2D9WA

Solution structure of the ph domain of docking protein 2 from human
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
127
structure length
127
Chain Sequence
GSSGSSGMGDGAVKQGFLYLQQQQTFGKKWRRFGASLYGGSDCALARLELQEGPEKPRRCEAARKVIRLSDCLRVAEAGGEASSPRDTSAFFLETKERLYLLAAPAAERGDWVQAICLLAFSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Docking protein 2
publication title Solution structure of the PH domain of Docking protein 2 from human
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 12
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2005-12-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2d9wA01
1U5DA 2CY4A 2N0YA 5DI9B 1W1DA 1NTVA 4HAYB 2CRFA 2DHIA 3SV1A 4MY6A 2DA0A 1FHXA 2I1JA 2J0JA 1MK9B 3GYOA 4HATB 2YS5A 2LOZA 1BTNA 2UZRA 4L6EA 4EJNA 5KQ4A 1FHWA 1FGZA 2K2JA 2W2XD 5D3YA 2L1CA 1EGXA 3D8FA 1AWEA 1V61A 3O96A 1FGYA 1GG3A 5C79A 3A98B 2BCJA 2DX1A 1EVHA 1U5GA 2EJ8A 3GYPA 1OMWA 3PVWA 1WJMA 3V5WA 1UPRA 2EMSA 3X23A 4A6FA 1TQZA 4PQ0A 3AJ4A 2ROVA 1X1GA 2COFA 2ELAA 2UVMA 3DXDA 1MPHA 1WG7A 2RUKB 1V5MA 2YSZA 1NU2A 4YONA 1N3HA 1IRSA 2MKRA 5JLJB 2ELBA 2YRYA 3F0WA 4XWXA 2R09A 3TFMA 2HE7A 1NTYA 2VRWB 1V5PA 1ZC4B 3KY9A 1DYNA 3PVLA 4A6KA 1DBHA 2IYBA 1PFJA 2MDXA 3D8EA 4P7IA 1K5DB 2ZPYA 5CLLB 5HE2A 3AU5A 2DFKA 1GC6A 1J19A 2I5FA 4GMXB 4ZRJA 5C5BA 3SO6A 3HQCA 5L81A 4NY0A 4GPTB 3FEHA 2Y8FA 3HK0A 1U5FA 5GOWB 2Z0OA 3OANA 2Z0QA 3PP2A 5D3VA 1SGHA 1U29A 2COAA 3KZ1A 2D9XA 4F7HA 3N7CA 3BJIA 4MT7A 4ZRIA 4K2OA 2EC1A 2DKQA 3VIAA 3P6AA 4F7GA 1MK7B 2Y7BA 1GC7A 1ISNA 2QKLA 5CLQB 1KI1B 1X1FA 3IVFA 2P0HA 5HE3A 1XD4A 3P7ZA 1BWNA 1OQNA 2X18A 4A6HA 1Y19B 3CIKA 5JHHA 1WGUA 3KSYA 4HDOA 2DHKA 3T06A 2LOXA 1DDWA 1DROA 3D8DA 2GJYA 2K00A 3TCAA 3UZTA 1WJ1A 1XODA 4F7UP 1BTKA 3M1IB 4BBKA 2Q13A 2J59M 2VKIA 1MKEA 4WSFA 2NZ8B 4K2PA 2Z0PA 2RLOA 3U7DA 3ML4A 5KQ1A 3BINA 1WGQA 3DXCA 3ZVRA 3KRXA 4B6HA 2OTXA 4MK0A 5LONB 1XKEA 5C16A 2QKMA 2LG1A 3F5RA 2MFQA 1Y5OA 4EMOA 2M14A 2YT0A 4PNKA 4Z2NA 1P3RA 3TO1A 1FOEA 3SNHA 1UPQA 1XR0B 1ZM0A 4GZUA 4HB2B 1UNQA 2RGNB 4DX8A 1V88A 1H10A 3PEGA 1KZGA 5EFXA 1AQCA 1KZ7A 4ZRKA 2DKPA 3PZDA 2ADZA 2DTCA 1P6SA 4CHMA 3ULCA 2NMBA 2J0KA 1UNPA 1Z87A 4HB3B 2KGXB 1OY2A 2D2QA 4HAXB 3ODXA 4CHJA 1EF1A 1ZVRA 5D27A 2KCJA 4DBBA 1I7AA 2K2UA 3DXEA 1K5GB 4HHVA 2W2XC 4WJ7A 2HTHB 3WA0A 1FAOA 2H7EA 2LYDA 1TJ6A 2GCLA 5FI0A 3PG7A 2RVBB 1EAZA 2L2IA 1WVHA 2V76A 1WI1A 1W1HA 1XX0A 2COCA 3TW1A 4HDQA 2GCJA 4IOYX 1J0WA 2YT1A 2E2XA 1NI2A 4A6FB 2CY5A 5DH9B 1SHCA 3A8PA 2YS1A 5J3QA 1E5WA 3A8QA 2DHJA 2AEHA 1MIXA 4HAZB 2D9WA 2MWNB 2YVCA 2I1KA 1FHOA 2I5CA 4D0NB 5LOPB 2D9YA 3FM8C 1U27A 2DYNA 3AU4A 5FI1A 4A5KA 2D11A 2G35A 3TVVA 2CAYA 1DDMA 3FSSA 3NSUA 2H7DA 1H4RA 1X86A 4HAWB 1QC6A 2LKOA 4YL8A 3SYXA 2DYQA 4DXAB 2J0MA 2OQBA 3PSCA 1MIZB 1LB1A 1ZSQA 3LJUX 2D4QA 5C5BB 4C0AA 2M38A 4HAVB 1FB8A 5J3TA 4KHAA 3MDBC 1U5EA 2ROZB 2PZ1A 2KUPA 4DX90 5D3XA 1MAIA 3VOQA 4GN1A 3RCPA 1U2BA 2VSZA 1I2HA 1LW3A 5C6RA 