2D9WA

Solution structure of the ph domain of docking protein 2 from human
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
127
structure length
127
Chain Sequence
GSSGSSGMGDGAVKQGFLYLQQQQTFGKKWRRFGASLYGGSDCALARLELQEGPEKPRRCEAARKVIRLSDCLRVAEAGGEASSPRDTSAFFLETKERLYLLAAPAAERGDWVQAICLLAFSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the PH domain of Docking protein 2 from human
rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Docking protein 2
total genus 12
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2005-12-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2d9wA01
2CRFA 5DHAB 2RSGA 5D27A 1RJ2A 1XX0A 3DXDA 2H7DA 1XD4A 3ZVRA 2EC1A 5C5BA 4F7HA 2K00A 1FAOA 2Y8GA 1NI2A 4HHVA 5J3YA 3PG7A 2OQBA 4A6HA 5HE3A 5LONB 2K2JA 1UPQA 1P3RA 4NY0A 1EAZA 4F7GA 1X05A 2P0HA 5FI1A 2PZ1A 4IFSA 4KVGB 3QBVB 4K2PA 5HE2A 1FB8A 3A8QA 4ZRIA 2ELAA 2X18A 2LULA 2D2QA 5D3WA 2P8VA 1FHOA 2DHIA 2RGNB 1Y19B 2BCJA 2D9VA 2LKOA 1ZVRA 2D4QA 2Z0PA 3U8ZA 2DYNA 4HAZB 1UEFA 1WGUA 1MAIA 3FSSA 3PZDA 1SHCA 2J59M 4WSFA 1LW3A 3PEGA 4DX8A 1ISNA 2I5CA 1SGHA 2W2WA 3P6AA 1Y5OA 2QKMA 2KCJA 1GC7A 4KHBB 2MKRA 4YONA 2VKIA 4HATB 2ELBA 4IOYX 1DDWA 2ROZB 1U29A 4HB0B 2DA0A 4EMOA 4CYEA 3ZDTA 1PMSA 2YS1A 3N7CA 1FHWA 2D9WA 3FM8C 2VRWB 1IRSA 4C0AA 2AL6A 2LOZA 3MDBC 4KAXB 4WVFB 2I1KA 1BTNA 3TCAA 5J3QA 1DROA 3D8DA 2DKPA 4DXAB 1MK7B 1ZSQA 1TXDA 3PVLA 3ODWA 5CLQB 5HE0A 2D10A 3HK0A 1KZ7A 1XKEA 1XODA 2NMBA 2ROVA 3FEHA 2YT0A 2DLWA 1X1GA 2W2XD 1BAKA 5KQ4A 2D9XA 1X11A 3SYXA 3SUZA 4D0NB 2R0DA 2ZPYA 1GC6A 4CHJA 1U2BA 2DX5A 1DYNA 1E5WA 3KRWA 3D8EA 2EMTA 3LJUX 2Y7BA 2UZSA 3PVUA 3GYOA 1UNRA 1GG3A 3PSCA 4KHOA 2D9YA 5C79A 4CHMA 1DDMA 3TW1A 2MFQA 2L1CA 3MPXA 1UNPA 4Z2NA 2GJYA 3ODXA 2YSZA 5D3VA 4BBKA 4L6EA 1M7RA 3F5RA 2EJ8A 4IAPA 3VOQA 3F0WA 2YF0A 5JHHA 1ZM0A 4GZUA 2I5FA 5JP4A 1B55A 2GS0A 2RVBB 2OTXA 1U5FA 5DI9B 4A5KA 1ZC3B 1MPHA 4GXBA 3SV1A 1V61A 2RUKB 1W1GA 2COAA 3UZTA 5LOPB 2K2UA 1WJ1A 3GYPA 2DN6A 5GOWB 2CY4A 2DTCA 1J0WA 2XQNM 2YT1A 4K2OA 4Z2MB 3SO6A 2HTHB 4TYZA 1AQCA 2UZRA 2Z0QA 3TVVA 1MKEA 5C16A 1OQNA 3PP2A 1QC6A 2CY5A 3ULCA 1FGYA 4MK0A 2QKLA 4HAYB 5DHFB 1V5PA 2I1JA 4HDOA 1U5GA 2Y8FA 3ML4A 2E2XA 4GN1A 5D3YA 3SNHA 3KRXA 1P6SA 2LOXA 4HB3B 5D3XA 1FOEA 2YRYA 3CXBB 4F7UP 3O96A 4XWXA 3RCPA 4DX90 2DHJA 1V89A 2YS5A 2GCLA 1H10A 1AWEA 3KZ1A 3TFMA 5C6RA 1WJMA 1XCGA 4K17A 4A6KA 2N23A 1OMWA 1V88A 1K5GB 2GCJA 1WGQA 2VSZA 3KY9A 3U7DA 2J0JA 1J19A 1MK9B 2COCA 5JHGA 2DHKA 5J3TA 1FGZA 2LYDA 3NSUA 1I7AA 4Y94A 1LB1A 4ZRJA 2IYBA 2Z0OA 1DDVA 1Z87A 3DXCA 1W1HA 4HAWB 1KZGA 2D11A 5DIFB 3A98B 4H8SA 2KUPA 1I2HA 3HW2B 2JP2A 4P7IA 2IFSA 1QQGA 3TO1A 1UNQA 4GPTB 2R09A 1PFJA 3M1IB 1W1DA 1MIXA 1BTKA 1PLSA 1N3HA 5DH9B 1NTYA 3G9WA 2L2IA 1MIZB 4EJNA 1RRPB 1BWNA 3CIKA 5JLJB 3D8FA 1KI1B 2D9ZA 2G35A 2M38A 4TKNA 5C5BB 1K5DB 1OY2A 3BINA 4GMXB 2YVCA 2COFA 4HB4B 4EKUA 2P0FA 2RLOA 1V5UA 1TJ6A 2ADZA 4MT7A 1X1FA 2KGXB 3OANA 1ZC4B 4MY6A 1P5TA 