2D9WA

Solution structure of the ph domain of docking protein 2 from human
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
127
structure length
127
Chain Sequence
GSSGSSGMGDGAVKQGFLYLQQQQTFGKKWRRFGASLYGGSDCALARLELQEGPEKPRRCEAARKVIRLSDCLRVAEAGGEASSPRDTSAFFLETKERLYLLAAPAAERGDWVQAICLLAFSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Docking protein 2
publication title Solution structure of the PH domain of Docking protein 2 from human
rcsb
source organism Homo sapiens
total genus 12
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2005-12-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2d9wA01
4HB0B 3PVLA 3HQCA 3PVUA 2ROZB 4MY6A 3ODOA 2KUPA 4IAPA 4EKUA 2Z0PA 2I1JA 1K5DB 3G9WA 4NSWA 3VIAA 1IRSA 1FAOA 1BAKA 1WJMA 1OMWA 4WSFA 4HATB 1FHOA 3QWMA 1SGHA 4MK0A 1DDVA 1V89A 3PEGA 3PG7A 2G35A 1W1GA 3M1IB 1XX0A 3PP2A 1ISNA 1ZC4B 2DLWA 1TQZA 2DTCA 2J0JA 2N23A 5JHHA 3V5WA 2Y7BA 1W1DA 5HE2A 4ZRJA 2EMSA 3PZDA 1XR0B 2QKLA 1Y19B 1MIZB 3GYOA 2P0FA 1OY2A 1QC6A 1Q67A 2DA0A 2RGNB 4WJ7A 5J3QA 2YT0A 3O96A 5KQ4A 5C16A 2Q13A 2IFSA 1KZGA 5D27A 1WVHA 2PZ1A 3AU4A 4HB3B 1V88A 1FHWA 1PFJA 1X05A 2DYQA 3F0WA 1U27A 3KRWA 4HAUB 3KZ1A 5JHGA 2J0MA 3HW2B 3A8QA 2UVMA 2COFA 3PSCA 2LKOA 4NY0A 1U5GA 5HE3A 4K81A 2YS1A 4KHOA 3RCPA 4KHAA 3LJUX 2J59M 1GC6A 2UZRA 2D2QA 2W2XC 5C6RA 2DHJA 3GYPA 1X1FA 1AQCA 4YL8A 2M38A 3QIJA 2RLOA 1XD4A 3KRXA 2GJYA 4GMXB 4CHJA 2ELAA 5HE1A 3HK0A 2D9YA 1DBHA 1SHCA 3WYFB 2BCJA 3SNHA 2DFKA 2D10A 2JP2A 4GMVA 3FSSA 2DHKA 2H7EA 3ZVRA 4BBKA 2OTXA 1XODA 2RUKB 3NSUA 5DIFB 5FI1A 2Z0OA 3ML4A 2Y8FA 1MPHA 1U5EA 2LG1A 3CIKA 3P7ZA 1EAZA 2GCJA 5JLJB 3IVFA 3D8DA 2K00A 2CRFA 4D0NB 5HE0A 1P6SA 1Z87A 2K2JA 5FI0A 1U5FA 2N0YA 4HB2B 1E5WA 3KSYA 1X11A 3FM8C 1U5DA 2W2WA 3F5RA 2L2IA 1MK7B 5DHAB 1J19A 3ZDTA 2CY4A 3A98B 5J3TA 4GPTB 2YVCA 3T06A 1WGQA 1H10A 4K2OA 2LOXA 2YSZA 3WA0A 2COCA 1ZM0A 1OQNA 5LONB 5CLQB 2MFQA 3CXBB 5DI9B 5LOPB 3MDBC 2D9WA 1X86A 3TO1A 1BTNA 2D11A 2DKPA 4K17A 4GZUA 2DYNA 1UNPA 3PVWA 4PNKA 3QBVB 4MT7A 2XQNM 4ZRKA 1BWNA 5J3YA 4DXAB 1PMSA 3SO6A 2J0KA 4F7GA 2LOZA 2VKIA 5D3YA 4HAYB 2ZPYA 4B6HA 2MWNB 2ADZA 3X23A 1EGXA 2M14A 4KHBB 1FHXA 2DN6A 2EJ8A 2COAA 2GCLA 3TVVA 4A6HA 3SV1A 1MK9B 1NI2A 2R0DA 4IOYX 2HE7A 4F7UP 4CHMA 1DYNA 1Y5OA 5C5BB 1EF1A 4HAZB 4DBBA 4HHVA 2MKRA 2VRWB 1NTVA 4EMOA 4HAVB 1NU2A 2QKMA 1V5PA 1V61A 4HAWB 2E2XA 4K2PA 5KQ1A 3DXEA 1GC7A 4Z2NA 1X1GA 4Z2MB 4C0AA 2W2XD 2YRYA 4P7IA 2IYBA 2FJLA 2YS3A 1UNRA 1ZC3B 3VOQA 2CY5A 5L81A 4L6EA 2R09A 5D3VA 2UZSA 2ELBA 2I5FA 5DHFB 5D3WA 2EMTA 2L1CA 1MAIA 3ODWA 1K5GB 1BTKA 3AJ4A 2HTHB 2ROVA 1FGZA 2AEHA 2D4QA 3MPXA 2KCJA 2OQBA 1EVHA 1DDMA 4XWXA 3SYXA 1ZVRA 1J0WA 1KZ7A 1UPRA 2NMBA 4HAXB 4A6FB 3D8EA 5C79A 2DHIA 1B55A 2D9ZA 5C5BA 2RVBB 1GG3A 1U2BA 1DROA 2I5CA 2VSZA 4DX8A 2GS0A 4EJNA 3A8PA 4Y94A 3BINA 4YONA 2DX1A 1RJ2A 2P0DA 1UPQA 3BJIA 2AL6A 1H4RA 2CODA 4TKNA 3TFMA 2LYDA 2P8VA 5GOWB 2LULA 3D8FA 1U29A 4KAXB 4WVFB 1XCGA 