FGZ A;  5JLJ B;  3HW2 B;  2Q13 A;  2D4Q A;  2HTH B;  5CLQ B;  1OMW A;  2N0Y A;  1NI2 A;  3ZVR A;  4CHJ A;  2D9Y A;  3IVF A;  5J3T A;  1WG7 A;  3RCP A;  3DCX A;  3ODO A;  4TKN A;  2GCL A;  2LG1 A;  5KQ1 A;  2DLW A;  1P5T A;  2Y8F A;  1U27 A;  2YT0 A;  1W1G A;  4HB3 B;  1PLS A;  4WJ7 A;  1FB8 A;  1U2B A;  5J3Y A;  2KGX B;  2I1K A;  1AQC A;  4QXA B;  1B55 A;  1K5D B;  3CIK A;  2DYQ A;  1BAK A;  1W1H A;  1DRO A;  2DX5 A;  5C6R A;  4D0N B;  2YT2 A;  5LG4 B;  4OSN A;  1W1D A;  4IAP A;  2K2J A;  2LKO A;  1X86 A;  4K2P A;  3DXC A;  3PVL A;  2YRY A;  1EF1 A;  2Y8G A;  4F7H A;  4DX8 A;  2OQB A;  4WVF B;  3KY9 A;  5HE0 A;  1EVH A;  4A6F A;  2COC A;  3VIA A;  4DXA B;  4PNK A;  1MKE A;  1EAZ A;  4HAV B;  3HQC A;  3SYX A;  4IFS A;  4DIX A;  1ISN A;  1NTV A;  2K00 A;  2W2X D;  3FSS A;  4HDQ A;  5D3Y A;  4HAX B;  2P8V A;  1ZC4 B;  2DTC A;  2YSZ A;  1DDM A;  2LOX A;  1U5F A;  2COA A;  2KIE A;  1MI1 A;  3NWD A;  1WJM A;  2LOZ A;  1I2H A;  3MDB C;  2ADZ A;  2Z13 A;  2GS0 A;  4HB2 B;  1V89 A;  3NW8 A;  1MK7 B;  1WVH A;  3A8Q A;  2UZR A;  2DN6 A;  3BIN A;  2VSZ A;  1WJ1 A;  1BWN A;  2K2U A;  4NY0 A;  1P3R A;  4NSW A;  2EC1 A;  2ROZ B;  2CRF A;  3TW1 A;  1FGY A;  3KSY A;  3OAN A;  3WYF B;  2GCJ A;  2QKL A;  4PQ0 A;  2M14 A;  2P0H A;  2I5F A;  4KHA A;  2DKP A;  3DXE A;  1UPR A;  2CAY A;  2DX1 A;  4GXB A;  3ODW A;  2D9X A;  3F0W A;  4GOU A;  3SV1 A;  1PMS A;  4P7I A;  5CLL B;  3U8Z A;  4K17 A;  3QIJ A;  1UPQ A;  2W2W A;  1FOE A;  4CYE A;  1ZC3 B;  5JHH A;  4EKU A;  3SUZ A;  4C0A A;  1GG3 A;  2L1C A;  2HE7 A;  4KVG B;  4YON A;  4TYZ A;  1XR0 B;  3LJU X;  4YL8 A;  2NZ8 B;  2KUP A;  2RRF A;  3ULB A;  1V5U A;  2EMT A;  1H10 A;  4KHB B;  2I1J A;  5I2M A;  1X1F A;  2X18 A;  3DXD A;  1X11 A;  1M7R A;  4HB0 B;  4HSI A;  1MIZ B;  4HDO A;  3KRX A;  4K2O A;  4QJ4 B;  1QQG A;  1NU2 A;  2DFK A;  1ZYI A;  3V5W A;  2DHJ A;  3M1I B;  5DHF B;  1TQZ A;  2Z4D A;  3GYP A;  3U12 A;  1MAI A;  3FEH A;  2H7D A;  2DA0 A;  2R09 A;  3B77 A;  1UNR A;  5JHG A;  1T77 A;  2LUL A;  1RJ2 A;  2D9W A;  3TVV A;  2D11 A;  4K81 A;  1XD4 A;  2RUK B;  1MIX