2CAYA 2J0KA 4NSWA 4ZRKA 1WVHA 3AJ4A 1TQZA 3A8PA 3AU4A 2M14A 2H7EA 1M7EA 2DX1A 3ODOA 2DYQA 4WJ7A 4B6HA 5L81A 4K81A 1V5MA 2V76A 3WA0A 4HDQA 1H4RA 4PNKA 4HAXB 2N0YA 4HAVB 2RNRB 2DFKA 3IVFA 1FHXA 3X23A 1NTVA 4PQ0A 3BJIA 5CLLB 2P0DA 3KSYA 3WYFB 3QWMA 2J0MA 3QIJA 1EF1A 3T06A 1NU2A 5KCVA 2YS3A 2MDXA 1U5EA 4YL8A 1DBHA 3HQCA 3PVWA 2AEHA 2MWNB 1U5DA 1UPRA 2NZ8B 5KQ1A 2CODA 1U27A 2EMSA 1EGXA 2W2XC 4GMVA 4HAUB 3P7ZA 2DKQA 2UVMA 2Q13A 4A6FB 1Q67A 1WI1A 1X86A 2LG1A 2FJLA 5HE1A 1EVHA 3VIAA 4DBBA 2HE7A 4KHAA 4A6FA 1XR0B 3V5WA 5EFXA 1WG7A 3DXEA 4HB2B 3AU5A 3ULBA 5FI0A
chains in the Genus database with same CATH superfamily
2CRFA 5DHAB 2RSGA 5D27A 1RJ2A 1XX0A 3A58A 3U12A 3DXDA 5I2MA 2H7DA 1XD4A 3ZVRA 3DCXA 2EC1A 5C5BA 4F7HA 2K00A 1FAOA 2Y8GA 1NI2A 4HHVA 5J3YA 3PG7A 2OQBA 4A6HA 5HE3A 5LONB 2Z4DA 2K2JA 1UPQA 1P3RA 4NY0A 1EAZA 4F7GA 1X05A 2P0HA 5FI1A 3NW8A 2PZ1A 2KUQA 4IFSA 4KVGB 2Z13A 3QBVB 4K2PA 5HE2A 1FB8A 3A8QA 4ZRIA 2ELAA 2X18A 2LULA 2D2QA 5D3WA 2P8VA 1FHOA 2DHIA 2RGNB 1Y19B 2BCJA 2D9VA 2LKOA 1ZVRA 2D4QA 2Z0PA 3U8ZA 5IRSA 2DYNA 4HAZB 1UEFA 1WGUA 1MAIA 3FSSA 3PZDA 1SHCA 2RRFA 2J59M 4WSFA 1LW3A 3PEGA 4DX8A 1ISNA 2I5CA 1SGHA 2W2WA 3P6AA 1Y5OA 2QKMA 2KCJA 1GC7A 3HIEA 4KHBB 3NWAA 2MKRA 4YONA 2VKIA 4HATB 2KIGA 2ELBA 4IOYX 1DDWA 2ROZB 1U29A 4HB0B 2DA0A 4EMOA 4CYEA 3ZDTA 1PMSA 2YS1A 3N7CA 1FHWA 2D9WA 3FM8C 2VRWB 1IRSA 4C0AA 2AL6A 2LOZA 3MDBC 4KAXB 4WVFB 2I1KA 1BTNA 3TCAA 5J3QA 1DROA 3D8DA 2DKPA 4DXAB 1MK7B 1ZSQA 1TXDA 3PVLA 3ODWA 5CLQB 5HE0A 2D10A 3HK0A 1KZ7A 1XKEA 1XODA 2NMBA 2ROVA 3FEHA 2YT0A 2DLWA 1X1GA 2W2XD 1BAKA 5KQ4A 2D9XA 4OT1A 1X11A 3SYXA 3SUZA 4D0NB 2R0DA 2ZPYA 1GC6A 4CHJA 1U2BA 2DX5A 1DYNA 1E5WA 3KRWA 3D8EA 2EMTA 2FJUB 3LJUX 2Y7BA 2UZSA 3PVUA 3GYOA 1UNRA 1GG3A 3FVCA 3PSCA 4KHOA 2D9YA 5C79A 4QJ3B 4CHMA 1DDMA 3TW1A 4HSIA 2MFQA 2L1CA 3MPXA 1UNPA 4Z2NA 2GJYA 3ODXA 2YSZA 5D3VA 4BBKA 4L6EA 1M7RA 3F5RA 2EJ8A 4IAPA 2KR0A 3VOQA 3F0WA 3HSAA 2YF0A 5JHHA 1ZM0A 3OHMB 2I5FA 4GZUA 5JP4A 1B55A 2GS0A 2RVBB 2NBVA 2OTXA 4D6WA 1U5FA 5DI9B 4A5KA 1ZC3B 2K8EA 1MPHA 4GXBA 3SV1A 1V61A 2RUKB 1W1GA 2COAA 3UZTA 5LOPB 2K2UA 1WJ1A 3GYPA 2DN6A 5GOWB 2CY4A 2DTCA 1J0WA 4GOUA 2XQNM 2YT1A 4K2OA 4Z2MB 3SO6A 2HTHB 4TYZA 4QJ5B 1AQCA 2YT2A 2UZRA 2Z0QA 3TVVA 1MKEA 5C16A 1OQNA 3PP2A 1QC6A 2CY5A 3ULCA 1FGYA 2R2YA 4MK0A 2QKLA 5M4YB 3NWFA 4HAYB 5I2SA 4OSNA 5DHFB 1V5PA 2I1JA 4HDOA 1U5GA 2Y8FA 3ML4A 2E2XA 4GN1A 4KHBA 5D3YA 3SNHA 3KRXA 1P6SA 2LOXA 4HB3B 5D3XA 1FOEA 4GNKB 2YRYA 3CXBB 4F7UP 3O96A 4XWXA 3RCPA 4DX90 2DHJA 1V89A 2YS5A 2GCLA 1H10A 1AWEA 3KZ1A 3TFMA 5C6RA 1WJMA 1XCGA 4K17A 4A6KA 2N23A 1OMWA 1V88A 1K5GB 2GCJA 1WGQA 2VSZA 3KY9A 3U7DA 2J0JA 1J19A 1MK9B 2COCA 5JHGA 2DHKA 5J3TA 1FGZA 2LYDA 3NSUA 1I7AA 4Y94A 2Z59A 1LB1A 4ZRJA 2IYBA 2Z0OA 1DDVA 1Z87A 3DXCA 1W1HA 4HAWB 1KZGA 2D11A 5DIFB 3A98B 4H8SA 2KUPA 1I2HA 3HW2B 2JP2A 4P7IA 2IFSA 1QQGA 3TO1A 1UNQA 4GPTB 2R09A 2Z14A 1PFJA 3M1IB 1W1DA 1MIXA 1BTKA 