1RRPB 2D9VA 1UEFA 4HDQA 4F7HA 2X18A 3AU5A 1I2HA 4GXBA 2V76A 1WJ1A 4IFSA 1LW3A 3N7CA 1DDWA 3ULBA 1FOEA 2Y8GA 5EFXA 2DX5A 2YS5A 1UNQA 1LB1A 1V5UA 2RNRB 1FB8A 1P3RA 1M7RA 4PQ0A 3SUZA 1I7AA 5DH9B 2D9XA 4A6FA 5CLLB 2K2UA 3UZTA 1WI1A 1ZSQA 4HB4B 1XKEA 5KCVA 3ODXA 4H8SA 3KY9A 4TYZA 1WGUA 2H7DA 2NZ8B 3DXCA 1MKEA 1W1HA 3OANA 1QQGA 1TXDA 2Z0QA 3U8ZA 4HDOA 1MIXA 2EC1A 3U7DA 1FGYA 3FEHA 5D3XA 2RSGA 1WG7A 3TCAA 2CAYA 3P6AA 3TW1A 5JP4A 1NTYA 1N3HA 2I1KA 1KI1B 2YT1A 4DX90 4A6KA 2MDXA 4KVGB 2KGXB 2DKQA 3ULCA 1TJ6A 1P5TA 4A5KA 2P0HA 1AWEA 4CYEA 1V5MA 3DXDA 1M7EA 2YF0A 4GN1A 1PLSA 4ZRIA
chains in the Genus database with same CATH superfamily
4HB0B 3PVLA 3HQCA 3PVUA 2ROZB 4MY6A 3ODOA 2KUPA 5I2SA 4IAPA 4EKUA 2Z0PA 2I1JA 3NW8A 5I2MA 1K5DB 4GNKB 3G9WA 4NSWA 3VIAA 1IRSA 1FAOA 1BAKA 1WJMA 1OMWA 4WSFA 4HATB 1FHOA 3QWMA 1SGHA 3HSAA 4MK0A 1DDVA 1V89A 3PEGA 3PG7A 2G35A 1W1GA 3M1IB 1XX0A 3PP2A 1ISNA 1ZC4B 2DLWA 1TQZA 2DTCA 2J0JA 2N23A 5JHHA 3V5WA 3U12A 2Y7BA 1W1DA 5HE2A 4ZRJA 2EMSA 3PZDA 1XR0B 2QKLA 1Y19B 1MIZB 3GYOA 2KIGA 2P0FA 1OY2A 1QC6A 1Q67A 2DA0A 2RGNB 4WJ7A 5J3QA 2YT0A 3O96A 5KQ4A 5C16A 2Q13A 3NWFA 2IFSA 1KZGA 5D27A 1WVHA 2PZ1A 3AU4A 4HB3B 4D6WA 1V88A 1FHWA 4OT1A 1PFJA 1X05A 2DYQA 3F0WA 1U27A 3KRWA 4HAUB 3KZ1A 5JHGA 2J0MA 2RRFA 3HW2B 3A8QA 2UVMA 2COFA 3PSCA 5M4YB 2LKOA 4NY0A 1U5GA 5HE3A 4K81A 2YS1A 4KHOA 3RCPA 4KHAA 2J59M 1GC6A 2UZRA 3LJUX 2D2QA 2W2XC 5C6RA 2DHJA 3GYPA 1X1FA 1AQCA 4YL8A 2M38A 3QIJA 5IRSA 2RLOA 1XD4A 3KRXA 2GJYA 4GMXB 4CHJA 2ELAA 5HE1A 4DIXA 4HSIA 3HK0A 2D9YA 1DBHA 1SHCA 3WYFB 2BCJA 3SNHA 2DFKA 2D10A 2JP2A 4GMVA 3FSSA 2DHKA 2H7EA 3ZVRA 2GUMA 4BBKA 2OTXA 1XODA 2RUKB 3NSUA 5DIFB 1T77A 5FI1A 2Z0OA 3ML4A 2Y8FA 1MPHA 1U5EA 2LG1A 3CIKA 3P7ZA 1EAZA 2GCJA 5JLJB 3IVFA 3D8DA 2K00A 3A58A 2CRFA 2R2YA 5HE0A 4D0NB 1P6SA 5LG4B 1Z87A 2K2JA 5FI0A 1U5FA 2N0YA 4HB2B 1E5WA 3KSYA 1X11A 3FM8C 3FVCA 1U5DA 2W2WA 3F5RA 2L2IA 1MK7B 5DHAB 1J19A 3ZDTA 2CY4A 3A98B 4CSQA 5J3TA 4GPTB 2YVCA 3T06A 1WGQA 1H10A 4K2OA 2KIEA 2LOXA 2YSZA 3WA0A 2COCA 2FJUB 1ZM0A 1OQNA 5LONB 5CLQB 2MFQA 3CXBB 5DI9B 5LOPB 3MDBC 4QJ4B 2D9WA 3NWDA 1X86A 3TO1A 1BTNA 2D11A 2DKPA 4K17A 4GZUA 2DYNA 1UNPA 3PVWA 4PNKA 3QBVB 4MT7A 2XQNM 4ZRKA 1BWNA 5J3YA 4DXAB 1PMSA 3SO6A 2J0KA 4F7GA 2LOZA 2VKIA 2Z4DA 5D3YA 4HAYB 2ZPYA 4B6HA 2MWNB 2ADZA 3X23A 1EGXA 2M14A 4KHBB 1FHXA 2DN6A 2EJ8A 2COAA 2GCLA 3TVVA 4A6HA 3SV1A 1MK9B 1NI2A 2R0DA 4IOYX 3HIEA 2HE7A 4F7UP 4CHMA 1DYNA 1Y5OA 2KR0A 5C5BB 1EF1A 4HAZB 4DBBA 4HHVA 2MKRA 2VRWB 1NTVA 1MI1A 2ZKMX 4EMOA 4HAVB 1NU2A 4OSNA 2QKMA 1V5PA 1V61A 4HAWB 2KUQA 2E2XA 4K2PA 5KQ1A 3DXEA 1GC7A 4Z2NA 1X1GA 4Z2MB 4C0AA 2W2XD 2YRYA 4P7IA 2IYBA 2FJLA 2YS3A 1UNRA 1ZC3B 3VOQA 2CY5A 5L81A 4L6EA 2R09A 2Z13A 5D3VA 2UZSA 2ELBA 2I5FA 5DHFB 5D3WA 2EMTA 2L1CA 1MAIA 3ODWA 4KHBA 1K5GB 1BTKA 3AJ4A 2HTHB 2ROVA 1FGZA 2AEHA 2D4QA 3MPXA 2KCJA 2OQBA 1EVHA 1DDMA 4XWXA 3SYXA 1ZVRA 1J0WA 1KZ7A 1UPRA 2NMBA 4HAXB 4A6FB 