A;  2PZ1 A;  1N3H A;  4HAY B;  2MKR A;  3PP2 A;  1KZG A;  2YS5 A;  3D8F A;  2J59 M;  1IRS A;  1MK9 B;  2M38 A;  4KAX B;  2D9V A;  5EFX A;  1TJ6 A;  1WGU A;  3AU4 A;  4Z2M B;  2Z59 A;  4GN1 A;  1DYN A;  3HK0 A;  4OT1 A;  4B6H A;  3PEG A;  1DDV A;  2K8E A;  1RRP B;  2DHK A;  2AEH A;  2RGN B;  5GOW B;  5DIF B;  3FM8 C;  5FI0 A;  5C5B B;  2YS3 A;  4HAU B;  5C79 A;  1Y19 B;  4KHO A;  2RSG A;  2LYD A;  4QJ3 B;  2K49 A;  4MK0 A;  2J0K A;  2JP2 A;  4EJN A;  2FJU B;  5KQ4 A;  1UNQ A;  3F5R A;  2E2X A;  3SNH A;  3P6A A;  2P0D A;  4DBB A;  3NWA A;  2COF A;  3MPX A;  4L1R A;  1U5G A;  3NWF A;  5FI1 A;  4CSQ A;  4CHM A;  4XWX A;  4A6H A;  1OY2 A;  2R0D A;  2YT1 A;  2Z0Q A;  1QC6 A;  5DI9 B;  2ROV A;  2YF0 A;  2IFS A;  2YVC A;  4H8S A;  2I5C A;  2L2I A;  5DH9 B;  2Y7B A;  2IYB A;  2MFQ A;  5D3V A;  2RNR B;  1P6S A;  2AL6 A;  5LOP B;  1BTN A;  4HB4 B;  4L6E A;  3D8D A;  2NBV A;  2Z0O A;  3PSC A;  4A5K A;  4F7G A;  3U7D A;  2FJL A;  4GMV A;  5DHA B;  1LW3 A;  4EMO A;  2J0M A;  3D8E A;  5J3Q A;  1V88 A;  3CXB B;  1UEF A;  5LON B;  1AWE A;  2VKI A;  2DYN A;  3A8P A;  4QJ5 B;  1U5E A;  2GJY A;  1BTK A;  5M4Y B;  1MPH A;  2NMB A;  2D10 A;  4WSF A;  4ZRI A;  1LB1 A;  5KCV A;  3TFM A;  2ELA A;  1TXD A;  2G35 A;  2KCJ A;  1XOD A;  2KUQ A;  5IRS A;  3HSA A;  3KZ1 A;  4HHV A;  4MY6 A;  2KIG A;  1K5G B;  4BBK A;  2VRW B;  4GPT B;  2P0F A;  1J0W A;  2J0J A;  1DDW A;  2MDX A;  4Y94 A;  3P7Z A;  3PG7 A;  1ZM0 A;  3A98 B;  4GZU A;  3QBV B;  2EJ8 A;  1OQN A;  4A6F B;  2BCJ A;  1KZ7 A;  1SHC A;  1X1G A;  4KHB A;  2OTX A;  2Z0P A;  1WGQ A;  5HE2 A;  3PVW A;  3ULC A;  3ZDT A;  1H4R A;  3OHM B;  2W2X C;  3TO1 A;  1DBH A;  3O96 A;  4ZRK A;  2CY4 A;  1FAO A;  2ELB A;  2XQN M;  3UZT A;  4Z2N A;  2D2Q A;  1KI1 B;  4F7U P;  1FHX A;  1V5P A;  2ZKM X;  4MT7 A;  2RVB B;  2CY5 A;  4HAW B;  1FHO A;  1GC6 A;  2UVM A;  2D9Z A;  3TCA A;  3ML4 A;  5L81 A;  1GC7 A; 
#chains in the Genus database with same CATH homology