1PLSA 1N3HA 5DH9B 1ZYIA 1NTYA 4L1RA 3G9WA 2L2IA 1MIZB 4EJNA 1RRPB 2K49A 1BWNA 3CIKA 2GUMA 5JLJB 3D8FA 4CSQA 1KI1B 2D9ZA 2G35A 2M38A 4TKNA 5C5BB 2ZKMX 1K5DB 1OY2A 3BINA 4GMXB 2YVCA 2COFA 1T77A 4HB4B 4EKUA 2P0FA 2RLOA 4DIXA 1V5UA 1TJ6A 2ADZA 4MT7A 1X1FA 2KGXB 3OANA 1ZC4B 4MY6A 3B77A 4QXAB 1P5TA 2CAYA 2J0KA 4NSWA 4ZRKA 1WVHA 2KIEA 3AJ4A 1TQZA 3A8PA 3AU4A 2M14A 2H7EA 1M7EA 2DX1A 3ODOA 2DYQA 4WJ7A 4QJ4B 4B6HA 5L81A 4K81A 3NWDA 1V5MA 2V76A 3WA0A 4HDQA 1H4RA 4PNKA 4HAXB 2N0YA 5LG4B 4HAVB 2RNRB 2DFKA 3IVFA 1FHXA 3X23A 1NTVA 4PQ0A 3BJIA 5CLLB 2P0DA 3KSYA 3WYFB 1MI1A 3QWMA 2J0MA 3QIJA 1EF1A 3T06A 1NU2A 5KCVA 2YS3A 2MDXA 1U5EA 4YL8A 1DBHA 3HQCA 3PVWA 2AEHA 2MWNB 1U5DA 1UPRA 2NZ8B 5KQ1A 2CODA 1U27A 2EMSA 1EGXA 2W2XC 4GMVA 4HAUB 3P7ZA 2DKQA 2UVMA 2Q13A 4A6FB 1Q67A 1WI1A 1X86A 2LG1A 2FJLA 5HE1A 1EVHA 3VIAA 4DBBA 2HE7A 4KHAA 4A6FA 1XR0B 3V5WA 5EFXA 1WG7A 3DXEA 4HB2B 3AU5A 3ULBA 5FI0A
chains in the Genus database with same CATH topology
2CRFA 5DHAB 2RSGA 5D27A 1RJ2A 1XX0A 3DXDA 2H7DA 1XD4A 3ZVRA 2EC1A 5C5BA 4F7HA 2K00A 1FAOA 2Y8GA 1NI2A 4HHVA 5J3YA 3PG7A 2OQBA 4A6HA 5HE3A 5LONB 2K2JA 1UPQA 1P3RA 4NY0A 1EAZA 4F7GA 1X05A 2P0HA 5FI1A 2PZ1A 4IFSA 4KVGB 3QBVB 4K2PA 5HE2A 1FB8A 3A8QA 4ZRIA 2ELAA 2X18A 2LULA 2D2QA 5D3WA 2P8VA 1FHOA 2DHIA 2RGNB 1Y19B 2BCJA 2D9VA 2LKOA 1ZVRA 2D4QA 2Z0PA 3U8ZA 2DYNA 4HAZB 1UEFA 1WGUA 1MAIA 3FSSA 3PZDA 1SHCA 2J59M 4WSFA 1LW3A 3PEGA 4DX8A 1ISNA 2I5CA 1SGHA 2W2WA 3P6AA 1Y5OA 2QKMA 2KCJA 1GC7A 4KHBB 2MKRA 4YONA 2VKIA 4HATB 2ELBA 4IOYX 1DDWA 2ROZB 1U29A 4HB0B 2DA0A 4EMOA 4CYEA 3ZDTA 1PMSA 2YS1A 3N7CA 1FHWA 2D9WA 3FM8C 2VRWB 1IRSA 4C0AA 2AL6A 2LOZA 3MDBC 4KAXB 4WVFB 2I1KA 1BTNA 3TCAA 5J3QA 1DROA 3D8DA 2DKPA 4DXAB 1MK7B 1ZSQA 1TXDA 3PVLA 3ODWA 5CLQB 5HE0A 2D10A 3HK0A 1KZ7A 1XKEA 1XODA 2NMBA 2ROVA 3FEHA 2YT0A 2DLWA 1X1GA 2W2XD 1BAKA 5KQ4A 2D9XA 1X11A 3SYXA 3SUZA 4D0NB 2R0DA 2ZPYA 1GC6A 4CHJA 1U2BA 2DX5A 1DYNA 1E5WA 3KRWA 3D8EA 2EMTA 3LJUX 2Y7BA 2UZSA 3PVUA 3GYOA 1UNRA 1GG3A 3PSCA 4KHOA 2D9YA 5C79A 4CHMA 1DDMA 3TW1A 2MFQA 2L1CA 3MPXA 1UNPA 4Z2NA 2GJYA 3ODXA 2YSZA 5D3VA 4BBKA 4L6EA 1M7RA 3F5RA 2EJ8A 4IAPA 3VOQA 3F0WA 2YF0A 5JHHA 1ZM0A 4GZUA 2I5FA 5JP4A 1B55A 2GS0A 2RVBB 2OTXA 1U5FA 5DI9B 4A5KA 1ZC3B 1MPHA 4GXBA 3SV1A 1V61A 2RUKB 1W1GA 2COAA 3UZTA 5LOPB 2K2UA 1WJ1A 3GYPA 2DN6A 5GOWB 2CY4A 2DTCA 1J0WA 2XQNM 2YT1A 4K2OA 4Z2MB 3SO6A 2HTHB 4TYZA 1AQCA 2UZRA 2Z0QA 3TVVA 1MKEA 5C16A 1OQNA 3PP2A 1QC6A 2CY5A 3ULCA 1FGYA 4MK0A 2QKLA 4HAYB 5DHFB 1V5PA 2I1JA 4HDOA 1U5GA 2Y8FA 3ML4A 2E2XA 4GN1A 5D3YA 3SNHA 3KRXA 1P6SA 2LOXA 4HB3B 5D3XA 1FOEA 2YRYA 3CXBB 4F7UP 3O96A 4XWXA 3RCPA 4DX90 2DHJA 1V89A 2YS5A 2GCLA 1H10A 1AWEA 3KZ1A 3TFMA 5C6RA 1WJMA 1XCGA 4K17A 4A6KA 2N23A 1OMWA 1V88A 1K5GB 2GCJA 1WGQA 2VSZA 3KY9A 3U7DA 2J0JA 1J19A 1MK9B 2COCA 5JHGA 2DHKA 5J3TA 1FGZA 2LYDA 3NSUA 1I7AA 4Y94A 1LB1A 4ZRJA 2IYBA 2Z0OA 1DDVA 1Z87A 3DXCA 1W1HA 4HAWB 1KZGA 2D11A 5DIFB 