3D8EA 5C79A 2DHIA 2Z59A 1B55A 2D9ZA 3DCXA 5C5BA 2RVBB 4QXAB 1GG3A 1U2BA 1DROA 2I5CA 2VSZA 4DX8A 2GS0A 4EJNA 3A8PA 4Y94A 3BINA 4YONA 2DX1A 1RJ2A 2P0DA 1UPQA 3BJIA 2AL6A 1H4RA 2CODA 4TKNA 3TFMA 2LYDA 2P8VA 5GOWB 2LULA 3D8FA 1U29A 4KAXB 4WVFB 1XCGA 1RRPB 2D9VA 1UEFA 4HDQA 4F7HA 2X18A 3AU5A 1I2HA 3B77A 4GXBA 2V76A 1WJ1A 4IFSA 1LW3A 3N7CA 1DDWA 3ULBA 1FOEA 2Y8GA 2K49A 5EFXA 2DX5A 2YS5A 1UNQA 1LB1A 1V5UA 1ZYIA 2RNRB 1FB8A 1P3RA 1M7RA 4PQ0A 3SUZA 1I7AA 5DH9B 2D9XA 4A6FA 5CLLB 2K2UA 3UZTA 1WI1A 1ZSQA 4QJ3B 4HB4B 1XKEA 5KCVA 3ODXA 4H8SA 3OHMB 3KY9A 4TYZA 1WGUA 2H7DA 2NZ8B 3DXCA 1MKEA 1W1HA 3OANA 1QQGA 1TXDA 2Z0QA 2Z14A 3U8ZA 4HDOA 1MIXA 2EC1A 3U7DA 1FGYA 3FEHA 5D3XA 2RSGA 1WG7A 3TCAA 4L1RA 2CAYA 3NWAA 3P6AA 3TW1A 5JP4A 1NTYA 1N3HA 2I1KA 1KI1B 2K8EA 2YT1A 4DX90 4A6KA 2MDXA 4KVGB 4GOUA 2KGXB 2NBVA 4QJ5B 2DKQA 3ULCA 2YT2A 1TJ6A 1P5TA 4A5KA 2P0HA 1AWEA 4CYEA 1V5MA 3DXDA 1M7EA 2YF0A 4GN1A 1PLSA 4ZRIA
chains in the Genus database with same CATH topology
4HB0B 3PVLA 3HQCA 3PVUA 2ROZB 4MY6A 3ODOA 2KUPA 4IAPA 4EKUA 2Z0PA 2I1JA 1K5DB 3G9WA 4NSWA 3VIAA 1IRSA 1FAOA 1BAKA 1WJMA 1OMWA 4WSFA 4HATB 1FHOA 3QWMA 1SGHA 4MK0A 1DDVA 1V89A 3PEGA 3PG7A 2G35A 1W1GA 3M1IB 1XX0A 3PP2A 1ISNA 1ZC4B 2DLWA 1TQZA 2DTCA 2J0JA 2N23A 5JHHA 3V5WA 2Y7BA 1W1DA 5HE2A 4ZRJA 2EMSA 3PZDA 1XR0B 2QKLA 1Y19B 1MIZB 3GYOA 2P0FA 1OY2A 1QC6A 1Q67A 2DA0A 2RGNB 4WJ7A 5J3QA 2YT0A 3O96A 5KQ4A 5C16A 2Q13A 2IFSA 1KZGA 5D27A 1WVHA 2PZ1A 3AU4A 4HB3B 1V88A 1FHWA 1PFJA 1X05A 2DYQA 3F0WA 1U27A 3KRWA 4HAUB 3KZ1A 5JHGA 2J0MA 3HW2B 3A8QA 2UVMA 2COFA 3PSCA 2LKOA 4NY0A 1U5GA 5HE3A 4K81A 2YS1A 4KHOA 3RCPA 4KHAA 3LJUX 2J59M 1GC6A 2UZRA 2D2QA 2W2XC 5C6RA 2DHJA 3GYPA 1X1FA 1AQCA 4YL8A 2M38A 3QIJA 2RLOA 1XD4A 3KRXA 2GJYA 4GMXB 4CHJA 2ELAA 5HE1A 3HK0A 2D9YA 1DBHA 1SHCA 3WYFB 2BCJA 3SNHA 2DFKA 2D10A 2JP2A 4GMVA 3FSSA 2DHKA 2H7EA 3ZVRA 4BBKA 2OTXA 1XODA 2RUKB 3NSUA 5DIFB 5FI1A 2Z0OA 3ML4A 2Y8FA 1MPHA 1U5EA 2LG1A 3CIKA 3P7ZA 1EAZA 2GCJA 5JLJB 3IVFA 3D8DA 2K00A 2CRFA 4D0NB 5HE0A 1P6SA 1Z87A 2K2JA 5FI0A 1U5FA 2N0YA 4HB2B 1E5WA 3KSYA 1X11A 3FM8C 1U5DA 2W2WA 3F5RA 2L2IA 1MK7B 5DHAB 1J19A 3ZDTA 2CY4A 3A98B 5J3TA 4GPTB 2YVCA 3T06A 1WGQA 1H10A 4K2OA 2LOXA 2YSZA 3WA0A 2COCA 1ZM0A 1OQNA 5LONB 5CLQB 2MFQA 3CXBB 5DI9B 5LOPB 3MDBC 2D9WA 1X86A 3TO1A 1BTNA 2D11A 2DKPA 4K17A 4GZUA 2DYNA 1UNPA 3PVWA 4PNKA 3QBVB 4MT7A 2XQNM 4ZRKA 1BWNA 5J3YA 4DXAB 1PMSA 3SO6A 2J0KA 4F7GA 2LOZA 2VKIA 5D3YA 4HAYB 2ZPYA 4B6HA 2MWNB 2ADZA 3X23A 1EGXA 2M14A 4KHBB 1FHXA 2DN6A 2EJ8A 2COAA 2GCLA 3TVVA 4A6HA 3SV1A 1MK9B 1NI2A 2R0DA 4IOYX 2HE7A 4F7UP 4CHMA 1DYNA 1Y5OA 5C5BB 1EF1A 4HAZB 4DBBA 4HHVA 2MKRA 2VRWB 1NTVA 4EMOA 4HAVB 1NU2A 2QKMA 1V5PA 1V61A 4HAWB 2E2XA 4K2PA 5KQ1A 3DXEA 1GC7A 4Z2NA 1X1GA 4Z2MB 4C0AA 2W2XD 2YRYA 4P7IA 2IYBA 2FJLA 2YS3A 1UNRA 1ZC3B 3VOQA 2CY5A 5L81A 4L6EA 2R09A 5D3VA 2UZSA 2ELBA 2I5FA 5DHFB 5D3WA 2EMTA 2L1CA 1MAIA 3ODWA 1K5GB 1BTKA 3AJ4A 2HTHB 