3ODOA 4NSWA 4Y94A 3QIJA 5DHAB 2P0DA 4GMVA 5HE0A 3SUZA 2UZSA 2Y8GA 1X05A 1RJ2A 3ULBA 1V89A 1RRPB 1P5TA 1B55A 2DX5A 4CYEA 3U8ZA 1ZC3B 5JHGA 2FJLA 4HB0B 2R0DA 3ODWA 2P8VA 3MPXA 1M7RA 2D9ZA 2AL6A 3KRWA 5HE1A 2RNRB 4IFSA 4TKNA 1M7EA 3CXBB 3ZDTA 1PLSA 5D3WA 2XQNM 4Z2MB 2W2WA 4K17A 4GXBA 1UEFA 4H8SA 1W1GA 2CODA 1TXDA 2DN6A 1BAKA 3G9WA 3HW2B 1PMSA 5DIFB 2EMTA 2IFSA 4TYZA 4EKUA 2D10A 4HAUB 2P0FA 2RSGA 1QQGA 2YS3A 2N23A 3QWMA 1X11A 1V5UA 4WVFB 2GS0A 4HB4B 4KAXB 4KVGB 1Q67A 1XCGA 4K81A 4IAPA 5KCVA 2LULA 2YF0A 1UNRA 3PVUA 4KHOA 2DLWA 5JP4A 5J3YA 2D9VA 1DDVA 2JP2A 5DHFB 4KHBB 3WYFB 3QBVB
chains in the Genus database with same CATH superfamily
3OHMB 1U5DA 2KUQA 2CY4A 2N0YA 5DI9B 2RRFA 1W1DA 1NTVA 4HAYB 2CRFA 2DHIA 3SV1A 4MY6A 2DA0A 1FHXA 2I1JA 2J0JA 2NBVA 1MK9B 3GYOA 4HATB 2YS5A 2LOZA 1BTNA 2UZRA 4L1RA 4L6EA 4EJNA 5KQ4A 1FHWA 1FGZA 2K2JA 2W2XD 5D3YA 2L1CA 1EGXA 3D8FA 1AWEA 1V61A 2Z59A 3O96A 4DIXA 1FGYA 1GG3A 5C79A 3A98B 2BCJA 2DX1A 1EVHA 1U5GA 2EJ8A 3GYPA 1OMWA 3PVWA 1WJMA 3V5WA 1UPRA 2EMSA 3X23A 4A6FA 1TQZA 2FJUB 4PQ0A 3AJ4A 2ROVA 1X1GA 2COFA 2ELAA 2UVMA 3DXDA 1MPHA 1WG7A 2RUKB 3DCXA 1V5MA 2YSZA 1NU2A 4YONA 4QXAB 1N3HA 1IRSA 2MKRA 5JLJB 2ELBA 2YRYA 4KHBA 3F0WA 4XWXA 2R09A 3TFMA 2HE7A 1NTYA 2VRWB 1V5PA 2GUMA 1ZC4B 3KY9A 3NWAA 1DYNA 3PVLA 4GNKB 4A6KA 1DBHA 2IYBA 1PFJA 2MDXA 3D8EA 4P7IA 1K5DB 2ZPYA 5CLLB 5HE2A 3AU5A 2DFKA 1GC6A 1J19A 2I5FA 4GMXB 4ZRJA 5C5BA 3SO6A 3HQCA 5L81A 4NY0A 4GPTB 3FEHA 2Y8FA 3HK0A 5I2MA 1U5FA 5GOWB 2Z0OA 3OANA 2Z0QA 3PP2A 5D3VA 1SGHA 1U29A 2COAA 3KZ1A 2D9XA 4QJ5B 4F7HA 3N7CA 3BJIA 4MT7A 4ZRIA 1ZYIA 4K2OA 2EC1A 2DKQA 3VIAA 3P6AA 4F7GA 1MK7B 2Y7BA 1GC7A 1ISNA 4HSIA 2QKLA 5CLQB 1KI1B 1X1FA 3IVFA 2P0HA 5HE3A 1XD4A 3P7ZA 1BWNA 1OQNA 2X18A 3A58A 4A6HA 1Y19B 2Z4DA 3CIKA 5JHHA 1WGUA 3KSYA 4HDOA 2DHKA 3T06A 2LOXA 1DDWA 1DROA 3D8DA 2GJYA 2K00A 3TCAA 3UZTA 1WJ1A 3HIEA 1XODA 4F7UP 1BTKA 3M1IB 2K8EA 2Z13A 4BBKA 2Q13A 2KR0A 2J59M 2VKIA 1MKEA 4WSFA 2NZ8B 4K2PA 2Z0PA 2RLOA 3U7DA 3ML4A 5KQ1A 2ZKMX 5M4YB 5I2SA 3BINA 1WGQA 3DXCA 3ZVRA 3KRXA 4B6HA 2OTXA 4MK0A 5LONB 1XKEA 5C16A 2QKMA 2LG1A 3F5RA 2MFQA 1Y5OA 4EMOA 2M14A 2YT0A 4PNKA 4Z2NA 1P3RA 1T77A 3TO1A 1FOEA 3SNHA 1UPQA 1XR0B 1ZM0A 4GZUA 4HB2B 1UNQA 2RGNB 4DX8A 1V88A 1H10A 3PEGA 1KZGA 5EFXA 1AQCA 1KZ7A 4ZRKA 2DKPA 3PZDA 2ADZA 2DTCA 1P6SA 4CHMA 3ULCA 2NMBA 2J0KA 1UNPA 1Z87A 4HB3B 2KGXB 1OY2A 2D2QA 4HAXB 3ODXA 4CHJA 1EF1A 1ZVRA 5D27A 2KCJA 4DBBA 1I7AA 3U12A 2K2UA 3DXEA 1K5GB 5IRSA 4HHVA 2W2XC 4WJ7A 2HTHB 3WA0A 1FAOA 2H7EA 2LYDA 1TJ6A 2GCLA 5FI0A 3PG7A 2RVBB 2Z14A 1EAZA 2L2IA 1WVHA 2V76A 1WI1A 1W1HA 1XX0A 2COCA 3NWFA 3TW1A 4HDQA 2GCJA 4IOYX 1J0WA 2YT1A 2E2XA 1NI2A 4A6FB 2CY5A 5DH9B 1SHCA 3A8PA 2YS1A 5J3QA 1E5WA 3A8QA 2DHJA 2AEHA 1MIXA 4HAZB 2D9WA 4CSQA 2MWNB 2YVCA 2I1KA 1FHOA 2I5CA 4D0NB 5LOPB 2D9YA 3FM8C 1U27A 2K49A 2DYNA 3NWDA 3AU4A 4GOUA 5FI1A 4A5KA 2D11A 2G35A 3TVVA 2CAYA 1DDMA 3FSSA 3NSUA 2H7DA 1H4RA 