3A98B 4H8SA 2KUPA 1I2HA 3HW2B 2JP2A 4P7IA 2IFSA 1QQGA 3TO1A 1UNQA 4GPTB 2R09A 1PFJA 3M1IB 1W1DA 1MIXA 1BTKA 1PLSA 1N3HA 5DH9B 1NTYA 3G9WA 2L2IA 1MIZB 4EJNA 1RRPB 1BWNA 3CIKA 5JLJB 3D8FA 1KI1B 2D9ZA 2G35A 2M38A 4TKNA 5C5BB 1K5DB 1OY2A 3BINA 4GMXB 2YVCA 2COFA 4HB4B 4EKUA 2P0FA 2RLOA 1V5UA 1TJ6A 2ADZA 4MT7A 1X1FA 2KGXB 3OANA 1ZC4B 4MY6A 1P5TA 2CAYA 2J0KA 4NSWA 4ZRKA 1WVHA 3AJ4A 1TQZA 3A8PA 3AU4A 2M14A 2H7EA 1M7EA 2DX1A 3ODOA 2DYQA 4WJ7A 4B6HA 5L81A 4K81A 1V5MA 2V76A 3WA0A 4HDQA 1H4RA 4PNKA 4HAXB 2N0YA 4HAVB 2RNRB 2DFKA 3IVFA 1FHXA 3X23A 1NTVA 4PQ0A 3BJIA 5CLLB 2P0DA 3KSYA 3WYFB 3QWMA 2J0MA 3QIJA 1EF1A 3T06A 1NU2A 5KCVA 2YS3A 2MDXA 1U5EA 4YL8A 1DBHA 3HQCA 3PVWA 2AEHA 2MWNB 1U5DA 1UPRA 2NZ8B 5KQ1A 2CODA 1U27A 2EMSA 1EGXA 2W2XC 4GMVA 4HAUB 3P7ZA 2DKQA 2UVMA 2Q13A 4A6FB 1Q67A 1WI1A 1X86A 2LG1A 2FJLA 5HE1A 1EVHA 3VIAA 4DBBA 2HE7A 4KHAA 4A6FA 1XR0B 3V5WA 5EFXA 1WG7A 3DXEA 4HB2B 3AU5A 3ULBA 5FI0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CRF A;  5DHA B;  2RSG A;  5D27 A;  1RJ2 A;  1XX0 A;  3DXD A;  2H7D A;  1XD4 A;  3ZVR A;  2EC1 A;  5C5B A;  4F7H A;  2K00 A;  1FAO A;  2Y8G A;  1NI2 A;  4HHV A;  5J3Y A;  3PG7 A;  2OQB A;  4A6H A;  5HE3 A;  5LON B;  2K2J A;  1UPQ A;  1P3R A;  4NY0 A;  1EAZ A;  4F7G A;  1X05 A;  2P0H A;  5FI1 A;  2PZ1 A;  4IFS A;  4KVG B;  3QBV B;  4K2P A;  5HE2 A;  1FB8 A;  3A8Q A;  4ZRI A;  2ELA A;  2X18 A;  2LUL A;  2D2Q A;  5D3W A;  2P8V A;  1FHO A;  2DHI A;  2RGN B;  1Y19 B;  2BCJ A;  2D9V A;  2LKO A;  1ZVR A;  2D4Q A;  2Z0P A;  3U8Z A;  2DYN A;  4HAZ B;  1UEF A;  1WGU A;  1MAI A;  3FSS A;  3PZD A;  1SHC A;  2J59 M;  4WSF A;  1LW3 A;  3PEG A;  4DX8 A;  1ISN A;  2I5C A;  1SGH A;  2W2W A;  3P6A A;  1Y5O A;  2QKM A;  2KCJ A;  1GC7 A;  4KHB B;  2MKR A;  4YON A;  2VKI A;  4HAT B;  2ELB A;  4IOY X;  1DDW A;  2ROZ B;  1U29 A;  4HB0 B;  2DA0 A;  4EMO A;  4CYE A;  3ZDT A;  1PMS A;  2YS1 A;  3N7C A;  1FHW A;  2D9W A;  3FM8 C;  2VRW B;  1IRS A;  4C0A A;  2AL6 A;  2LOZ A;  3MDB C;  4KAX B;  4WVF B;  2I1K A;  1BTN A;  3TCA A;  5J3Q A;  1DRO A;  3D8D A;  2DKP A;  4DXA B;  1MK7 B;  1ZSQ A;  1TXD A;  3PVL A;  3ODW A;  5CLQ B;  5HE0 A;  2D10 A;  3HK0 A;  1KZ7 A;  1XKE A;  1XOD A;  2NMB A;  2ROV A;  3FEH A;  2YT0 A;  2DLW A;  1X1G A;  2W2X D;  1BAK A;  5KQ4 A;  2D9X A;  1X11 A;  3SYX A;  3SUZ A;  4D0N B;  2R0D A;  2ZPY A;  1GC6 A;  4CHJ A;  1U2B A;  2DX5 A;  1DYN A;  1E5W A;  3KRW A;  3D8E A;  2EMT A;  3LJU X;  2Y7B A;  2UZS A;  3PVU A;  3GYO A;  1UNR A;  1GG3 A;  3PSC A;  4KHO A;  2D9Y A;  5C79 A;  4CHM A;  1DDM A;  3TW1 A;  2MFQ A;  2L1C A;  3MPX A;  1UNP A;  4Z2N A;  2GJY A;  3ODX A;  2YSZ A;  5D3V A;  4BBK A;  4L6E A;  1M7R A;  3F5R A;  2EJ8 A;  4IAP A;  3VOQ A;  3F0W A;  2YF0 A;  5JHH A;  1ZM0 A;  4GZU A;  2I5F A;  5JP4 A;  1B55 A;  2GS0 A;  2RVB B;  2OTX A;  1U5F A;  5DI9 B;  4A5K A;  1ZC3 B;  1MPH A;  4GXB A;  3SV1 A;  1V61 A;  2RUK B;  