2ROVA 1FGZA 2AEHA 2D4QA 3MPXA 2KCJA 2OQBA 1EVHA 1DDMA 4XWXA 3SYXA 1ZVRA 1J0WA 1KZ7A 1UPRA 2NMBA 4HAXB 4A6FB 3D8EA 5C79A 2DHIA 1B55A 2D9ZA 5C5BA 2RVBB 1GG3A 1U2BA 1DROA 2I5CA 2VSZA 4DX8A 2GS0A 4EJNA 3A8PA 4Y94A 3BINA 4YONA 2DX1A 1RJ2A 2P0DA 1UPQA 3BJIA 2AL6A 1H4RA 2CODA 4TKNA 3TFMA 2LYDA 2P8VA 5GOWB 2LULA 3D8FA 1U29A 4KAXB 4WVFB 1XCGA 1RRPB 2D9VA 1UEFA 4HDQA 4F7HA 2X18A 3AU5A 1I2HA 4GXBA 2V76A 1WJ1A 4IFSA 1LW3A 3N7CA 1DDWA 3ULBA 1FOEA 2Y8GA 5EFXA 2DX5A 2YS5A 1UNQA 1LB1A 1V5UA 2RNRB 1FB8A 1P3RA 1M7RA 4PQ0A 3SUZA 1I7AA 5DH9B 2D9XA 4A6FA 5CLLB 2K2UA 3UZTA 1WI1A 1ZSQA 4HB4B 1XKEA 5KCVA 3ODXA 4H8SA 3KY9A 4TYZA 1WGUA 2H7DA 2NZ8B 3DXCA 1MKEA 1W1HA 3OANA 1QQGA 1TXDA 2Z0QA 3U8ZA 4HDOA 1MIXA 2EC1A 3U7DA 1FGYA 3FEHA 5D3XA 2RSGA 1WG7A 3TCAA 2CAYA 3P6AA 3TW1A 5JP4A 1NTYA 1N3HA 2I1KA 1KI1B 2YT1A 4DX90 4A6KA 2MDXA 4KVGB 2KGXB 2DKQA 3ULCA 1TJ6A 1P5TA 4A5KA 2P0HA 1AWEA 4CYEA 1V5MA 3DXDA 1M7EA 2YF0A 4GN1A 1PLSA 4ZRIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HB0 B;  3PVL A;  3HQC A;  3PVU A;  2ROZ B;  4MY6 A;  3ODO A;  2KUP A;  4IAP A;  4EKU A;  2Z0P A;  2I1J A;  1K5D B;  3G9W A;  4NSW A;  3VIA A;  1IRS A;  1FAO A;  1BAK A;  1WJM A;  1OMW A;  4WSF A;  4HAT B;  1FHO A;  3QWM A;  1SGH A;  4MK0 A;  1DDV A;  1V89 A;  3PEG A;  3PG7 A;  2G35 A;  1W1G A;  3M1I B;  1XX0 A;  3PP2 A;  1ISN A;  1ZC4 B;  2DLW A;  1TQZ A;  2DTC A;  2J0J A;  2N23 A;  5JHH A;  3V5W A;  2Y7B A;  1W1D A;  5HE2 A;  4ZRJ A;  2EMS A;  3PZD A;  1XR0 B;  2QKL A;  1Y19 B;  1MIZ B;  3GYO A;  2P0F A;  1OY2 A;  1QC6 A;  1Q67 A;  2DA0 A;  2RGN B;  4WJ7 A;  5J3Q A;  2YT0 A;  3O96 A;  5KQ4 A;  5C16 A;  2Q13 A;  2IFS A;  1KZG A;  5D27 A;  1WVH A;  2PZ1 A;  3AU4 A;  4HB3 B;  1V88 A;  1FHW A;  1PFJ A;  1X05 A;  2DYQ A;  3F0W A;  1U27 A;  3KRW A;  4HAU B;  3KZ1 A;  5JHG A;  2J0M A;  3HW2 B;  3A8Q A;  2UVM A;  2COF A;  3PSC A;  2LKO A;  4NY0 A;  1U5G A;  5HE3 A;  4K81 A;  2YS1 A;  4KHO A;  3RCP A;  4KHA A;  3LJU X;  2J59 M;  1GC6 A;  2UZR A;  2D2Q A;  2W2X C;  5C6R A;  2DHJ A;  3GYP A;  1X1F A;  1AQC A;  4YL8 A;  2M38 A;  3QIJ A;  2RLO A;  1XD4 A;  3KRX A;  2GJY A;  4GMX B;  4CHJ A;  2ELA A;  5HE1 A;  3HK0 A;  2D9Y A;  1DBH A;  1SHC A;  3WYF B;  2BCJ A;  3SNH A;  2DFK A;  2D10 A;  2JP2 A;  4GMV A;  3FSS A;  2DHK A;  2H7E A;  3ZVR A;  4BBK A;  2OTX A;  1XOD A;  2RUK B;  3NSU A;  5DIF B;  5FI1 A;  2Z0O A;  3ML4 A;  2Y8F A;  1MPH A;  1U5E A;  2LG1 A;  3CIK A;  3P7Z A;  1EAZ A;  2GCJ A;  5JLJ B;  3IVF A;  3D8D A;  2K00 A;  2CRF A;  4D0N B;  5HE0 A;  1P6S A;  1Z87 A;  2K2J A;  5FI0 A;  1U5F A;  2N0Y A;  4HB2 B;  1E5W A;  3KSY A;  1X11 A;  3FM8 C;  1U5D A;  2W2W A;  3F5R A;  2L2I A;  1MK7 B;  5DHA B;  1J19 A;  3ZDT A;  2CY4 A;  3A98 B;  5J3T A;  4GPT B;  2YVC A;  3T06 A;  1WGQ A;  1H10 A;  4K2O A;  2LOX A;  2YSZ A;  3WA0 A;  2COC A;  1ZM0 A;  1OQN A;  5LON B;  5CLQ B;  2MFQ A;  3CXB B;  5DI9 B;  5LOP B;  3MDB