2Z14A

Crystal structure of the n-terminal duf1126 in human ef-hand domain containing 2 protein
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
121
structure length
116
Chain Sequence
SGWVAFDKQVLSFDAYLEEEVLDKSQTNYRIRYYKIYFYPEDDTIQVNEPELLQGTSIRRHRITLPPPDEDQFYTVYHFNVGTEVVFYGRTFKIYDCDAFTRNFLRKIGVKVNPPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords EF-hand domain-containing family member C2
publication title Crystal structure of the N-terminal DUF1126 in human ef-hand domain containing 2 protein
rcsb
source organism Homo sapiens
total genus 23
structure length 116
sequence length 121
ec nomenclature
pdb deposition date 2007-05-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.170 Mainly Beta Roll PH-domain like PH-domain like 2z14A00
2Z13A 2Z14A
chains in the Genus database with same CATH superfamily
2Y8FA 5D3YA 1ZC3B 5KQ4A 5HE1A 1LB1A 2Z0OA 5C5BA 2D9WA 1M7EA 2KUQA 4NSWA 5LONB 4QJ3B 4TYZA 1FB8A 2Z14A 4HDOA 2W2XD 4KHAA 2PZ1A 3TW1A 1V61A 4QXAB 2DX1A 4K17A 2CRFA 4F7GA 4IFSA 4TKNA 2RVBB 2ADZA 3NWFA 4L1RA 2DLWA 4HAZB 2N0YA 1Y19B 2YVCA 5C79A 1W1HA 5D3XA 2I5FA 2CAYA 3AU4A 3PEGA 1DDWA 5JLJB 2DTCA 5J3TA 1ZVRA 1P5TA 3QWMA 2L1CA 1Y5OA 4L6EA 3VOQA 2RRFA 2R0DA 1FHXA 3QBVB 2VRWB 2IYBA 5FI1A 2G35A 5FI0A 4NY0A 2YS5A 4P7IA 1WG7A 4GOUA 2DFKA 3TCAA 2EC1A 1WJ1A 2Y8GA 3A8QA 5CLLB 4A5KA 2I1JA 1UNRA 3U8ZA 1V5PA 4YONA 1UEFA 4YL8A 1WJMA 5EFXA 3PP2A 2VKIA 3FM8C 3GYPA 3NW8A 4MK0A 2EMTA 2LOXA 4F7UP 3WYFB 3AU5A 3A98B 1UPRA 2UZSA 3M1IB 2Z13A 2ELBA 4KVGB 4GMVA 4DXAB 2Z59A 2R09A 1X86A 3PG7A 2KIGA 4OSNA 5J3YA 1DDVA 4A6KA 2FJUB 1U27A 1BTKA 3T06A 4HB2B 3A58A 3N7CA 1K5DB 2DKPA 3NSUA 2ELAA 2YSZA 4DBBA 3PVWA 1GG3A 4ZRKA 1BAKA 1U5DA 2I5CA 2I1KA 2OQBA 5CLQB 3P7ZA 5DIFB 1J19A 2D10A 3F0WA 3D8FA 1V89A 1MKEA 2D9ZA 1U5GA 3VIAA 1WVHA 3ZDTA 4DX8A 3P6AA 2M38A 2J0KA 3U7DA 1QQGA 1QC6A 1U29A 4HB0B 3HW2B 2QKLA 1XODA 2HE7A 2X18A 2AEHA 1RJ2A 1DROA 4QJ4B 4CSQA 3DXCA 4Z2MB 1NI2A 1EGXA 3HSAA 3KRXA 3MPXA 1LW3A 3F5RA 1PLSA 2E2XA 5J3QA 1PMSA 2DKQA 3PZDA 2COCA 2R2YA 4HB4B 2K2UA 2RUKB 1UNQA 1XD4A 3MDBC 3ODOA 4KHOA 1MIXA 5DHAB 2FJLA 1OQNA 1XX0A 4KHBB 2CY4A 2ROVA 1GC7A 2D9VA 1H4RA 2J0MA 4H8SA 1ISNA 1PFJA 1BWNA 1NTYA 1P6SA 4HSIA 5JHGA 3PVLA 1DDMA 1TQZA 3CXBB 2K2JA 1X1FA 4KHBA 3SNHA 4EKUA 5M4YB 1FAOA 3QIJA 1SGHA 1EAZA 2MFQA 3LJUX 5D3WA 4ZRIA 4GNKB 1T77A 5DI9B 2H7DA 1FGYA 2YRYA 1TXDA 