1X86A 4HAWB 1QC6A 2LKOA 4YL8A 3SYXA 4QJ4B 2YT2A 3B77A 3HSAA 2DYQA 3FVCA 4DXAB 2J0MA 2OQBA 3PSCA 1MIZB 1LB1A 1ZSQA 3LJUX 2D4QA 5C5BB 4C0AA 2M38A 4HAVB 1FB8A 5J3TA 4KHAA 3MDBC 5LG4B 1U5EA 2ROZB 2PZ1A 2KUPA 4DX90 2KIGA 5D3XA 1MAIA 3VOQA 3NW8A 4GN1A 3RCPA 1U2BA 2VSZA 1I2HA 1LW3A 5C6RA 3ODOA 4NSWA 4Y94A 3QIJA 5DHAB 2P0DA 4GMVA 5HE0A 3SUZA 2UZSA 2Y8GA 1X05A 1RJ2A 3ULBA 1V89A 1RRPB 1P5TA 1B55A 2DX5A 4CYEA 3U8ZA 1ZC3B 5JHGA 2FJLA 4HB0B 2R0DA 3ODWA 2P8VA 3MPXA 1M7RA 2D9ZA 2AL6A 3KRWA 5HE1A 2RNRB 4IFSA 4TKNA 1M7EA 3CXBB 3ZDTA 1PLSA 5D3WA 2XQNM 4Z2MB 2W2WA 4K17A 4GXBA 1UEFA 4H8SA 1W1GA 2CODA 1TXDA 2DN6A 4QJ3B 4OSNA 1BAKA 3G9WA 3HW2B 1PMSA 5DIFB 2EMTA 2IFSA 1MI1A 4TYZA 4EKUA 4D6WA 2D10A 4HAUB 2P0FA 4OT1A 2RSGA 1QQGA 2YS3A 2N23A 3QWMA 1X11A 1V5UA 4WVFB 2GS0A 4HB4B 4KAXB 4KVGB 2R2YA 1Q67A 1XCGA 4K81A 2KIEA 4IAPA 5KCVA 2LULA 2YF0A 1UNRA 3PVUA 4KHOA 2DLWA 5JP4A 5J3YA 2D9VA 1DDVA 2JP2A 5DHFB 4KHBB 3WYFB 3QBVB
chains in the Genus database with same CATH topology
1U5DA 2CY4A 2N0YA 5DI9B 1W1DA 1NTVA 4HAYB 2CRFA 2DHIA 3SV1A 4MY6A 2DA0A 1FHXA 2I1JA 2J0JA 1MK9B 3GYOA 4HATB 2YS5A 2LOZA 1BTNA 2UZRA 4L6EA 4EJNA 5KQ4A 1FHWA 1FGZA 2K2JA 2W2XD 5D3YA 2L1CA 1EGXA 3D8FA 1AWEA 1V61A 3O96A 1FGYA 1GG3A 5C79A 3A98B 2BCJA 2DX1A 1EVHA 1U5GA 2EJ8A 3GYPA 1OMWA 3PVWA 1WJMA 3V5WA 1UPRA 2EMSA 3X23A 4A6FA 1TQZA 4PQ0A 3AJ4A 2ROVA 1X1GA 2COFA 2ELAA 2UVMA 3DXDA 1MPHA 1WG7A 2RUKB 1V5MA 2YSZA 1NU2A 4YONA 1N3HA 1IRSA 2MKRA 5JLJB 2ELBA 2YRYA 3F0WA 4XWXA 2R09A 3TFMA 2HE7A 1NTYA 2VRWB 1V5PA 1ZC4B 3KY9A 1DYNA 3PVLA 4A6KA 1DBHA 2IYBA 1PFJA 2MDXA 3D8EA 4P7IA 1K5DB 2ZPYA 5CLLB 5HE2A 3AU5A 2DFKA 1GC6A 1J19A 2I5FA 4GMXB 4ZRJA 5C5BA 3SO6A 3HQCA 5L81A 4NY0A 4GPTB 3FEHA 2Y8FA 3HK0A 1U5FA 5GOWB 2Z0OA 3OANA 2Z0QA 3PP2A 5D3VA 1SGHA 1U29A 2COAA 3KZ1A 2D9XA 4F7HA 3N7CA 3BJIA 4MT7A 4ZRIA 4K2OA 2EC1A 2DKQA 3VIAA 3P6AA 4F7GA 1MK7B 2Y7BA 1GC7A 1ISNA 2QKLA 5CLQB 1KI1B 1X1FA 3IVFA 2P0HA 5HE3A 1XD4A 3P7ZA 1BWNA 1OQNA 2X18A 4A6HA 1Y19B 3CIKA 5JHHA 1WGUA 3KSYA 4HDOA 2DHKA 3T06A 2LOXA 1DDWA 1DROA 3D8DA 2GJYA 2K00A 3TCAA 3UZTA 1WJ1A 1XODA 4F7UP 1BTKA 3M1IB 4BBKA 2Q13A 2J59M 2VKIA 1MKEA 4WSFA 2NZ8B 4K2PA 2Z0PA 2RLOA 3U7DA 3ML4A 5KQ1A 3BINA 1WGQA 3DXCA 3ZVRA 3KRXA 4B6HA 2OTXA 4MK0A 5LONB 1XKEA 5C16A 2QKMA 2LG1A 3F5RA 2MFQA 1Y5OA 4EMOA 2M14A 2YT0A 4PNKA 4Z2NA 1P3RA 3TO1A 1FOEA 3SNHA 1UPQA 1XR0B 1ZM0A 4GZUA 4HB2B 1UNQA 2RGNB 4DX8A 1V88A 1H10A 3PEGA 1KZGA 5EFXA 1AQCA 1KZ7A 4ZRKA 2DKPA 3PZDA 2ADZA 2DTCA 1P6SA 4CHMA 3ULCA 2NMBA 2J0KA 1UNPA 1Z87A 4HB3B 2KGXB 1OY2A 2D2QA 4HAXB 3ODXA 4CHJA 1EF1A 1ZVRA 5D27A 2KCJA 4DBBA 1I7AA 2K2UA 3DXEA 1K5GB 4HHVA 2W2XC 4WJ7A 2HTHB 3WA0A 1FAOA 2H7EA 2LYDA 1TJ6A 2GCLA 5FI0A 3PG7A 2RVBB 1EAZA 2L2IA 1WVHA 2V76A 1WI1A 1W1HA 1XX0A 2COCA 3TW1A 4HDQA 2GCJA 4IOYX 1J0WA 2YT1A 2E2XA 1NI2A 4A6FB 2CY5A 5DH9B 1SHCA 3A8PA 2YS1A 5J3QA 1E5WA 3A8QA 2DHJA 2AEHA 1MIXA 4HAZB 2D9WA 2MWNB 2YVCA 2I1KA 1FHOA 2I5CA 4D0NB 5LOPB 