C;  2D9W A;  1X86 A;  3TO1 A;  1BTN A;  2D11 A;  2DKP A;  4K17 A;  4GZU A;  2DYN A;  1UNP A;  3PVW A;  4PNK A;  3QBV B;  4MT7 A;  2XQN M;  4ZRK A;  1BWN A;  5J3Y A;  4DXA B;  1PMS A;  3SO6 A;  2J0K A;  4F7G A;  2LOZ A;  2VKI A;  5D3Y A;  4HAY B;  2ZPY A;  4B6H A;  2MWN B;  2ADZ A;  3X23 A;  1EGX A;  2M14 A;  4KHB B;  1FHX A;  2DN6 A;  2EJ8 A;  2COA A;  2GCL A;  3TVV A;  4A6H A;  3SV1 A;  1MK9 B;  1NI2 A;  2R0D A;  4IOY X;  2HE7 A;  4F7U P;  4CHM A;  1DYN A;  1Y5O A;  5C5B B;  1EF1 A;  4HAZ B;  4DBB A;  4HHV A;  2MKR A;  2VRW B;  1NTV A;  4EMO A;  4HAV B;  1NU2 A;  2QKM A;  1V5P A;  1V61 A;  4HAW B;  2E2X A;  4K2P A;  5KQ1 A;  3DXE A;  1GC7 A;  4Z2N A;  1X1G A;  4Z2M B;  4C0A A;  2W2X D;  2YRY A;  4P7I A;  2IYB A;  2FJL A;  2YS3 A;  1UNR A;  1ZC3 B;  3VOQ A;  2CY5 A;  5L81 A;  4L6E A;  2R09 A;  5D3V A;  2UZS A;  2ELB A;  2I5F A;  5DHF B;  5D3W A;  2EMT A;  2L1C A;  1MAI A;  3ODW A;  1K5G B;  1BTK A;  3AJ4 A;  2HTH B;  2ROV A;  1FGZ A;  2AEH A;  2D4Q A;  3MPX A;  2KCJ A;  2OQB A;  1EVH A;  1DDM A;  4XWX A;  3SYX A;  1ZVR A;  1J0W A;  1KZ7 A;  1UPR A;  2NMB A;  4HAX B;  4A6F B;  3D8E A;  5C79 A;  2DHI A;  1B55 A;  2D9Z A;  5C5B A;  2RVB B;  1GG3 A;  1U2B A;  1DRO A;  2I5C A;  2VSZ A;  4DX8 A;  2GS0 A;  4EJN A;  3A8P A;  4Y94 A;  3BIN A;  4YON A;  2DX1 A;  1RJ2 A;  2P0D A;  1UPQ A;  3BJI A;  2AL6 A;  1H4R A;  2COD A;  4TKN A;  3TFM A;  2LYD A;  2P8V A;  5GOW B;  2LUL A;  3D8F A;  1U29 A;  4KAX B;  4WVF B;  1XCG A;  1RRP B;  2D9V A;  1UEF A;  4HDQ A;  4F7H A;  2X18 A;  3AU5 A;  1I2H A;  4GXB A;  2V76 A;  1WJ1 A;  4IFS A;  1LW3 A;  3N7C A;  1DDW A;  3ULB A;  1FOE A;  2Y8G A;  5EFX A;  2DX5 A;  2YS5 A;  1UNQ A;  1LB1 A;  1V5U A;  2RNR B;  1FB8 A;  1P3R A;  1M7R A;  4PQ0 A;  3SUZ A;  1I7A A;  5DH9 B;  2D9X A;  4A6F A;  5CLL B;  2K2U A;  3UZT A;  1WI1 A;  1ZSQ A;  4HB4 B;  1XKE A;  5KCV A;  3ODX A;  4H8S A;  3KY9 A;  4TYZ A;  1WGU A;  2H7D A;  2NZ8 B;  3DXC A;  1MKE A;  1W1H A;  3OAN A;  1QQG A;  1TXD A;  2Z0Q A;  3U8Z A;  4HDO A;  1MIX A;  2EC1 A;  3U7D A;  1FGY A;  3FEH A;  5D3X A;  2RSG A;  1WG7 A;  3TCA A;  2CAY A;  3P6A A;  3TW1 A;  5JP4 A;  1NTY A;  1N3H A;  2I1K A;  1KI1 B;  2YT1 A;  4DX9 0;  4A6K A;  2MDX A;  4KVG B;  2KGX B;  2DKQ A;  3ULC A;  1TJ6 A;  1P5T A;  4A5K A;  2P0H A;  1AWE A;  4CYE A;  1V5M A;  3DXD A;  1M7E A;  2YF0 A;  4GN1 A;  1PLS A;  4ZRI A; 
#chains in the Genus database with same CATH topology
 4HB0 B;  3PVL A;  3HQC A;  3PVU A;  2ROZ B;  4MY6 A;  3ODO A;  2KUP A;  5I2S A;  4IAP A;  4EKU A;  2Z0P A;  2I1J A;  3NW8 A;  5I2M A;  1K5D B;  4GNK B;  3G9W A;  4NSW A;  3VIA A;  1IRS A;  1FAO A;  1BAK A;  1WJM A;  1OMW A;  4WSF A;  4HAT B;  1FHO A;  3QWM A;  1SGH A;  3HSA A;  4MK0 A;  1DDV A;  1V89 A;  3PEG A;  3PG7 A;  2G35 A;  1W1G A;  3M1I B;  1XX0 A;  3PP2 A;  1ISN A;  1ZC4 B;  2DLW A;  1TQZ A;  2DTC A;  2J0J A;  2N23 A;  5JHH A;  