2Z14A

Crystal structure of the n-terminal duf1126 in human ef-hand domain containing 2 protein
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
121
structure length
116
Chain Sequence
SGWVAFDKQVLSFDAYLEEEVLDKSQTNYRIRYYKIYFYPEDDTIQVNEPELLQGTSIRRHRITLPPPDEDQFYTVYHFNVGTEVVFYGRTFKIYDCDAFTRNFLRKIGVKVNPPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the N-terminal DUF1126 in human ef-hand domain containing 2 protein
rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords EF-hand domain-containing family member C2
total genus 23
structure length 116
sequence length 121
ec nomenclature
pdb deposition date 2007-05-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.170 Mainly Beta Roll PH-domain like PH-domain like 2z14A00
2Z14A 2Z13A
chains in the Genus database with same CATH superfamily
1PFJA 1J19A 2D9YA 2P8VA 5KQ1A 3A8QA 3G9WA 3GYPA 1BTNA 4WVFB 1XR0B 2MWNB 2L2IA 1BTKA 3CXBB 5C5BA 4MY6A 5HE2A 3LJUX 1PMSA 2YS1A 2RLOA 4CSQA 1WI1A 2KIGA 5HE3A 3D8DA 3PVWA 4XWXA 2N0YA 2GUMA 5C79A 4P7IA 3SO6A 5D27A 4HHVA 1TXDA 2I5CA 2JP2A 3HK0A 3FEHA 5D3YA 3ODWA 5C6RA 2YRYA 3HIEA 2KUQA 4DX8A 1RRPB 2N23A 4OT1A 2LYDA 3QBVB 4QJ3B 1FHWA 3ML4A 5DH9B 1Y19B 4PNKA 1J0WA 2AL6A 4HB2B 2DX5A 4Z2MB 3TO1A 5JP4A 1NTVA 1U5FA 2MFQA 5J3TA 2H7DA 2YT0A 3FSSA 5J3YA 2D9VA 2YS5A 4L6EA 1KZ7A 2CRFA 3M1IB 2D2QA 2FJUB 2QKLA 1XCGA 4DX90 1ZM0A 5LG4B 4KVGB 1M7RA 2LKOA 2RVBB 1XKEA 3U12A 4HAYB 3A58A 2D9ZA 3F5RA 4HB4B 4ZRIA 2J0JA 1MPHA 4QXAB 1MIZB 1V89A 3SUZA 2HTHB 3UZTA 1PLSA 2UZRA 2Y8GA 2DKQA 1OY2A 2ROVA 2K8EA 1I7AA 2J0MA 4H8SA 2XQNM 1I2HA 2I5FA 4KAXB 4IFSA 1WJ1A 2ELBA 1MK7B 2VSZA 2GS0A 1BAKA 1WGUA 2DYNA 2DFKA 3AU5A 3HSAA 2RUKB 1FAOA 3KRWA 4F7HA 2DX1A 2YF0A 1UNPA 4K17A 2VRWB 1BWNA 2MKRA 2Z0QA 1DYNA 1UEFA 1MK9B 2K00A 1GC7A 3DXEA 2YS3A 3GYOA 2I1JA 1FOEA 3ULCA 4BBKA 5D3VA 1T77A 1WGQA 1QQGA 2W2WA 1H10A 2J59M 2J0KA 3PZDA 3QIJA 3WYFB 4GOUA 4IOYX 4ZRJA 3X23A 2MDXA 2RRFA 5KQ4A 1ZC4B 1U5DA 4QJ4B 3PSCA 3AU4A 3V5WA 5L81A 4GPTB 1P3RA 3D8FA 2D11A 2G35A 2D9XA 