2D9YA 3FM8C 1U27A 2DYNA 3AU4A 5FI1A 4A5KA 2D11A 2G35A 3TVVA 2CAYA 1DDMA 3FSSA 3NSUA 2H7DA 1H4RA 1X86A 4HAWB 1QC6A 2LKOA 4YL8A 3SYXA 2DYQA 4DXAB 2J0MA 2OQBA 3PSCA 1MIZB 1LB1A 1ZSQA 3LJUX 2D4QA 5C5BB 4C0AA 2M38A 4HAVB 1FB8A 5J3TA 4KHAA 3MDBC 1U5EA 2ROZB 2PZ1A 2KUPA 4DX90 5D3XA 1MAIA 3VOQA 4GN1A 3RCPA 1U2BA 2VSZA 1I2HA 1LW3A 5C6RA 3ODOA 4NSWA 4Y94A 3QIJA 5DHAB 2P0DA 4GMVA 5HE0A 3SUZA 2UZSA 2Y8GA 1X05A 1RJ2A 3ULBA 1V89A 1RRPB 1P5TA 1B55A 2DX5A 4CYEA 3U8ZA 1ZC3B 5JHGA 2FJLA 4HB0B 2R0DA 3ODWA 2P8VA 3MPXA 1M7RA 2D9ZA 2AL6A 3KRWA 5HE1A 2RNRB 4IFSA 4TKNA 1M7EA 3CXBB 3ZDTA 1PLSA 5D3WA 2XQNM 4Z2MB 2W2WA 4K17A 4GXBA 1UEFA 4H8SA 1W1GA 2CODA 1TXDA 2DN6A 1BAKA 3G9WA 3HW2B 1PMSA 5DIFB 2EMTA 2IFSA 4TYZA 4EKUA 2D10A 4HAUB 2P0FA 2RSGA 1QQGA 2YS3A 2N23A 3QWMA 1X11A 1V5UA 4WVFB 2GS0A 4HB4B 4KAXB 4KVGB 1Q67A 1XCGA 4K81A 4IAPA 5KCVA 2LULA 2YF0A 1UNRA 3PVUA 4KHOA 2DLWA 5JP4A 5J3YA 2D9VA 1DDVA 2JP2A 5DHFB 4KHBB 3WYFB 3QBVB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1U5D A;  2CY4 A;  2N0Y A;  5DI9 B;  1W1D A;  1NTV A;  4HAY B;  2CRF A;  2DHI A;  3SV1 A;  4MY6 A;  2DA0 A;  1FHX A;  2I1J A;  2J0J A;  1MK9 B;  3GYO A;  4HAT B;  2YS5 A;  2LOZ A;  1BTN A;  2UZR A;  4L6E A;  4EJN A;  5KQ4 A;  1FHW A;  1FGZ A;  2K2J A;  2W2X D;  5D3Y A;  2L1C A;  1EGX A;  3D8F A;  1AWE A;  1V61 A;  3O96 A;  1FGY A;  1GG3 A;  5C79 A;  3A98 B;  2BCJ A;  2DX1 A;  1EVH A;  1U5G A;  2EJ8 A;  3GYP A;  1OMW A;  3PVW A;  1WJM A;  3V5W A;  1UPR A;  2EMS A;  3X23 A;  4A6F A;  1TQZ A;  4PQ0 A;  3AJ4 A;  2ROV A;  1X1G A;  2COF A;  2ELA A;  2UVM A;  3DXD A;  1MPH A;  1WG7 A;  2RUK B;  1V5M A;  2YSZ A;  1NU2 A;  4YON A;  1N3H A;  1IRS A;  2MKR A;  5JLJ B;  2ELB A;  2YRY A;  3F0W A;  4XWX A;  2R09 A;  3TFM A;  2HE7 A;  1NTY A;  2VRW B;  1V5P A;  1ZC4 B;  3KY9 A;  1DYN A;  3PVL A;  4A6K A;  1DBH A;  2IYB A;  1PFJ A;  2MDX A;  3D8E A;  4P7I A;  1K5D B;  2ZPY A;  5CLL B;  5HE2 A;  3AU5 A;  2DFK A;  1GC6 A;  1J19 A;  2I5F A;  4GMX B;  4ZRJ A;  5C5B A;  3SO6 A;  3HQC A;  5L81 A;  4NY0 A;  4GPT B;  3FEH A;  2Y8F A;  3HK0 A;  1U5F A;  5GOW B;  2Z0O A;  3OAN A;  2Z0Q A;  3PP2 A;  5D3V A;  1SGH A;  1U29 A;  2COA A;  3KZ1 A;  2D9X A;  4F7H A;  3N7C A;  3BJI A;  4MT7 A;  4ZRI A;  4K2O A;  2EC1 A;  2DKQ A;  3VIA A;  3P6A A;  4F7G A;  1MK7 B;  2Y7B A;  1GC7 A;  1ISN A;  2QKL A;  5CLQ B;  1KI1 B;  1X1F A;  3IVF A;  2P0H A;  5HE3 A;  1XD4 A;  3P7Z A;  1BWN A;  1OQN A;  2X18 A;  4A6H A;  1Y19 B;  3CIK A;  5JHH A;  1WGU A;  3KSY A;  4HDO A;  2DHK A;  3T06 A;  2LOX A;  1DDW A;  1DRO A;  3D8D A;  2GJY A;  2K00 A;  3TCA A;  3UZT A;  1WJ1 A;  1XOD A;  4F7U P;  1BTK A;  3M1I B;  4BBK A;  2Q13 A;  2J59 M;  2VKI A;  1MKE A;  4WSF A;  2NZ8 B;  4K2P A;  2Z0P A;  2RLO A;  3U7D A;  3ML4 A;  5KQ1 A;  3BIN A;  1WGQ A;  3DXC A;  3ZVR A;  3KRX A;  4B6H A;  2OTX A;  4MK0 A;  5LON B;  1XKE A;  5C16 A;  2QKM A;  2LG1 A;  3F5R A;  