 1XKE A;  1EGX A;  3T06 A;  3VOQ A;  4DX9 0;  3GYO A;  2YS1 A;  3X23 A;  1ZSQ A;  3WA0 A;  3G9W A;  5C16 A;  2H7E A;  2ZPY A;  1V5M A;  2MWN B;  1XX0 A;  2V76 A;  1WI1 A;  4ZRJ A;  1ZVR A;  1Q67 A;  1J19 A;  1NTY A;  1XCG A;  1X05 A;  4HAT B;  5C5B A;  5JP4 A;  2QKM A;  1M7E A;  2EMS A;  5HE1 A;  2DKQ A;  5D27 A;  1U5D A;  1Z87 A;  1U29 A;  3AJ4 A;  2RLO A;  3N7C A;  5HE3 A;  1V61 A;  3KRW A;  2COD A;  4A6K A;  5D3W A;  2DHI A;  3AU5 A;  3SO6 A;  3QWM A;  1UNP A;  2N23 A;  4GMX B;  1I7A A;  3PZD A;  4IOY X;  3BJI A;  1PFJ A;  2UZS A;  1SGH A;  1E5W A;  1Y5O A;  1FHW A;  3NSU A;  3PVU A;  3ODX A;  4HAZ B;  5D3X A;  1FGZ A;  5JLJ B;  3HW2 B;  2Q13 A;  2D4Q A;  2HTH B;  5CLQ B;  1OMW A;  2N0Y A;  1NI2 A;  3ZVR A;  4CHJ A;  2D9Y A;  3IVF A;  5J3T A;  1WG7 A;  3RCP A;  3ODO A;  4TKN A;  2GCL A;  2LG1 A;  5KQ1 A;  2DLW A;  1P5T A;  2Y8F A;  1U27 A;  2YT0 A;  1W1G A;  4HB3 B;  1PLS A;  4WJ7 A;  1FB8 A;  1U2B A;  5J3Y A;  2KGX B;  2I1K A;  1AQC A;  1B55 A;  1K5D B;  3CIK A;  2DYQ A;  1BAK A;  1W1H A;  1DRO A;  2DX5 A;  5C6R A;  4D0N B;  1W1D A;  4IAP A;  2K2J A;  2LKO A;  1X86 A;  4K2P A;  3DXC A;  3PVL A;  2YRY A;  1EF1 A;  2Y8G A;  4F7H A;  4DX8 A;  2OQB A;  4WVF B;  3KY9 A;  5HE0 A;  1EVH A;  4A6F A;  2COC A;  3VIA A;  4DXA B;  4PNK A;  1MKE A;  1EAZ A;  4HAV B;  3HQC A;  3SYX A;  4IFS A;  1ISN A;  1NTV A;  2K00 A;  2W2X D;  3FSS A;  4HDQ A;  5D3Y A;  4HAX B;  2P8V A;  1ZC4 B;  2DTC A;  2YSZ A;  1DDM A;  2LOX A;  1U5F A;  2COA A;  1WJM A;  2LOZ A;  1I2H A;  3MDB C;  2ADZ A;  2GS0 A;  4HB2 B;  1V89 A;  1MK7 B;  1WVH A;  3A8Q A;  2UZR A;  2DN6 A;  3BIN A;  2VSZ A;  1WJ1 A;  1BWN A;  2K2U A;  4NY0 A;  1P3R A;  4NSW A;  2EC1 A;  2ROZ B;  2CRF A;  3TW1 A;  1FGY A;  3KSY A;  3OAN A;  3WYF B;  2GCJ A;  2QKL A;  4PQ0 A;  2M14 A;  2P0H A;  2I5F A;  4KHA A;  2DKP A;  3DXE A;  1UPR A;  2CAY A;  2DX1 A;  4GXB A;  3ODW A;  2D9X A;  3F0W A;  3SV1 A;  1PMS A;  4P7I A;  5CLL B;  3U8Z A;  4K17 A;  3QIJ A;  1UPQ A;  2W2W A;  1FOE A;  4CYE A;  1ZC3 B;  5JHH A;  4EKU A;  3SUZ A;  4C0A A;  1GG3 A;  2L1C A;  2HE7 A;  4KVG B;  4YON A;  4TYZ A;  1XR0 B;  3LJU X;  4YL8 A;  2NZ8 B;  2KUP A;  3ULB A;  1V5U A;  2EMT A;  1H10 A;  4KHB B;  2I1J A;  