4HAUB 4K2OA 2DHIA 1AWEA 1ZM0A 2YS3A 5D3VA 1OMWA 3SO6A 1GC6A 1DYNA 3SUZA 1U5FA 2D2QA 5GOWB 4A6FB 3ZVRA 3PSCA 2Z0QA 4WJ7A 3SV1A 1MK7B 1Q67A 5D27A 2KGXB 4HAWB 1TJ6A 1FOEA 5HE0A 1OY2A 1MK9B 2NMBA 3DXDA 4F7HA 4PQ0A 5L81A 4A6FA 2L2IA 3ULCA 3OANA 2K49A 2UZRA 3ODWA 2P0FA 1KZ7A 2M14A 2ROZB 3FSSA 2DA0A 4Z2NA 2AL6A 4DX90 4CYEA 1FGZA 5C16A 1V5UA 1MIZB 1J0WA 1XR0B 2LG1A 2KR0A 2YT2A 4GPTB 1E5WA 2GJYA 1NU2A 2GUMA 2EJ8A 4K2PA 1N3HA 3UZTA 3IVFA 2HTHB 3B77A 2ZKMX 2P0DA 4PNKA 3WA0A 1BTNA 4XWXA 3ML4A 1H10A 5KQ1A 1Z87A 2LOZA 4GMXB 2CY5A 2V76A 3DXEA 3AJ4A 5IRSA 3HK0A 4OT1A 5I2SA 1I7AA 2GCLA 3KSYA 2K8EA 4WSFA 5JHHA 4MT7A 3KRWA 2ZPYA 3BJIA 2W2XC 3HQCA 2DN6A 2N23A 4GXBA 4Y94A 1MPHA 3PVUA 4QJ5B 5KCVA 4HAYB 2IFSA 1EF1A 2GCJA 1V88A 2DHJA 2JP2A 3TO1A 4B6HA 1AQCA 2MKRA 3SYXA 2BCJA 2KIEA 2RGNB 2DYNA 1SHCA 2YS1A 1K5GB 4A6HA 2P0HA 2EMSA 4CHJA 3X23A 3KY9A 4HAVB 1X11A 3FVCA 4IOYX 4D0NB 3O96A 5C6RA 3CIKA 2RLOA 2Z4DA 3ODXA 2YF0A 1ZYIA 1X05A 2J59M 1IRSA 1W1GA 1FHWA 4ZRJA 2YT1A 2DYQA 3TFMA 4D6WA 2XQNM 2Y7BA 1DBHA 1EVHA 1W1DA 1MAIA 2QKMA 1ZSQA 3D8EA 3ULBA 4HDQA 3NWDA 1U5EA 3NWAA 2NZ8B 1I2HA 2DX5A 5LOPB 2D11A 4DIXA 3RCPA 5HE3A 2D9XA 4IAPA 2J0JA 1KI1B 2UVMA 1WGUA 5LG4B 2LKOA 1XCGA 3GYOA 3D8DA 1FHOA 4EJNA 1NTVA 1XKEA 1M7RA 3DCXA 4HAXB 2KUPA 4CHMA 3BINA 4KAXB 1P3RA 1B55A 2LYDA 1MI1A 3TVVA 2DHKA 2D9YA 4BBKA 1UPQA 3A8PA 2MDXA 2Z0PA 3U12A 2P8VA 3OHMB 2OTXA 4HB3B 3V5WA 4HATB 2RSGA 3FEHA 2NBVA 1RRPB 1ZC4B 2COAA 4MY6A 5DH9B 5JP4A 2RNRB 4C0AA 3G9WA 2LULA 4HHVA 1WGQA 3KZ1A 1V5MA 2GS0A 5I2MA 1X1GA 4EMOA 4GN1A 2YT0A 2Q13A 1WI1A 2COFA 2K00A 1U2BA 2MWNB 2H7EA 1KZGA 5DHFB 5HE2A 1UNPA 5C5BB 2W2WA 2CODA 3HIEA 2KCJA 4K81A 4WVFB 4GZUA 2D4QA 2VSZA
chains in the Genus database with same CATH topology
2GCLA 2YT2A 3GYPA 4L1RA 3TVVA 4DIXA 3NW8A 2KIEA 4GNKB 2K8EA 4KHBB 4OT1A 4QJ4B 4D6WA 2GUMA 4CSQA 4Z2MB 5I2MA 3U12A 4GOUA 2KUQA 4PQ0A 2ZKMX 3OHMB 4QJ3B 5LG4B 2Z13A 2K49A 4HSIA 3GYOA 2Z59A 2Z14A 2R2YA 2KIGA 4OSNA 2NBVA 4KHAA 3FVCA 4IOYX 4QJ5B 3NWDA 4KHBA 2FJUB 3FSSA 4QXAB 3TW1A 4Z2NA 5M4YB 3NWAA 3HIEA 2Z4DA 2GCJA 2RRFA 3A58A 1ZYIA 4KHOA 3TO1A 5IRSA 4IFSA 5I2SA 3NWFA 2KR0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z13 A;  2Z14 A; 
#chains in the Genus database with same CATH topology