3KRXA 4A6FB 3IVFA 1V5MA 2COAA 5JHGA 2D9WA 2UZSA 1V5UA 2EJ8A 4A5KA 4F7UP 5DHAB 4IAPA 2LOXA 3MDBC 2X18A 2Z0PA 3ULBA 1TQZA 5GOWB 5JLJB 4YL8A 4HAWB 3OHMB 5D3WA 4NSWA 4GXBA 4GMVA 2LOZA 3ODXA 5CLLB 1ZSQA 3PVLA 4EKUA 2ZPYA 5JHHA 3DCXA 1XD4A 2DKPA 2DHKA 3KY9A 3OANA 4HB3B 3SNHA 1EF1A 2CY5A 1V61A 4WSFA 1LW3A 4Y94A 5C16A 1SHCA 3QWMA 4HAVB 2Z59A 1X1GA 4L1RA 2IFSA 2Z4DA 2EMTA 1E5WA 4EMOA 4CHJA 2ROZB 1X11A 1ZYIA 3ZVRA 4WJ7A 2Z13A 3A98B 3FVCA 2HE7A 2V76A 2R2YA 5CLQB 5DI9B 3D8EA 4HATB 1EVHA 1MKEA 3VIAA 3WA0A 1FB8A 1P6SA 1RJ2A 1ISNA 1TJ6A 1UPRA 2COCA 4ZRKA 2R09A 2VKIA 1SGHA 4MK0A 1DROA 2Y7BA 2GCLA 2Z14A 5HE0A 2OTXA 5C5BB 1OQNA 1MAIA 1Y5OA 3DXCA 2CY4A 2W2XC 1N3HA 2I1KA 2PZ1A 2KIEA 1GC6A 2LG1A 5HE1A 2NMBA 2M38A 1LB1A 2Z0OA 2OQBA 1DDVA 4A6FA 3TVVA 1W1DA 1X1FA 1NI2A 3RCPA 2DYQA 4TKNA 1V88A 2DTCA 2UVMA 2D10A 1KZGA 4KHBA 2YT2A 5M4YB 1K5GB 2LULA 3PG7A 1XX0A 1K5DB 5LONB 1EGXA 2E2XA 1FHXA 2CAYA 1WJMA 4HAXB 1U5EA 3FM8C 1XODA 3TFMA 2K2JA 3NWFA 2YSZA 4GZUA 1Q67A 3NWAA 4EJNA 4YONA 3KZ1A 4F7GA 2CODA 4A6KA 4DXAB 3HQCA 4TYZA 1H4RA 4HDQA 2NZ8B 3A8PA 4DBBA 3AJ4A 2Y8FA 2EMSA 4HAUB 2P0DA 4KHAA 1DDMA 3NSUA 2ZKMX 1WVHA 2P0FA 4NY0A 2D4QA 2COFA 4HSIA 4A6HA 1UNRA 1V5PA 5I2MA 2K49A 3P6AA 1FGYA 5D3XA 2R0DA 1AQCA 2FJLA 3U7DA 4KHBB 1FHOA 1KI1B 4PQ0A 1DBHA 3KSYA 1GG3A 2ADZA 1P5TA 4GMXB 1AWEA 2P0HA 2M14A 2DHJA 4CHMA 4DIXA 1OMWA 3CIKA 3ZDTA 5FI0A 2KR0A 1ZVRA 2RSGA 3SV1A 5LOPB 2BCJA 1W1GA 2NBVA 2YVCA 2YT1A 5KCVA 1Z87A 3HW2B 1M7EA 1NU2A 2QKMA 1U5GA 2Q13A 2KUPA 2KGXB 1WG7A 3B77A 4K2PA 3TW1A 2H7EA 2GCJA 2K2UA 2DHIA 1QC6A 3NWDA 1DDWA 3O96A 4HB0B 1X05A 2IYBA 4KHOA 1MI1A 5FI1A 3PEGA 4Z2NA 4MT7A 1W1HA 4D6WA 4GNKB 2DLWA 1UNQA 2KCJA 5DHFB 3PVUA 5EFXA 3T06A 2DN6A 4QJ5B 1U27A 4K2OA 4K81A 2L1CA 4OSNA 1NTYA 2GJYA 3VOQA 2ELAA 1MIXA 3TCAA 3MPXA 5J3QA 3SYXA 3BJIA 3BINA 1B55A 2EC1A 3N7CA 2AEHA 4HAZB 3U8ZA 1UPQA 5DIFB 4CYEA 4B6HA 1EAZA 3DXDA 1ZC3B 1U29A 1U2BA 3ODOA 4C0AA 2RNRB 3P7ZA 5IRSA 2RGNB 4GN1A 3NW8A 4D0NB 4HDOA 1IRSA 1X86A 3F0WA 2W2XD 2DA0A 3PP2A 5I2SA 1FGZA