1X1F A;  2X18 A;  3DXD A;  1X11 A;  1M7R A;  4HB0 B;  1MIZ B;  4HDO A;  3KRX A;  4K2O A;  1QQG A;  1NU2 A;  2DFK A;  3V5W A;  2DHJ A;  3M1I B;  5DHF B;  1TQZ A;  3GYP A;  1MAI A;  3FEH A;  2H7D A;  2DA0 A;  2R09 A;  1UNR A;  5JHG A;  2LUL A;  1RJ2 A;  2D9W A;  3TVV A;  2D11 A;  4K81 A;  1XD4 A;  2RUK B;  1MIX A;  2PZ1 A;  1N3H A;  4HAY B;  2MKR A;  3PP2 A;  1KZG A;  2YS5 A;  3D8F A;  2J59 M;  1IRS A;  1MK9 B;  2M38 A;  4KAX B;  2D9V A;  5EFX A;  1TJ6 A;  1WGU A;  3AU4 A;  4Z2M B;  4GN1 A;  1DYN A;  3HK0 A;  4B6H A;  3PEG A;  1DDV A;  1RRP B;  2DHK A;  2AEH A;  2RGN B;  5GOW B;  5DIF B;  3FM8 C;  5FI0 A;  5C5B B;  2YS3 A;  4HAU B;  5C79 A;  1Y19 B;  4KHO A;  2RSG A;  2LYD A;  4MK0 A;  2J0K A;  2JP2 A;  4EJN A;  5KQ4 A;  1UNQ A;  3F5R A;  2E2X A;  3SNH A;  3P6A A;  2P0D A;  4DBB A;  2COF A;  3MPX A;  1U5G A;  5FI1 A;  4CHM A;  4XWX A;  4A6H A;  1OY2 A;  2R0D A;  2YT1 A;  2Z0Q A;  1QC6 A;  5DI9 B;  2ROV A;  2YF0 A;  2IFS A;  2YVC A;  4H8S A;  2I5C A;  2L2I A;  5DH9 B;  2Y7B A;  2IYB A;  2MFQ A;  5D3V A;  2RNR B;  1P6S A;  2AL6 A;  5LOP B;  1BTN A;  4HB4 B;  4L6E A;  3D8D A;  2Z0O A;  3PSC A;  4A5K A;  4F7G A;  3U7D A;  2FJL A;  4GMV A;  5DHA B;  1LW3 A;  4EMO A;  2J0M A;  3D8E A;  5J3Q A;  1V88 A;  3CXB B;  1UEF A;  5LON B;  1AWE A;  2VKI A;  2DYN A;  3A8P A;  1U5E A;  2GJY A;  1BTK A;  1MPH A;  2NMB A;  2D10 A;  4WSF A;  4ZRI A;  1LB1 A;  5KCV A;  3TFM A;  2ELA A;  1TXD A;  2G35 A;  2KCJ A;  1XOD A;  3KZ1 A;  4HHV A;  4MY6 A;  4BBK A;  1K5G B;  2VRW B;  4GPT B;  2P0F A;  1J0W A;  2J0J A;  1DDW A;  2MDX A;  4Y94 A;  3P7Z A;  3PG7 A;  1ZM0 A;  3A98 B;  4GZU A;  3QBV B;  2EJ8 A;  1OQN A;  4A6F B;  2BCJ A;  1KZ7 A;  1SHC A;  1X1G A;  2OTX A;  2Z0P A;  1WGQ A;  5HE2 A;  3PVW A;  3ULC A;  3ZDT A;  1H4R A;  2W2X C;  3TO1 A;  1DBH A;  3O96 A;  4ZRK A;  2CY4 A;  1FAO A;  2ELB A;  2XQN M;  3UZT A;  4Z2N A;  2D2Q A;  1KI1 B;  4F7U P;  1FHX A;  1V5P A;  4MT7 A;  2RVB B;  2CY5 A;  4HAW B;  1FHO A;  1GC6 A;  2UVM A;  2D9Z A;  3TCA A;  3ML4 A;  5L81 A;  1GC7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...