2MFQ A;  1Y5O A;  4EMO A;  2M14 A;  2YT0 A;  4PNK A;  4Z2N A;  1P3R A;  3TO1 A;  1FOE A;  3SNH A;  1UPQ A;  1XR0 B;  1ZM0 A;  4GZU A;  4HB2 B;  1UNQ A;  2RGN B;  4DX8 A;  1V88 A;  1H10 A;  3PEG A;  1KZG A;  5EFX A;  1AQC A;  1KZ7 A;  4ZRK A;  2DKP A;  3PZD A;  2ADZ A;  2DTC A;  1P6S A;  4CHM A;  3ULC A;  2NMB A;  2J0K A;  1UNP A;  1Z87 A;  4HB3 B;  2KGX B;  1OY2 A;  2D2Q A;  4HAX B;  3ODX A;  4CHJ A;  1EF1 A;  1ZVR A;  5D27 A;  2KCJ A;  4DBB A;  1I7A A;  2K2U A;  3DXE A;  1K5G B;  4HHV A;  2W2X C;  4WJ7 A;  2HTH B;  3WA0 A;  1FAO A;  2H7E A;  2LYD A;  1TJ6 A;  2GCL A;  5FI0 A;  3PG7 A;  2RVB B;  1EAZ A;  2L2I A;  1WVH A;  2V76 A;  1WI1 A;  1W1H A;  1XX0 A;  2COC A;  3TW1 A;  4HDQ A;  2GCJ A;  4IOY X;  1J0W A;  2YT1 A;  2E2X A;  1NI2 A;  4A6F B;  2CY5 A;  5DH9 B;  1SHC A;  3A8P A;  2YS1 A;  5J3Q A;  1E5W A;  3A8Q A;  2DHJ A;  2AEH A;  1MIX A;  4HAZ B;  2D9W A;  2MWN B;  2YVC A;  2I1K A;  1FHO A;  2I5C A;  4D0N B;  5LOP B;  2D9Y A;  3FM8 C;  1U27 A;  2DYN A;  3AU4 A;  5FI1 A;  4A5K A;  2D11 A;  2G35 A;  3TVV A;  2CAY A;  1DDM A;  3FSS A;  3NSU A;  2H7D A;  1H4R A;  1X86 A;  4HAW B;  1QC6 A;  2LKO A;  4YL8 A;  3SYX A;  2DYQ A;  4DXA B;  2J0M A;  2OQB A;  3PSC A;  1MIZ B;  1LB1 A;  1ZSQ A;  3LJU X;  2D4Q A;  5C5B B;  4C0A A;  2M38 A;  4HAV B;  1FB8 A;  5J3T A;  4KHA A;  3MDB C;  1U5E A;  2ROZ B;  2PZ1 A;  2KUP A;  4DX9 0;  5D3X A;  1MAI A;  3VOQ A;  4GN1 A;  3RCP A;  1U2B A;  2VSZ A;  1I2H A;  1LW3 A;  5C6R A;  3ODO A;  4NSW A;  4Y94 A;  3QIJ A;  5DHA B;  2P0D A;  4GMV A;  5HE0 A;  3SUZ A;  2UZS A;  2Y8G A;  1X05 A;  1RJ2 A;  3ULB A;  1V89 A;  1RRP B;  1P5T A;  1B55 A;  2DX5 A;  4CYE A;  3U8Z A;  1ZC3 B;  5JHG A;  2FJL A;  4HB0 B;  2R0D A;  3ODW A;  2P8V A;  3MPX A;  1M7R A;  2D9Z A;  2AL6 A;  3KRW A;  5HE1 A;  2RNR B;  4IFS A;  4TKN A;  1M7E A;  3CXB B;  3ZDT A;  1PLS A;  5D3W A;  2XQN M;  4Z2M B;  2W2W A;  4K17 A;  4GXB A;  1UEF A;  4H8S A;  1W1G A;  2COD A;  1TXD A;  2DN6 A;  1BAK A;  3G9W A;  3HW2 B;  1PMS A;  5DIF B;  2EMT A;  2IFS A;  4TYZ A;  4EKU A;  2D10 A;  4HAU B;  2P0F A;  2RSG A;  1QQG A;  2YS3 A;  2N23 A;  3QWM A;  1X11 A;  1V5U A;  4WVF B;  2GS0 A;  4HB4 B;  4KAX B;  4KVG B;  1Q67 A;  1XCG A;  4K81 A;  4IAP A;  5KCV A;  2LUL A;  2YF0 A;  1UNR A;  3PVU A;  4KHO A;  2DLW A;  5JP4 A;  5J3Y A;  2D9V A;  1DDV A;  2JP2 A;  5DHF B;  4KHB B;  3WYF B;  3QBV B; 
#chains in the Genus database with same CATH topology
 3OHM B;  1U5D A;  2KUQ A;  2CY4 A;  2N0Y A;  5DI9 B;  2RRF A;  1W1D A;  1NTV A;  4HAY B;  2CRF A;  2DHI A;  3SV1 A;  4MY6 A;  2DA0 A;  1FHX A;  2I1J A;  2J0J A;  2NBV A;  1MK9 B;  3GYO A;  4HAT B;  2YS5 A;  2LOZ A;  1BTN A;  2UZR A;  4L1R A;  4L6E A;  4EJN A;  5KQ4 A;  1FHW A;  1FGZ A;  2K2J A;  2W2X D;  5D3Y A;  2L1C A;  1EGX A;  3D8F A;  1AWE A;  1V61 A;  2Z59 A;  3O96 A;  4DIX A;  1FGY A;  1GG3 A;  5C79 A;  3A98 B;  2BCJ A;  2DX1 A;  