chains in the Genus database with same CATH topology
4Z2NA 2R2YA 5M4YB 4D6WA 5I2MA 3TO1A 4Z2MB 4GNKB 2NBVA 4GOUA 4IOYX 2KIEA 3U12A 2RRFA 3GYPA 3A58A 4QJ4B 4KHBB 4PQ0A 4QXAB 5I2SA 3FSSA 3OHMB 5IRSA 4KHAA 3TW1A 4QJ5B 3NW8A 4OSNA 3GYOA 2Z59A 2GCJA 2KUQA 3HIEA 4L1RA 4DIXA 3TVVA 2ZKMX 3NWFA 2Z4DA 2FJUB 2K8EA 3NWAA 2KR0A 2Z14A 2GCLA 3NWDA 4OT1A 4CSQA 2KIGA 2GUMA 1ZYIA 4QJ3B 2Z13A 5LG4B 3FVCA 4HSIA 4IFSA 4KHOA 4KHBA 2YT2A 2K49A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z14 A;  2Z13 A; 
#chains in the Genus database with same CATH topology
 1PFJ A;  1J19 A;  2D9Y A;  2P8V A;  5KQ1 A;  3A8Q A;  3G9W A;  3GYP A;  1BTN A;  4WVF B;  1XR0 B;  2MWN B;  2L2I A;  1BTK A;  3CXB B;  5C5B A;  4MY6 A;  5HE2 A;  3LJU X;  1PMS A;  2YS1 A;  2RLO A;  4CSQ A;  1WI1 A;  2KIG A;  5HE3 A;  3D8D A;  3PVW A;  4XWX A;  2N0Y A;  2GUM A;  5C79 A;  4P7I A;  3SO6 A;  5D27 A;  4HHV A;  1TXD A;  2I5C A;  2JP2 A;  3HK0 A;  3FEH A;  5D3Y A;  3ODW A;  5C6R A;  2YRY A;  3HIE A;  2KUQ A;  4DX8 A;  1RRP B;  2N23 A;  4OT1 A;  2LYD A;  3QBV B;  4QJ3 B;  1FHW A;  3ML4 A;  5DH9 B;  1Y19 B;  4PNK A;  1J0W A;  2AL6 A;  4HB2 B;  2DX5 A;  4Z2M B;  3TO1 A;  5JP4 A;  1NTV A;  1U5F A;  2MFQ A;  5J3T A;  2H7D A;  2YT0 A;  3FSS A;  5J3Y A;  2D9V A;  2YS5 A;  4L6E A;  1KZ7 A;  2CRF A;  3M1I B;  2D2Q A;  2FJU B;  2QKL A;  1XCG A;  4DX9 0;  1ZM0 A;  5LG4 B;  4KVG B;  1M7R A;  2LKO A;  2RVB B;  1XKE A;  3U12 A;  4HAY B;  3A58 A;  2D9Z A;  3F5R A;  4HB4 B;  4ZRI A;  2J0J A;  1MPH A;  4QXA B;  1MIZ B;  1V89 A;  3SUZ A;  2HTH B;  3UZT A;  1PLS A;  2UZR A;  2Y8G A;  2DKQ A;  1OY2 A;  2ROV A;  2K8E A;  1I7A A;  2J0M A;  4H8S A;  2XQN M;  1I2H A;  2I5F A;  4KAX B;  4IFS A;  1WJ1 A;  2ELB A;  1MK7 B;  2VSZ A;  2GS0 A;  1BAK A;  1WGU A;  2DYN A;  2DFK A;  3AU5 A;  3HSA A;  2RUK B;  1FAO A;  3KRW A;  4F7H A;  2DX1 A;  2YF0 A;  1UNP A;  4K17 A;  2VRW B;  1BWN A;  2MKR A;  2Z0Q A;  1DYN A;  1UEF A;  1MK9 B;  2K00 A;  1GC7 A;  3DXE A;  2YS3 A;  3GYO A;  2I1J A;  