1W1G A;  2COA A;  3UZT A;  5LOP B;  2K2U A;  1WJ1 A;  3GYP A;  2DN6 A;  5GOW B;  2CY4 A;  2DTC A;  1J0W A;  2XQN M;  2YT1 A;  4K2O A;  4Z2M B;  3SO6 A;  2HTH B;  4TYZ A;  1AQC A;  2UZR A;  2Z0Q A;  3TVV A;  1MKE A;  5C16 A;  1OQN A;  3PP2 A;  1QC6 A;  2CY5 A;  3ULC A;  1FGY A;  4MK0 A;  2QKL A;  4HAY B;  5DHF B;  1V5P A;  2I1J A;  4HDO A;  1U5G A;  2Y8F A;  3ML4 A;  2E2X A;  4GN1 A;  5D3Y A;  3SNH A;  3KRX A;  1P6S A;  2LOX A;  4HB3 B;  5D3X A;  1FOE A;  2YRY A;  3CXB B;  4F7U P;  3O96 A;  4XWX A;  3RCP A;  4DX9 0;  2DHJ A;  1V89 A;  2YS5 A;  2GCL A;  1H10 A;  1AWE A;  3KZ1 A;  3TFM A;  5C6R A;  1WJM A;  1XCG A;  4K17 A;  4A6K A;  2N23 A;  1OMW A;  1V88 A;  1K5G B;  2GCJ A;  1WGQ A;  2VSZ A;  3KY9 A;  3U7D A;  2J0J A;  1J19 A;  1MK9 B;  2COC A;  5JHG A;  2DHK A;  5J3T A;  1FGZ A;  2LYD A;  3NSU A;  1I7A A;  4Y94 A;  1LB1 A;  4ZRJ A;  2IYB A;  2Z0O A;  1DDV A;  1Z87 A;  3DXC A;  1W1H A;  4HAW B;  1KZG A;  2D11 A;  5DIF B;  3A98 B;  4H8S A;  2KUP A;  1I2H A;  3HW2 B;  2JP2 A;  4P7I A;  2IFS A;  1QQG A;  3TO1 A;  1UNQ A;  4GPT B;  2R09 A;  1PFJ A;  3M1I B;  1W1D A;  1MIX A;  1BTK A;  1PLS A;  1N3H A;  5DH9 B;  1NTY A;  3G9W A;  2L2I A;  1MIZ B;  4EJN A;  1RRP B;  1BWN A;  3CIK A;  5JLJ B;  3D8F A;  1KI1 B;  2D9Z A;  2G35 A;  2M38 A;  4TKN A;  5C5B B;  1K5D B;  1OY2 A;  3BIN A;  4GMX B;  2YVC A;  2COF A;  4HB4 B;  4EKU A;  2P0F A;  2RLO A;  1V5U A;  1TJ6 A;  2ADZ A;  4MT7 A;  1X1F A;  2KGX B;  3OAN A;  1ZC4 B;  4MY6 A;  1P5T A;  2CAY A;  2J0K A;  4NSW A;  4ZRK A;  1WVH A;  3AJ4 A;  1TQZ A;  3A8P A;  3AU4 A;  2M14 A;  2H7E A;  1M7E A;  2DX1 A;  3ODO A;  2DYQ A;  4WJ7 A;  4B6H A;  5L81 A;  4K81 A;  1V5M A;  2V76 A;  3WA0 A;  4HDQ A;  1H4R A;  4PNK A;  4HAX B;  2N0Y A;  4HAV B;  2RNR B;  2DFK A;  3IVF A;  1FHX A;  3X23 A;  1NTV A;  4PQ0 A;  3BJI A;  5CLL B;  2P0D A;  3KSY A;  3WYF B;  3QWM A;  2J0M A;  3QIJ A;  1EF1 A;  3T06 A;  1NU2 A;  5KCV A;  2YS3 A;  2MDX A;  1U5E A;  4YL8 A;  1DBH A;  3HQC A;  3PVW A;  2AEH A;  2MWN B;  1U5D A;  1UPR A;  2NZ8 B;  5KQ1 A;  2COD A;  1U27 A;  2EMS A;  1EGX A;  2W2X C;  4GMV A;  4HAU B;  3P7Z A;  2DKQ A;  2UVM A;  2Q13 A;  4A6F B;  1Q67 A;  1WI1 A;  1X86 A;  2LG1 A;  2FJL A;  5HE1 A;  1EVH A;  3VIA A;  4DBB A;  2HE7 A;  4KHA A;  4A6F A;  1XR0 B;  3V5W A;  5EFX A;  1WG7 A;  3DXE A;  4HB2 B;  3AU5 A;  3ULB A;  5FI0 A; 
#chains in the Genus database with same CATH topology
 2CRF A;  5DHA B;  2RSG A;  5D27 A;  1RJ2 A;  1XX0 A;  3A58 A;  3U12 A;  3DXD A;  5I2M A;  2H7D A;  1XD4 A;  3ZVR A;  3DCX A;  2EC1 A;  5C5B A;  4F7H A;  2K00 A;  1FAO A;  2Y8G A;  1NI2 A;  4HHV A;  5J3Y A;  3PG7 A;  2OQB A;  4A6H A;  5HE3 A;  5LON B;  2Z4D A;  2K2J A;  1UPQ A;  1P3R A;  4NY0 A;  1EAZ A;  4F7G A;  1X05 A;  2P0H A;  5FI1 A;  3NW8 A;  2PZ1 A;  2KUQ A;  4IFS A;  4KVG B;  2Z13 A;  3QBV B;  4K2P A;  5HE2 A;  1FB8 A;  3A8Q A;  4ZRI A;  