3V5W A;  3U12 A;  2Y7B A;  1W1D A;  5HE2 A;  4ZRJ A;  2EMS A;  3PZD A;  1XR0 B;  2QKL A;  1Y19 B;  1MIZ B;  3GYO A;  2KIG A;  2P0F A;  1OY2 A;  1QC6 A;  1Q67 A;  2DA0 A;  2RGN B;  4WJ7 A;  5J3Q A;  2YT0 A;  3O96 A;  5KQ4 A;  5C16 A;  2Q13 A;  3NWF A;  2IFS A;  1KZG A;  5D27 A;  1WVH A;  2PZ1 A;  3AU4 A;  4HB3 B;  4D6W A;  1V88 A;  1FHW A;  4OT1 A;  1PFJ A;  1X05 A;  2DYQ A;  3F0W A;  1U27 A;  3KRW A;  4HAU B;  3KZ1 A;  5JHG A;  2J0M A;  2RRF A;  3HW2 B;  3A8Q A;  2UVM A;  2COF A;  3PSC A;  5M4Y B;  2LKO A;  4NY0 A;  1U5G A;  5HE3 A;  4K81 A;  2YS1 A;  4KHO A;  3RCP A;  4KHA A;  2J59 M;  1GC6 A;  2UZR A;  3LJU X;  2D2Q A;  2W2X C;  5C6R A;  2DHJ A;  3GYP A;  1X1F A;  1AQC A;  4YL8 A;  2M38 A;  3QIJ A;  5IRS A;  2RLO A;  1XD4 A;  3KRX A;  2GJY A;  4GMX B;  4CHJ A;  2ELA A;  5HE1 A;  4DIX A;  4HSI A;  3HK0 A;  2D9Y A;  1DBH A;  1SHC A;  3WYF B;  2BCJ A;  3SNH A;  2DFK A;  2D10 A;  2JP2 A;  4GMV A;  3FSS A;  2DHK A;  2H7E A;  3ZVR A;  2GUM A;  4BBK A;  2OTX A;  1XOD A;  2RUK B;  3NSU A;  5DIF B;  1T77 A;  5FI1 A;  2Z0O A;  3ML4 A;  2Y8F A;  1MPH A;  1U5E A;  2LG1 A;  3CIK A;  3P7Z A;  1EAZ A;  2GCJ A;  5JLJ B;  3IVF A;  3D8D A;  2K00 A;  3A58 A;  2CRF A;  2R2Y A;  5HE0 A;  4D0N B;  1P6S A;  5LG4 B;  1Z87 A;  2K2J A;  5FI0 A;  1U5F A;  2N0Y A;  4HB2 B;  1E5W A;  3KSY A;  1X11 A;  3FM8 C;  3FVC A;  1U5D A;  2W2W A;  3F5R A;  2L2I A;  1MK7 B;  5DHA B;  1J19 A;  3ZDT A;  2CY4 A;  3A98 B;  4CSQ A;  5J3T A;  4GPT B;  2YVC A;  3T06 A;  1WGQ A;  1H10 A;  4K2O A;  2KIE A;  2LOX A;  2YSZ A;  3WA0 A;  2COC A;  2FJU B;  1ZM0 A;  1OQN A;  5LON B;  5CLQ B;  2MFQ A;  3CXB B;  5DI9 B;  5LOP B;  3MDB C;  4QJ4 B;  2D9W A;  3NWD A;  1X86 A;  3TO1 A;  1BTN A;  2D11 A;  2DKP A;  4K17 A;  4GZU A;  2DYN A;  1UNP A;  3PVW A;  4PNK A;  3QBV B;  4MT7 A;  2XQN M;  4ZRK A;  1BWN A;  5J3Y A;  4DXA B;  1PMS A;  3SO6 A;  2J0K A;  4F7G A;  2LOZ A;  2VKI A;  2Z4D A;  5D3Y A;  4HAY B;  2ZPY A;  4B6H A;  2MWN B;  2ADZ A;  3X23 A;  1EGX A;  2M14 A;  4KHB B;  1FHX A;  2DN6 A;  2EJ8 A;  2COA A;  2GCL A;  3TVV A;  4A6H A;  3SV1 A;  1MK9 B;  1NI2 A;  2R0D A;  4IOY X;  3HIE A;  2HE7 A;  4F7U P;  4CHM A;  1DYN A;  1Y5O A;  2KR0 A;  5C5B B;  1EF1 A;  4HAZ B;  4DBB A;  4HHV A;  2MKR A;  2VRW B;  1NTV A;  1MI1 A;  2ZKM X;  4EMO A;  4HAV B;  1NU2 A;  4OSN A;  2QKM A;  1V5P A;  1V61 A;  4HAW B;  2KUQ A;  2E2X A;  4K2P A;  5KQ1 A;  3DXE A;  1GC7 A;  4Z2N A;  1X1G A;  4Z2M B;  4C0A A;  2W2X D;  2YRY A;  4P7I A;  2IYB A;  2FJL A;  2YS3 A;  1UNR A;  1ZC3 B;  3VOQ A;  2CY5 A;  5L81 A;  4L6E A;  2R09 A;  2Z13 A;  5D3V A;  2UZS A;  2ELB A;  2I5F A;  5DHF B;  5D3W A;  2EMT A;  2L1C A;  1MAI A;  3ODW A;  4KHB A;  1K5G B;  1BTK A;  3AJ4 A;  2HTH B;  2ROV A;  1FGZ A;  2AEH A;  2D4Q A;  3MPX A;  2KCJ A;  2OQB A;  1EVH A;  1DDM A;  4XWX A;  3SYX A;  1ZVR A;  1J0W A;  1KZ7 A;  1UPR A;  2NMB A;  4HAX B;  4A6F