1FOE A;  3ULC A;  4BBK A;  5D3V A;  1T77 A;  1WGQ A;  1QQG A;  2W2W A;  1H10 A;  2J59 M;  2J0K A;  3PZD A;  3QIJ A;  3WYF B;  4GOU A;  4IOY X;  4ZRJ A;  3X23 A;  2MDX A;  2RRF A;  5KQ4 A;  1ZC4 B;  1U5D A;  4QJ4 B;  3PSC A;  3AU4 A;  3V5W A;  5L81 A;  4GPT B;  1P3R A;  3D8F A;  2D11 A;  2G35 A;  2D9X A;  3KRX A;  4A6F B;  3IVF A;  1V5M A;  2COA A;  5JHG A;  2D9W A;  2UZS A;  1V5U A;  2EJ8 A;  4A5K A;  4F7U P;  5DHA B;  4IAP A;  2LOX A;  3MDB C;  2X18 A;  2Z0P A;  3ULB A;  1TQZ A;  5GOW B;  5JLJ B;  4YL8 A;  4HAW B;  3OHM B;  5D3W A;  4NSW A;  4GXB A;  4GMV A;  2LOZ A;  3ODX A;  5CLL B;  1ZSQ A;  3PVL A;  4EKU A;  2ZPY A;  5JHH A;  3DCX A;  1XD4 A;  2DKP A;  2DHK A;  3KY9 A;  3OAN A;  4HB3 B;  3SNH A;  1EF1 A;  2CY5 A;  1V61 A;  4WSF A;  1LW3 A;  4Y94 A;  5C16 A;  1SHC A;  3QWM A;  4HAV B;  2Z59 A;  1X1G A;  4L1R A;  2IFS A;  2Z4D A;  2EMT A;  1E5W A;  4EMO A;  4CHJ A;  2ROZ B;  1X11 A;  1ZYI A;  3ZVR A;  4WJ7 A;  2Z13 A;  3A98 B;  3FVC A;  2HE7 A;  2V76 A;  2R2Y A;  5CLQ B;  5DI9 B;  3D8E A;  4HAT B;  1EVH A;  1MKE A;  3VIA A;  3WA0 A;  1FB8 A;  1P6S A;  1RJ2 A;  1ISN A;  1TJ6 A;  1UPR A;  2COC A;  4ZRK A;  2R09 A;  2VKI A;  1SGH A;  4MK0 A;  1DRO A;  2Y7B A;  2GCL A;  2Z14 A;  5HE0 A;  2OTX A;  5C5B B;  1OQN A;  1MAI A;  1Y5O A;  3DXC A;  2CY4 A;  2W2X C;  1N3H A;  2I1K A;  2PZ1 A;  2KIE A;  1GC6 A;  2LG1 A;  5HE1 A;  2NMB A;  2M38 A;  1LB1 A;  2Z0O A;  2OQB A;  1DDV A;  4A6F A;  3TVV A;  1W1D A;  1X1F A;  1NI2 A;  3RCP A;  2DYQ A;  4TKN A;  1V88 A;  2DTC A;  2UVM A;  2D10 A;  1KZG A;  4KHB A;  2YT2 A;  5M4Y B;  1K5G B;  2LUL A;  3PG7 A;  1XX0 A;  1K5D B;  5LON B;  1EGX A;  2E2X A;  1FHX A;  2CAY A;  1WJM A;  4HAX B;  1U5E A;  3FM8 C;  1XOD A;  3TFM A;  2K2J A;  3NWF A;  2YSZ A;  4GZU A;  1Q67 A;  3NWA A;  4EJN A;  4YON A;  3KZ1 A;  4F7G A;  2COD A;  4A6K A;  4DXA B;  3HQC A;  4TYZ A;  1H4R A;  4HDQ A;  2NZ8 B;  3A8P A;  4DBB A;  3AJ4 A;  2Y8F A;  2EMS A;  4HAU B;  2P0D A;  4KHA A;  1DDM A;  3NSU A;  