2ELA A;  2X18 A;  2LUL A;  2D2Q A;  5D3W A;  2P8V A;  1FHO A;  2DHI A;  2RGN B;  1Y19 B;  2BCJ A;  2D9V A;  2LKO A;  1ZVR A;  2D4Q A;  2Z0P A;  3U8Z A;  5IRS A;  2DYN A;  4HAZ B;  1UEF A;  1WGU A;  1MAI A;  3FSS A;  3PZD A;  1SHC A;  2RRF A;  2J59 M;  4WSF A;  1LW3 A;  3PEG A;  4DX8 A;  1ISN A;  2I5C A;  1SGH A;  2W2W A;  3P6A A;  1Y5O A;  2QKM A;  2KCJ A;  1GC7 A;  3HIE A;  4KHB B;  3NWA A;  2MKR A;  4YON A;  2VKI A;  4HAT B;  2KIG A;  2ELB A;  4IOY X;  1DDW A;  2ROZ B;  1U29 A;  4HB0 B;  2DA0 A;  4EMO A;  4CYE A;  3ZDT A;  1PMS A;  2YS1 A;  3N7C A;  1FHW A;  2D9W A;  3FM8 C;  2VRW B;  1IRS A;  4C0A A;  2AL6 A;  2LOZ A;  3MDB C;  4KAX B;  4WVF B;  2I1K A;  1BTN A;  3TCA A;  5J3Q A;  1DRO A;  3D8D A;  2DKP A;  4DXA B;  1MK7 B;  1ZSQ A;  1TXD A;  3PVL A;  3ODW A;  5CLQ B;  5HE0 A;  2D10 A;  3HK0 A;  1KZ7 A;  1XKE A;  1XOD A;  2NMB A;  2ROV A;  3FEH A;  2YT0 A;  2DLW A;  1X1G A;  2W2X D;  1BAK A;  5KQ4 A;  2D9X A;  4OT1 A;  1X11 A;  3SYX A;  3SUZ A;  4D0N B;  2R0D A;  2ZPY A;  1GC6 A;  4CHJ A;  1U2B A;  2DX5 A;  1DYN A;  1E5W A;  3KRW A;  3D8E A;  2EMT A;  2FJU B;  3LJU X;  2Y7B A;  2UZS A;  3PVU A;  3GYO A;  1UNR A;  1GG3 A;  3FVC A;  3PSC A;  4KHO A;  2D9Y A;  5C79 A;  4QJ3 B;  4CHM A;  1DDM A;  3TW1 A;  4HSI A;  2MFQ A;  2L1C A;  3MPX A;  1UNP A;  4Z2N A;  2GJY A;  3ODX A;  2YSZ A;  5D3V A;  4BBK A;  4L6E A;  1M7R A;  3F5R A;  2EJ8 A;  4IAP A;  2KR0 A;  3VOQ A;  3F0W A;  3HSA A;  2YF0 A;  5JHH A;  1ZM0 A;  3OHM B;  2I5F A;  4GZU A;  5JP4 A;  1B55 A;  2GS0 A;  2RVB B;  2NBV A;  2OTX A;  4D6W A;  1U5F A;  5DI9 B;  4A5K A;  1ZC3 B;  2K8E A;  1MPH A;  4GXB A;  3SV1 A;  1V61 A;  2RUK B;  1W1G A;  2COA A;  3UZT A;  5LOP B;  2K2U A;  1WJ1 A;  3GYP A;  2DN6 A;  5GOW B;  2CY4 A;  2DTC A;  1J0W A;  4GOU A;  2XQN M;  2YT1 A;  4K2O A;  4Z2M B;  3SO6 A;  2HTH B;  4TYZ A;  4QJ5 B;  1AQC A;  2YT2 A;  2UZR A;  2Z0Q A;  3TVV A;  1MKE A;  5C16 A;  1OQN A;  3PP2 A;  1QC6 A;  2CY5 A;  3ULC A;  1FGY A;  2R2Y A;  4MK0 A;  2QKL A;  5M4Y B;  3NWF A;  4HAY B;  5I2S A;  4OSN A;  5DHF B;  1V5P A;  2I1J A;  4HDO A;  1U5G A;  2Y8F A;  3ML4 A;  2E2X A;  4GN1 A;  4KHB A;  5D3Y A;  3SNH A;  3KRX A;  1P6S A;  2LOX A;  4HB3 B;  5D3X A;  1FOE A;  4GNK B;  2YRY A;  3CXB B;  4F7U P;  3O96 A;  4XWX A;  3RCP A;  4DX9 0;  2DHJ A;  1V89 A;  2YS5 A;  2GCL A;  1H10 A;  1AWE A;  3KZ1 A;  3TFM A;  5C6R A;  1WJM A;  1XCG A;  4K17 A;  4A6K A;  2N23 A;  1OMW A;  1V88 A;  1K5G B;  2GCJ A;  1WGQ A;  2VSZ A;  3KY9 A;  3U7D A;  2J0J A;  1J19 A;  1MK9 B;  2COC A;  5JHG A;  2DHK A;  5J3T A;  1FGZ A;  2LYD A;  3NSU A;  1I7A A;  4Y94 A;  2Z59 A;  1LB1 A;  4ZRJ A;  2IYB A;  2Z0O A;  1DDV A;  1Z87 A;  3DXC A;  1W1H A;  4HAW B;  1KZG A;  2D11 A;  5DIF B;  3A98 B;  4H8S A;  2KUP A;  1I2H A;  3HW2 B;  2JP2 A;  4P7I A;  2IFS A;  1QQG A;  3TO1 A;  1UNQ A;  4GPT B;  2R09 A;  2Z14 A;  1PFJ A;  3M1I B;  