1EVH A;  1U5G A;  2EJ8 A;  3GYP A;  1OMW A;  3PVW A;  1WJM A;  3V5W A;  1UPR A;  2EMS A;  3X23 A;  4A6F A;  1TQZ A;  2FJU B;  4PQ0 A;  3AJ4 A;  2ROV A;  1X1G A;  2COF A;  2ELA A;  2UVM A;  3DXD A;  1MPH A;  1WG7 A;  2RUK B;  3DCX A;  1V5M A;  2YSZ A;  1NU2 A;  4YON A;  4QXA B;  1N3H A;  1IRS A;  2MKR A;  5JLJ B;  2ELB A;  2YRY A;  4KHB A;  3F0W A;  4XWX A;  2R09 A;  3TFM A;  2HE7 A;  1NTY A;  2VRW B;  1V5P A;  2GUM A;  1ZC4 B;  3KY9 A;  3NWA A;  1DYN A;  3PVL A;  4GNK B;  4A6K A;  1DBH A;  2IYB A;  1PFJ A;  2MDX A;  3D8E A;  4P7I A;  1K5D B;  2ZPY A;  5CLL B;  5HE2 A;  3AU5 A;  2DFK A;  1GC6 A;  1J19 A;  2I5F A;  4GMX B;  4ZRJ A;  5C5B A;  3SO6 A;  3HQC A;  5L81 A;  4NY0 A;  4GPT B;  3FEH A;  2Y8F A;  3HK0 A;  5I2M A;  1U5F A;  5GOW B;  2Z0O A;  3OAN A;  2Z0Q A;  3PP2 A;  5D3V A;  1SGH A;  1U29 A;  2COA A;  3KZ1 A;  2D9X A;  4QJ5 B;  4F7H A;  3N7C A;  3BJI A;  4MT7 A;  4ZRI A;  1ZYI A;  4K2O A;  2EC1 A;  2DKQ A;  3VIA A;  3P6A A;  4F7G A;  1MK7 B;  2Y7B A;  1GC7 A;  1ISN A;  4HSI A;  2QKL A;  5CLQ B;  1KI1 B;  1X1F A;  3IVF A;  2P0H A;  5HE3 A;  1XD4 A;  3P7Z A;  1BWN A;  1OQN A;  2X18 A;  3A58 A;  4A6H A;  1Y19 B;  2Z4D A;  3CIK A;  5JHH A;  1WGU A;  3KSY A;  4HDO A;  2DHK A;  3T06 A;  2LOX A;  1DDW A;  1DRO A;  3D8D A;  2GJY A;  2K00 A;  3TCA A;  3UZT A;  1WJ1 A;  3HIE A;  1XOD A;  4F7U P;  1BTK A;  3M1I B;  2K8E A;  2Z13 A;  4BBK A;  2Q13 A;  2KR0 A;  2J59 M;  2VKI A;  1MKE A;  4WSF A;  2NZ8 B;  4K2P A;  2Z0P A;  2RLO A;  3U7D A;  3ML4 A;  5KQ1 A;  2ZKM X;  5M4Y B;  5I2S A;  3BIN A;  1WGQ A;  3DXC A;  3ZVR A;  3KRX A;  4B6H A;  2OTX A;  4MK0 A;  5LON B;  1XKE A;  5C16 A;  2QKM A;  2LG1 A;  3F5R A;  2MFQ A;  1Y5O A;  4EMO A;  2M14 A;  2YT0 A;  4PNK A;  4Z2N A;  1P3R A;  1T77 A;  3TO1 A;  1FOE A;  3SNH A;  1UPQ A;  1XR0 B;  1ZM0 A;  4GZU A;  4HB2 B;  1UNQ A;  2RGN B;  4DX8 A;  1V88 A;  1H10 A;  3PEG A;  1KZG A;  5EFX A;  1AQC A;  1KZ7 A;  4ZRK A;  2DKP A;  3PZD A;  2ADZ A;  2DTC A;  1P6S A;  4CHM A;  3ULC A;  2NMB A;  2J0K A;  1UNP A;  1Z87 A;  4HB3 B;  2KGX B;  1OY2 A;  2D2Q A;  4HAX B;  3ODX A;  4CHJ A;  1EF1 A;  1ZVR A;  5D27 A;  2KCJ A;  4DBB A;  1I7A A;  3U12 A;  2K2U A;  3DXE A;  1K5G B;  5IRS A;  4HHV A;  2W2X C;  4WJ7 A;  2HTH B;  3WA0 A;  1FAO A;  2H7E A;  2LYD A;  1TJ6 A;  2GCL A;  5FI0 A;  3PG7 A;  2RVB B;  2Z14 A;  1EAZ A;  2L2I A;  1WVH A;  2V76 A;  1WI1 A;  1W1H A;  1XX0 A;  2COC A;  3NWF A;  3TW1 A;  4HDQ A;  2GCJ A;  4IOY X;  1J0W A;  2YT1 A;  2E2X A;  1NI2 A;  4A6F B;  2CY5 A;  5DH9 B;  1SHC A;  3A8P A;  2YS1 A;  5J3Q A;  1E5W A;  3A8Q A;  2DHJ A;  2AEH A;  1MIX A;  4HAZ B;  2D9W A;  4CSQ A;  2MWN B;  2YVC A;  2I1K A;  1FHO A;  2I5C A;  4D0N B;  5LOP B;  2D9Y A;  3FM8 C;  1U27 A;  2K49 A;  2DYN A;  3NWD A;  3AU4 A;  4GOU A;  5FI1 A;  4A5K A;  2D11 A;  2G35 A;  3TVV A;  2CAY A;  1DDM A;  3FSS A;  3NSU A;  2H7D A;  1H4R A;  1X86 