B;  3D8E A;  5C79 A;  2DHI A;  2Z59 A;  1B55 A;  2D9Z A;  3DCX A;  5C5B A;  2RVB B;  4QXA B;  1GG3 A;  1U2B A;  1DRO A;  2I5C A;  2VSZ A;  4DX8 A;  2GS0 A;  4EJN A;  3A8P A;  4Y94 A;  3BIN A;  4YON A;  2DX1 A;  1RJ2 A;  2P0D A;  1UPQ A;  3BJI A;  2AL6 A;  1H4R A;  2COD A;  4TKN A;  3TFM A;  2LYD A;  2P8V A;  5GOW B;  2LUL A;  3D8F A;  1U29 A;  4KAX B;  4WVF B;  1XCG A;  1RRP B;  2D9V A;  1UEF A;  4HDQ A;  4F7H A;  2X18 A;  3AU5 A;  1I2H A;  3B77 A;  4GXB A;  2V76 A;  1WJ1 A;  4IFS A;  1LW3 A;  3N7C A;  1DDW A;  3ULB A;  1FOE A;  2Y8G A;  2K49 A;  5EFX A;  2DX5 A;  2YS5 A;  1UNQ A;  1LB1 A;  1V5U A;  1ZYI A;  2RNR B;  1FB8 A;  1P3R A;  1M7R A;  4PQ0 A;  3SUZ A;  1I7A A;  5DH9 B;  2D9X A;  4A6F A;  5CLL B;  2K2U A;  3UZT A;  1WI1 A;  1ZSQ A;  4QJ3 B;  4HB4 B;  1XKE A;  5KCV A;  3ODX A;  4H8S A;  3OHM B;  3KY9 A;  4TYZ A;  1WGU A;  2H7D A;  2NZ8 B;  3DXC A;  1MKE A;  1W1H A;  3OAN A;  1QQG A;  1TXD A;  2Z0Q A;  2Z14 A;  3U8Z A;  4HDO A;  1MIX A;  2EC1 A;  3U7D A;  1FGY A;  3FEH A;  5D3X A;  2RSG A;  1WG7 A;  3TCA A;  4L1R A;  2CAY A;  3NWA A;  3P6A A;  3TW1 A;  5JP4 A;  1NTY A;  1N3H A;  2I1K A;  1KI1 B;  2K8E A;  2YT1 A;  4DX9 0;  4A6K A;  2MDX A;  4KVG B;  4GOU A;  2KGX B;  2NBV A;  4QJ5 B;  2DKQ A;  3ULC A;  2YT2 A;  1TJ6 A;  1P5T A;  4A5K A;  2P0H A;  1AWE A;  4CYE A;  1V5M A;  3DXD A;  1M7E A;  2YF0 A;  4GN1 A;  1PLS A;  4ZRI A; 
#chains in the Genus database with same CATH homology
 4HB0 B;  3PVL A;  3HQC A;  3PVU A;  2ROZ B;  4MY6 A;  3ODO A;  2KUP A;  4IAP A;  4EKU A;  2Z0P A;  2I1J A;  1K5D B;  3G9W A;  4NSW A;  3VIA A;  1IRS A;  1FAO A;  1BAK A;  1WJM A;  1OMW A;  4WSF A;  4HAT B;  1FHO A;  3QWM A;  1SGH A;  4MK0 A;  1DDV A;  1V89 A;  3PEG A;  3PG7 A;  2G35 A;  1W1G A;  3M1I B;  1XX0 A;  3PP2 A;  1ISN A;  1ZC4 B;  2DLW A;  1TQZ A;  2DTC A;  2J0J A;  2N23 A;  5JHH A;  3V5W A;  2Y7B A;  1W1D A;  5HE2 A;  4ZRJ A;  2EMS A;  3PZD A;  1XR0 B;  2QKL A;  1Y19 B;  1MIZ B;  3GYO A;  2P0F A;  1OY2 A;  1QC6 A;  1Q67 A;  2DA0 A;  2RGN B;  4WJ7 A;  5J3Q A;  2YT0 A;  3O96 A;  5KQ4 A;  5C16 A;  2Q13 A;  2IFS A;  1KZG A;  5D27 A;  1WVH A;  2PZ1 A;  3AU4 A;  4HB3 B;  1V88 A;  1FHW A;  1PFJ A;  1X05 A;  2DYQ A;  3F0W A;  1U27 A;  3KRW A;  4HAU B;  3KZ1 A;  5JHG A;  2J0M A;  3HW2 B;  3A8Q A;  2UVM A;  2COF A;  3PSC A;  2LKO A;  4NY0 A;  1U5G A;  5HE3 A;  4K81 A;  2YS1 A;  4KHO A;  3RCP A;  4KHA A;  3LJU X;  2J59 M;  1GC6 A;  2UZR A;  2D2Q A;  2W2X C;  5C6R A;  2DHJ A;  3GYP A;  1X1F A;  1AQC A;  4YL8 A;  2M38 A;  3QIJ A;  2RLO A;  1XD4 A;  3KRX A;  2GJY A;  4GMX B;  4CHJ A;  2ELA A;  5HE1 A;  3HK0 A;  2D9Y A;  1DBH A;  1SHC A;  3WYF B;  2BCJ A;  3SNH A;  2DFK A;  2D10 A;  2JP2 A;  4GMV A;  3FSS A;  2DHK A;  2H7E A;  3ZVR A;  4BBK A;  2OTX A;  1XOD A;  2RUK B;  3NSU A;  5DIF B;  5FI1 A;  2Z0O A;  3ML4 A;  2Y8F A;  1MPH A;  1U5E A;  2LG1 A;  3CIK A;  3P7Z A;  