1W1D A;  1MIX A;  1BTK A;  1PLS A;  1N3H A;  5DH9 B;  1ZYI A;  1NTY A;  4L1R A;  3G9W A;  2L2I A;  1MIZ B;  4EJN A;  1RRP B;  2K49 A;  1BWN A;  3CIK A;  2GUM A;  5JLJ B;  3D8F A;  4CSQ A;  1KI1 B;  2D9Z A;  2G35 A;  2M38 A;  4TKN A;  5C5B B;  2ZKM X;  1K5D B;  1OY2 A;  3BIN A;  4GMX B;  2YVC A;  2COF A;  1T77 A;  4HB4 B;  4EKU A;  2P0F A;  2RLO A;  4DIX A;  1V5U A;  1TJ6 A;  2ADZ A;  4MT7 A;  1X1F A;  2KGX B;  3OAN A;  1ZC4 B;  4MY6 A;  3B77 A;  4QXA B;  1P5T A;  2CAY A;  2J0K A;  4NSW A;  4ZRK A;  1WVH A;  2KIE A;  3AJ4 A;  1TQZ A;  3A8P A;  3AU4 A;  2M14 A;  2H7E A;  1M7E A;  2DX1 A;  3ODO A;  2DYQ A;  4WJ7 A;  4QJ4 B;  4B6H A;  5L81 A;  4K81 A;  3NWD A;  1V5M A;  2V76 A;  3WA0 A;  4HDQ A;  1H4R A;  4PNK A;  4HAX B;  2N0Y A;  5LG4 B;  4HAV B;  2RNR B;  2DFK A;  3IVF A;  1FHX A;  3X23 A;  1NTV A;  4PQ0 A;  3BJI A;  5CLL B;  2P0D A;  3KSY A;  3WYF B;  1MI1 A;  3QWM A;  2J0M A;  3QIJ A;  1EF1 A;  3T06 A;  1NU2 A;  5KCV A;  2YS3 A;  2MDX A;  1U5E A;  4YL8 A;  1DBH A;  3HQC A;  3PVW A;  2AEH A;  2MWN B;  1U5D A;  1UPR A;  2NZ8 B;  5KQ1 A;  2COD A;  1U27 A;  2EMS A;  1EGX A;  2W2X C;  4GMV A;  4HAU B;  3P7Z A;  2DKQ A;  2UVM A;  2Q13 A;  4A6F B;  1Q67 A;  1WI1 A;  1X86 A;  2LG1 A;  2FJL A;  5HE1 A;  1EVH A;  3VIA A;  4DBB A;  2HE7 A;  4KHA A;  4A6F A;  1XR0 B;  3V5W A;  5EFX A;  1WG7 A;  3DXE A;  4HB2 B;  3AU5 A;  3ULB A;  5FI0 A; 
#chains in the Genus database with same CATH homology
 2CRF A;  5DHA B;  2RSG A;  5D27 A;  1RJ2 A;  1XX0 A;  3DXD A;  2H7D A;  1XD4 A;  3ZVR A;  2EC1 A;  5C5B A;  4F7H A;  2K00 A;  1FAO A;  2Y8G A;  1NI2 A;  4HHV A;  5J3Y A;  3PG7 A;  2OQB A;  4A6H A;  5HE3 A;  5LON B;  2K2J A;  1UPQ A;  1P3R A;  4NY0 A;  1EAZ A;  4F7G A;  1X05 A;  2P0H A;  5FI1 A;  2PZ1 A;  4IFS A;  4KVG B;  3QBV B;  4K2P A;  5HE2 A;  1FB8 A;  3A8Q A;  4ZRI A;  2ELA A;  2X18 A;  2LUL A;  2D2Q A;  5D3W A;  2P8V A;  1FHO A;  2DHI A;  2RGN B;  1Y19 B;  2BCJ A;  2D9V A;  2LKO A;  1ZVR A;  2D4Q A;  2Z0P A;  3U8Z A;  2DYN A;  4HAZ B;  1UEF A;  1WGU A;  1MAI A;  3FSS A;  3PZD A;  1SHC A;  2J59 M;  4WSF A;  1LW3 A;  3PEG A;  4DX8 A;  1ISN A;  2I5C A;  1SGH A;  2W2W A;  3P6A A;  1Y5O A;  2QKM A;  2KCJ A;  1GC7 A;  4KHB B;  2MKR A;  4YON A;  2VKI A;  4HAT B;  2ELB A;  4IOY X;  1DDW A;  2ROZ B;  1U29 A;  4HB0 B;  2DA0 A;  4EMO A;  4CYE A;  3ZDT A;  1PMS A;  2YS1 A;  3N7C A;  1FHW A;  2D9W A;  3FM8 C;  2VRW B;  1IRS A;  4C0A A;  2AL6 A;  2LOZ A;  3MDB C;  4KAX B;  4WVF B;  2I1K A;  1BTN A;  3TCA A;  5J3Q A;  1DRO A;  3D8D A;  2DKP A;  4DXA B;  1MK7 B;  1ZSQ A;  1TXD A;  3PVL A;  3ODW A;  5CLQ B;  5HE0 A;  2D10 A;  3HK0 A;  1KZ7 A;  1XKE A;  1XOD A;  2NMB A;  2ROV A;  3FEH A;  2YT0 A;  2DLW A;  1X1G A;  2W2X D;  1BAK A;  5KQ4 A;  2D9X A;  1X11 A;  3SYX A;  3SUZ A;  4D0N B;  2R0D A;  2ZPY A;  1GC6 A;  4CHJ A;  1U2B A;  2DX5 A;  1DYN A;  1E5W A;  3KRW A;  3D8E A;  2EMT