A;  4HAW B;  1QC6 A;  2LKO A;  4YL8 A;  3SYX A;  4QJ4 B;  2YT2 A;  3B77 A;  3HSA A;  2DYQ A;  3FVC A;  4DXA B;  2J0M A;  2OQB A;  3PSC A;  1MIZ B;  1LB1 A;  1ZSQ A;  3LJU X;  2D4Q A;  5C5B B;  4C0A A;  2M38 A;  4HAV B;  1FB8 A;  5J3T A;  4KHA A;  3MDB C;  5LG4 B;  1U5E A;  2ROZ B;  2PZ1 A;  2KUP A;  4DX9 0;  2KIG A;  5D3X A;  1MAI A;  3VOQ A;  3NW8 A;  4GN1 A;  3RCP A;  1U2B A;  2VSZ A;  1I2H A;  1LW3 A;  5C6R A;  3ODO A;  4NSW A;  4Y94 A;  3QIJ A;  5DHA B;  2P0D A;  4GMV A;  5HE0 A;  3SUZ A;  2UZS A;  2Y8G A;  1X05 A;  1RJ2 A;  3ULB A;  1V89 A;  1RRP B;  1P5T A;  1B55 A;  2DX5 A;  4CYE A;  3U8Z A;  1ZC3 B;  5JHG A;  2FJL A;  4HB0 B;  2R0D A;  3ODW A;  2P8V A;  3MPX A;  1M7R A;  2D9Z A;  2AL6 A;  3KRW A;  5HE1 A;  2RNR B;  4IFS A;  4TKN A;  1M7E A;  3CXB B;  3ZDT A;  1PLS A;  5D3W A;  2XQN M;  4Z2M B;  2W2W A;  4K17 A;  4GXB A;  1UEF A;  4H8S A;  1W1G A;  2COD A;  1TXD A;  2DN6 A;  4QJ3 B;  4OSN A;  1BAK A;  3G9W A;  3HW2 B;  1PMS A;  5DIF B;  2EMT A;  2IFS A;  1MI1 A;  4TYZ A;  4EKU A;  4D6W A;  2D10 A;  4HAU B;  2P0F A;  4OT1 A;  2RSG A;  1QQG A;  2YS3 A;  2N23 A;  3QWM A;  1X11 A;  1V5U A;  4WVF B;  2GS0 A;  4HB4 B;  4KAX B;  4KVG B;  2R2Y A;  1Q67 A;  1XCG A;  4K81 A;  2KIE A;  4IAP A;  5KCV A;  2LUL A;  2YF0 A;  1UNR A;  3PVU A;  4KHO A;  2DLW A;  5JP4 A;  5J3Y A;  2D9V A;  1DDV A;  2JP2 A;  5DHF B;  4KHB B;  3WYF B;  3QBV B; 
#chains in the Genus database with same CATH homology
 1U5D A;  2CY4 A;  2N0Y A;  5DI9 B;  1W1D A;  1NTV A;  4HAY B;  2CRF A;  2DHI A;  3SV1 A;  4MY6 A;  2DA0 A;  1FHX A;  2I1J A;  2J0J A;  1MK9 B;  3GYO A;  4HAT B;  2YS5 A;  2LOZ A;  1BTN A;  2UZR A;  4L6E A;  4EJN A;  5KQ4 A;  1FHW A;  1FGZ A;  2K2J A;  2W2X D;  5D3Y A;  2L1C A;  1EGX A;  3D8F A;  1AWE A;  1V61 A;  3O96 A;  1FGY A;  1GG3 A;  5C79 A;  3A98 B;  2BCJ A;  2DX1 A;  1EVH A;  1U5G A;  2EJ8 A;  3GYP A;  1OMW A;  3PVW A;  1WJM A;  3V5W A;  1UPR A;  2EMS A;  3X23 A;  4A6F A;  1TQZ A;  4PQ0 A;  3AJ4 A;  2ROV A;  1X1G A;  2COF A;  2ELA A;  2UVM A;  3DXD A;  1MPH A;  1WG7 A;  2RUK B;  1V5M A;  2YSZ A;  1NU2 A;  4YON A;  1N3H A;  1IRS A;  2MKR A;  5JLJ B;  2ELB A;  2YRY A;  3F0W A;  4XWX A;  2R09 A;  3TFM A;  2HE7 A;  1NTY A;  2VRW B;  1V5P A;  1ZC4 B;  3KY9 A;  1DYN A;  3PVL A;  4A6K A;  1DBH A;  2IYB A;  1PFJ A;  2MDX A;  3D8E A;  4P7I A;  1K5D B;  2ZPY A;  5CLL B;  5HE2 A;  3AU5 A;  2DFK A;  1GC6 A;  1J19 A;  2I5F A;  4GMX B;  4ZRJ A;  5C5B A;  3SO6 A;  3HQC A;  5L81 A;  4NY0 A;  4GPT B;  3FEH A;  2Y8F A;  3HK0 A;  1U5F A;  5GOW B;  2Z0O A;  3OAN A;  2Z0Q A;  3PP2 A;  5D3V A;  1SGH A;  1U29 A;  2COA A;  3KZ1 A;  2D9X A;  4F7H A;  3N7C A;  3BJI A;  4MT7 A;  4ZRI A;  4K2O A;  2EC1 A;  2DKQ A;  3VIA A;  3P6A A;  4F7G A;  1MK7 B;  2Y7B A;  1GC7 A;  1ISN A;  2QKL A;  5CLQ B;  1KI1 B;  1X1F A;  3IVF A;  2P0H A;  5HE3 A;  1XD4 A;  3P7Z A;  1BWN A;  1OQN A;  2X18 A;  