1EAZ A;  2GCJ A;  5JLJ B;  3IVF A;  3D8D A;  2K00 A;  2CRF A;  4D0N B;  5HE0 A;  1P6S A;  1Z87 A;  2K2J A;  5FI0 A;  1U5F A;  2N0Y A;  4HB2 B;  1E5W A;  3KSY A;  1X11 A;  3FM8 C;  1U5D A;  2W2W A;  3F5R A;  2L2I A;  1MK7 B;  5DHA B;  1J19 A;  3ZDT A;  2CY4 A;  3A98 B;  5J3T A;  4GPT B;  2YVC A;  3T06 A;  1WGQ A;  1H10 A;  4K2O A;  2LOX A;  2YSZ A;  3WA0 A;  2COC A;  1ZM0 A;  1OQN A;  5LON B;  5CLQ B;  2MFQ A;  3CXB B;  5DI9 B;  5LOP B;  3MDB C;  2D9W A;  1X86 A;  3TO1 A;  1BTN A;  2D11 A;  2DKP A;  4K17 A;  4GZU A;  2DYN A;  1UNP A;  3PVW A;  4PNK A;  3QBV B;  4MT7 A;  2XQN M;  4ZRK A;  1BWN A;  5J3Y A;  4DXA B;  1PMS A;  3SO6 A;  2J0K A;  4F7G A;  2LOZ A;  2VKI A;  5D3Y A;  4HAY B;  2ZPY A;  4B6H A;  2MWN B;  2ADZ A;  3X23 A;  1EGX A;  2M14 A;  4KHB B;  1FHX A;  2DN6 A;  2EJ8 A;  2COA A;  2GCL A;  3TVV A;  4A6H A;  3SV1 A;  1MK9 B;  1NI2 A;  2R0D A;  4IOY X;  2HE7 A;  4F7U P;  4CHM A;  1DYN A;  1Y5O A;  5C5B B;  1EF1 A;  4HAZ B;  4DBB A;  4HHV A;  2MKR A;  2VRW B;  1NTV A;  4EMO A;  4HAV B;  1NU2 A;  2QKM A;  1V5P A;  1V61 A;  4HAW B;  2E2X A;  4K2P A;  5KQ1 A;  3DXE A;  1GC7 A;  4Z2N A;  1X1G A;  4Z2M B;  4C0A A;  2W2X D;  2YRY A;  4P7I A;  2IYB A;  2FJL A;  2YS3 A;  1UNR A;  1ZC3 B;  3VOQ A;  2CY5 A;  5L81 A;  4L6E A;  2R09 A;  5D3V A;  2UZS A;  2ELB A;  2I5F A;  5DHF B;  5D3W A;  2EMT A;  2L1C A;  1MAI A;  3ODW A;  1K5G B;  1BTK A;  3AJ4 A;  2HTH B;  2ROV A;  1FGZ A;  2AEH A;  2D4Q A;  3MPX A;  2KCJ A;  2OQB A;  1EVH A;  1DDM A;  4XWX A;  3SYX A;  1ZVR A;  1J0W A;  1KZ7 A;  1UPR A;  2NMB A;  4HAX B;  4A6F B;  3D8E A;  5C79 A;  2DHI A;  1B55 A;  2D9Z A;  5C5B A;  2RVB B;  1GG3 A;  1U2B A;  1DRO A;  2I5C A;  2VSZ A;  4DX8 A;  2GS0 A;  4EJN A;  3A8P A;  4Y94 A;  3BIN A;  4YON A;  2DX1 A;  1RJ2 A;  2P0D A;  1UPQ A;  3BJI A;  2AL6 A;  1H4R A;  2COD A;  4TKN A;  3TFM A;  2LYD A;  2P8V A;  5GOW B;  2LUL A;  3D8F A;  1U29 A;  4KAX B;  4WVF B;  1XCG A;  1RRP B;  2D9V A;  1UEF A;  4HDQ A;  4F7H A;  2X18 A;  3AU5 A;  1I2H A;  4GXB A;  2V76 A;  1WJ1 A;  4IFS A;  1LW3 A;  3N7C A;  1DDW A;  3ULB A;  1FOE A;  2Y8G A;  5EFX A;  2DX5 A;  2YS5 A;  1UNQ A;  1LB1 A;  1V5U A;  2RNR B;  1FB8 A;  1P3R A;  1M7R A;  4PQ0 A;  3SUZ A;  1I7A A;  5DH9 B;  2D9X A;  4A6F A;  5CLL B;  2K2U A;  3UZT A;  1WI1 A;  1ZSQ A;  4HB4 B;  1XKE A;  5KCV A;  3ODX A;  4H8S A;  3KY9 A;  4TYZ A;  1WGU A;  2H7D A;  2NZ8 B;  3DXC A;  1MKE A;  1W1H A;  3OAN A;  1QQG A;  1TXD A;  2Z0Q A;  3U8Z A;  4HDO A;  1MIX A;  2EC1 A;  3U7D A;  1FGY A;  3FEH A;  5D3X A;  2RSG A;  1WG7 A;  3TCA A;  2CAY A;  3P6A A;  3TW1 A;  5JP4 A;  1NTY A;  1N3H A;  2I1K A;  1KI1 B;  2YT1 A;  4DX9 0;  4A6K A;  2MDX A;  4KVG B;  2KGX B;  2DKQ A;  3ULC A;  1TJ6 A;  1P5T A;  4A5K A;  2P0H A;  1AWE A;  4CYE A;  1V5M A;  3DXD A;  1M7E A;  2YF0 A;  4GN1 A;  1PLS A;  4ZRI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...