A;  3LJU X;  2Y7B A;  2UZS A;  3PVU A;  3GYO A;  1UNR A;  1GG3 A;  3PSC A;  4KHO A;  2D9Y A;  5C79 A;  4CHM A;  1DDM A;  3TW1 A;  2MFQ A;  2L1C A;  3MPX A;  1UNP A;  4Z2N A;  2GJY A;  3ODX A;  2YSZ A;  5D3V A;  4BBK A;  4L6E A;  1M7R A;  3F5R A;  2EJ8 A;  4IAP A;  3VOQ A;  3F0W A;  2YF0 A;  5JHH A;  1ZM0 A;  4GZU A;  2I5F A;  5JP4 A;  1B55 A;  2GS0 A;  2RVB B;  2OTX A;  1U5F A;  5DI9 B;  4A5K A;  1ZC3 B;  1MPH A;  4GXB A;  3SV1 A;  1V61 A;  2RUK B;  1W1G A;  2COA A;  3UZT A;  5LOP B;  2K2U A;  1WJ1 A;  3GYP A;  2DN6 A;  5GOW B;  2CY4 A;  2DTC A;  1J0W A;  2XQN M;  2YT1 A;  4K2O A;  4Z2M B;  3SO6 A;  2HTH B;  4TYZ A;  1AQC A;  2UZR A;  2Z0Q A;  3TVV A;  1MKE A;  5C16 A;  1OQN A;  3PP2 A;  1QC6 A;  2CY5 A;  3ULC A;  1FGY A;  4MK0 A;  2QKL A;  4HAY B;  5DHF B;  1V5P A;  2I1J A;  4HDO A;  1U5G A;  2Y8F A;  3ML4 A;  2E2X A;  4GN1 A;  5D3Y A;  3SNH A;  3KRX A;  1P6S A;  2LOX A;  4HB3 B;  5D3X A;  1FOE A;  2YRY A;  3CXB B;  4F7U P;  3O96 A;  4XWX A;  3RCP A;  4DX9 0;  2DHJ A;  1V89 A;  2YS5 A;  2GCL A;  1H10 A;  1AWE A;  3KZ1 A;  3TFM A;  5C6R A;  1WJM A;  1XCG A;  4K17 A;  4A6K A;  2N23 A;  1OMW A;  1V88 A;  1K5G B;  2GCJ A;  1WGQ A;  2VSZ A;  3KY9 A;  3U7D A;  2J0J A;  1J19 A;  1MK9 B;  2COC A;  5JHG A;  2DHK A;  5J3T A;  1FGZ A;  2LYD A;  3NSU A;  1I7A A;  4Y94 A;  1LB1 A;  4ZRJ A;  2IYB A;  2Z0O A;  1DDV A;  1Z87 A;  3DXC A;  1W1H A;  4HAW B;  1KZG A;  2D11 A;  5DIF B;  3A98 B;  4H8S A;  2KUP A;  1I2H A;  3HW2 B;  2JP2 A;  4P7I A;  2IFS A;  1QQG A;  3TO1 A;  1UNQ A;  4GPT B;  2R09 A;  1PFJ A;  3M1I B;  1W1D A;  1MIX A;  1BTK A;  1PLS A;  1N3H A;  5DH9 B;  1NTY A;  3G9W A;  2L2I A;  1MIZ B;  4EJN A;  1RRP B;  1BWN A;  3CIK A;  5JLJ B;  3D8F A;  1KI1 B;  2D9Z A;  2G35 A;  2M38 A;  4TKN A;  5C5B B;  1K5D B;  1OY2 A;  3BIN A;  4GMX B;  2YVC A;  2COF A;  4HB4 B;  4EKU A;  2P0F A;  2RLO A;  1V5U A;  1TJ6 A;  2ADZ A;  4MT7 A;  1X1F A;  2KGX B;  3OAN A;  1ZC4 B;  4MY6 A;  1P5T A;  2CAY A;  2J0K A;  4NSW A;  4ZRK A;  1WVH A;  3AJ4 A;  1TQZ A;  3A8P A;  3AU4 A;  2M14 A;  2H7E A;  1M7E A;  2DX1 A;  3ODO A;  2DYQ A;  4WJ7 A;  4B6H A;  5L81 A;  4K81 A;  1V5M A;  2V76 A;  3WA0 A;  4HDQ A;  1H4R A;  4PNK A;  4HAX B;  2N0Y A;  4HAV B;  2RNR B;  2DFK A;  3IVF A;  1FHX A;  3X23 A;  1NTV A;  4PQ0 A;  3BJI A;  5CLL B;  2P0D A;  3KSY A;  3WYF B;  3QWM A;  2J0M A;  3QIJ A;  1EF1 A;  3T06 A;  1NU2 A;  5KCV A;  2YS3 A;  2MDX A;  1U5E A;  4YL8 A;  1DBH A;  3HQC A;  3PVW A;  2AEH A;  2MWN B;  1U5D A;  1UPR A;  2NZ8 B;  5KQ1 A;  2COD A;  1U27 A;  2EMS A;  1EGX A;  2W2X C;  4GMV A;  4HAU B;  3P7Z A;  2DKQ A;  2UVM A;  2Q13 A;  4A6F B;  1Q67 A;  1WI1 A;  1X86 A;  2LG1 A;  2FJL A;  5HE1 A;  1EVH A;  3VIA A;  4DBB A;  2HE7 A;  4KHA A;  4A6F A;  1XR0 B;  3V5W A;  5EFX A;  1WG7 A;  3DXE A;  4HB2 B;  3AU5 A;  3ULB A;  5FI0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...