4A6H A;  1Y19 B;  3CIK A;  5JHH A;  1WGU A;  3KSY A;  4HDO A;  2DHK A;  3T06 A;  2LOX A;  1DDW A;  1DRO A;  3D8D A;  2GJY A;  2K00 A;  3TCA A;  3UZT A;  1WJ1 A;  1XOD A;  4F7U P;  1BTK A;  3M1I B;  4BBK A;  2Q13 A;  2J59 M;  2VKI A;  1MKE A;  4WSF A;  2NZ8 B;  4K2P A;  2Z0P A;  2RLO A;  3U7D A;  3ML4 A;  5KQ1 A;  3BIN A;  1WGQ A;  3DXC A;  3ZVR A;  3KRX A;  4B6H A;  2OTX A;  4MK0 A;  5LON B;  1XKE A;  5C16 A;  2QKM A;  2LG1 A;  3F5R A;  2MFQ A;  1Y5O A;  4EMO A;  2M14 A;  2YT0 A;  4PNK A;  4Z2N A;  1P3R A;  3TO1 A;  1FOE A;  3SNH A;  1UPQ A;  1XR0 B;  1ZM0 A;  4GZU A;  4HB2 B;  1UNQ A;  2RGN B;  4DX8 A;  1V88 A;  1H10 A;  3PEG A;  1KZG A;  5EFX A;  1AQC A;  1KZ7 A;  4ZRK A;  2DKP A;  3PZD A;  2ADZ A;  2DTC A;  1P6S A;  4CHM A;  3ULC A;  2NMB A;  2J0K A;  1UNP A;  1Z87 A;  4HB3 B;  2KGX B;  1OY2 A;  2D2Q A;  4HAX B;  3ODX A;  4CHJ A;  1EF1 A;  1ZVR A;  5D27 A;  2KCJ A;  4DBB A;  1I7A A;  2K2U A;  3DXE A;  1K5G B;  4HHV A;  2W2X C;  4WJ7 A;  2HTH B;  3WA0 A;  1FAO A;  2H7E A;  2LYD A;  1TJ6 A;  2GCL A;  5FI0 A;  3PG7 A;  2RVB B;  1EAZ A;  2L2I A;  1WVH A;  2V76 A;  1WI1 A;  1W1H A;  1XX0 A;  2COC A;  3TW1 A;  4HDQ A;  2GCJ A;  4IOY X;  1J0W A;  2YT1 A;  2E2X A;  1NI2 A;  4A6F B;  2CY5 A;  5DH9 B;  1SHC A;  3A8P A;  2YS1 A;  5J3Q A;  1E5W A;  3A8Q A;  2DHJ A;  2AEH A;  1MIX A;  4HAZ B;  2D9W A;  2MWN B;  2YVC A;  2I1K A;  1FHO A;  2I5C A;  4D0N B;  5LOP B;  2D9Y A;  3FM8 C;  1U27 A;  2DYN A;  3AU4 A;  5FI1 A;  4A5K A;  2D11 A;  2G35 A;  3TVV A;  2CAY A;  1DDM A;  3FSS A;  3NSU A;  2H7D A;  1H4R A;  1X86 A;  4HAW B;  1QC6 A;  2LKO A;  4YL8 A;  3SYX A;  2DYQ A;  4DXA B;  2J0M A;  2OQB A;  3PSC A;  1MIZ B;  1LB1 A;  1ZSQ A;  3LJU X;  2D4Q A;  5C5B B;  4C0A A;  2M38 A;  4HAV B;  1FB8 A;  5J3T A;  4KHA A;  3MDB C;  1U5E A;  2ROZ B;  2PZ1 A;  2KUP A;  4DX9 0;  5D3X A;  1MAI A;  3VOQ A;  4GN1 A;  3RCP A;  1U2B A;  2VSZ A;  1I2H A;  1LW3 A;  5C6R A;  3ODO A;  4NSW A;  4Y94 A;  3QIJ A;  5DHA B;  2P0D A;  4GMV A;  5HE0 A;  3SUZ A;  2UZS A;  2Y8G A;  1X05 A;  1RJ2 A;  3ULB A;  1V89 A;  1RRP B;  1P5T A;  1B55 A;  2DX5 A;  4CYE A;  3U8Z A;  1ZC3 B;  5JHG A;  2FJL A;  4HB0 B;  2R0D A;  3ODW A;  2P8V A;  3MPX A;  1M7R A;  2D9Z A;  2AL6 A;  3KRW A;  5HE1 A;  2RNR B;  4IFS A;  4TKN A;  1M7E A;  3CXB B;  3ZDT A;  1PLS A;  5D3W A;  2XQN M;  4Z2M B;  2W2W A;  4K17 A;  4GXB A;  1UEF A;  4H8S A;  1W1G A;  2COD A;  1TXD A;  2DN6 A;  1BAK A;  3G9W A;  3HW2 B;  1PMS A;  5DIF B;  2EMT A;  2IFS A;  4TYZ A;  4EKU A;  2D10 A;  4HAU B;  2P0F A;  2RSG A;  1QQG A;  2YS3 A;  2N23 A;  3QWM A;  1X11 A;  1V5U A;  4WVF B;  2GS0 A;  4HB4 B;  4KAX B;  4KVG B;  1Q67 A;  1XCG A;  4K81 A;  4IAP A;  5KCV A;  2LUL A;  2YF0 A;  1UNR A;  3PVU A;  4KHO A;  2DLW A;  5JP4 A;  5J3Y A;  2D9V A;  1DDV A;  2JP2 A;  5DHF B;  4KHB B;  3WYF B;  3QBV B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...