2ZKM X;  1WVH A;  2P0F A;  4NY0 A;  2D4Q A;  2COF A;  4HSI A;  4A6H A;  1UNR A;  1V5P A;  5I2M A;  2K49 A;  3P6A A;  1FGY A;  5D3X A;  2R0D A;  1AQC A;  2FJL A;  3U7D A;  4KHB B;  1FHO A;  1KI1 B;  4PQ0 A;  1DBH A;  3KSY A;  1GG3 A;  2ADZ A;  1P5T A;  4GMX B;  1AWE A;  2P0H A;  2M14 A;  2DHJ A;  4CHM A;  4DIX A;  1OMW A;  3CIK A;  3ZDT A;  5FI0 A;  2KR0 A;  1ZVR A;  2RSG A;  3SV1 A;  5LOP B;  2BCJ A;  1W1G A;  2NBV A;  2YVC A;  2YT1 A;  5KCV A;  1Z87 A;  3HW2 B;  1M7E A;  1NU2 A;  2QKM A;  1U5G A;  2Q13 A;  2KUP A;  2KGX B;  1WG7 A;  3B77 A;  4K2P A;  3TW1 A;  2H7E A;  2GCJ A;  2K2U A;  2DHI A;  1QC6 A;  3NWD A;  1DDW A;  3O96 A;  4HB0 B;  1X05 A;  2IYB A;  4KHO A;  1MI1 A;  5FI1 A;  3PEG A;  4Z2N A;  4MT7 A;  1W1H A;  4D6W A;  4GNK B;  2DLW A;  1UNQ A;  2KCJ A;  5DHF B;  3PVU A;  5EFX A;  3T06 A;  2DN6 A;  4QJ5 B;  1U27 A;  4K2O A;  4K81 A;  2L1C A;  4OSN A;  1NTY A;  2GJY A;  3VOQ A;  2ELA A;  1MIX A;  3TCA A;  3MPX A;  5J3Q A;  3SYX A;  3BJI A;  3BIN A;  1B55 A;  2EC1 A;  3N7C A;  2AEH A;  4HAZ B;  3U8Z A;  1UPQ A;  5DIF B;  4CYE A;  4B6H A;  1EAZ A;  3DXD A;  1ZC3 B;  1U29 A;  1U2B A;  3ODO A;  4C0A A;  2RNR B;  3P7Z A;  5IRS A;  2RGN B;  4GN1 A;  3NW8 A;  4D0N B;  4HDO A;  1IRS A;  1X86 A;  3F0W A;  2W2X D;  2DA0 A;  3PP2 A;  5I2S A;  1FGZ A; 
#chains in the Genus database with same CATH homology
 4Z2N A;  2R2Y A;  5M4Y B;  4D6W A;  5I2M A;  3TO1 A;  4Z2M B;  4GNK B;  2NBV A;  4GOU A;  4IOY X;  2KIE A;  3U12 A;  2RRF A;  3GYP A;  3A58 A;  4QJ4 B;  4KHB B;  4PQ0 A;  4QXA B;  5I2S A;  3FSS A;  3OHM B;  5IRS A;  4KHA A;  3TW1 A;  4QJ5 B;  3NW8 A;  4OSN A;  3GYO A;  2Z59 A;  2GCJ A;  2KUQ A;  3HIE A;  4L1R A;  4DIX A;  3TVV A;  2ZKM X;  3NWF A;  2Z4D A;  2FJU B;  2K8E A;  3NWA A;  2KR0 A;  2Z14 A;  2GCL A;  3NWD A;  4OT1 A;  4CSQ A;  2KIG A;  2GUM A;  1ZYI A;  4QJ3 B;  2Z13 A;  5LG4 B;  3FVC A;  4HSI A;  4IFS A;  4KHO A;  4KHB A;  2YT2 A;  2K49 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...