 2Y8F A;  5D3Y A;  1ZC3 B;  5KQ4 A;  5HE1 A;  1LB1 A;  2Z0O A;  5C5B A;  2D9W A;  1M7E A;  2KUQ A;  4NSW A;  5LON B;  4QJ3 B;  4TYZ A;  1FB8 A;  2Z14 A;  4HDO A;  2W2X D;  4KHA A;  2PZ1 A;  3TW1 A;  1V61 A;  4QXA B;  2DX1 A;  4K17 A;  2CRF A;  4F7G A;  4IFS A;  4TKN A;  2RVB B;  2ADZ A;  3NWF A;  4L1R A;  2DLW A;  4HAZ B;  2N0Y A;  1Y19 B;  2YVC A;  5C79 A;  1W1H A;  5D3X A;  2I5F A;  2CAY A;  3AU4 A;  3PEG A;  1DDW A;  5JLJ B;  2DTC A;  5J3T A;  1ZVR A;  1P5T A;  3QWM A;  2L1C A;  1Y5O A;  4L6E A;  3VOQ A;  2RRF A;  2R0D A;  1FHX A;  3QBV B;  2VRW B;  2IYB A;  5FI1 A;  2G35 A;  5FI0 A;  4NY0 A;  2YS5 A;  4P7I A;  1WG7 A;  4GOU A;  2DFK A;  3TCA A;  2EC1 A;  1WJ1 A;  2Y8G A;  3A8Q A;  5CLL B;  4A5K A;  2I1J A;  1UNR A;  3U8Z A;  1V5P A;  4YON A;  1UEF A;  4YL8 A;  1WJM A;  5EFX A;  3PP2 A;  2VKI A;  3FM8 C;  3GYP A;  3NW8 A;  4MK0 A;  2EMT A;  2LOX A;  4F7U P;  3WYF B;  3AU5 A;  3A98 B;  1UPR A;  2UZS A;  3M1I B;  2Z13 A;  2ELB A;  4KVG B;  4GMV A;  4DXA B;  2Z59 A;  2R09 A;  1X86 A;  3PG7 A;  2KIG A;  4OSN A;  5J3Y A;  1DDV A;  4A6K A;  2FJU B;  1U27 A;  1BTK A;  3T06 A;  4HB2 B;  3A58 A;  3N7C A;  1K5D B;  2DKP A;  3NSU A;  2ELA A;  2YSZ A;  4DBB A;  3PVW A;  1GG3 A;  4ZRK A;  1BAK A;  1U5D A;  2I5C A;  2I1K A;  2OQB A;  5CLQ B;  3P7Z A;  5DIF B;  1J19 A;  2D10 A;  3F0W A;  3D8F A;  1V89 A;  1MKE A;  2D9Z A;  1U5G A;  3VIA A;  1WVH A;  3ZDT A;  4DX8 A;  3P6A A;  2M38 A;  2J0K A;  3U7D A;  1QQG A;  1QC6 A;  1U29 A;  4HB0 B;  3HW2 B;  2QKL A;  1XOD A;  2HE7 A;  2X18 A;  2AEH A;  1RJ2 A;  1DRO A;  4QJ4 B;  4CSQ A;  3DXC A;  4Z2M B;  1NI2 A;  1EGX A;  3HSA A;  3KRX A;  3MPX A;  1LW3 A;  3F5R A;  1PLS A;  2E2X A;  5J3Q A;  1PMS A;  2DKQ A;  3PZD A;  2COC A;  2R2Y A;  4HB4 B;  2K2U A;  2RUK B;  1UNQ A;  1XD4 A;  3MDB C;  3ODO A;  4KHO A;  1MIX A;  5DHA B;  2FJL A;  1OQN A;  1XX0 A;  4KHB B;  2CY4 A;  2ROV A;  1GC7 A;  2D9V A;  1H4R A;  2J0M A;  4H8S A;  1ISN A;  1PFJ A;  1BWN A;  1NTY A;  1P6S A;  4HSI A;  5JHG A;  3PVL A;  1DDM A;  1TQZ A;  3CXB B;  2K2J A;  1X1F A;  4KHB A;  3SNH A;  4EKU A;  5M4Y B;  1FAO A;  3QIJ A;  1SGH A;  1EAZ A;  2MFQ A;  3LJU X;  5D3W A;  4ZRI A;  4GNK B;  1T77 A;  5DI9 B;  2H7D A;  1FGY A;  2YRY A;  1TXD A;  4HAU B;  4K2O A;  2DHI A;  1AWE A;  1ZM0 A;  2YS3 A;  5D3V A;  1OMW A;  3SO6 A;  1GC6 A;  1DYN A;  3SUZ A;  1U5F A;  2D2Q A;  5GOW B;  4A6F B;  3ZVR A;  3PSC A;  2Z0Q A;  4WJ7 A;  3SV1 A;  1MK7 B;  1Q67 A;  5D27 A;  2KGX B;  4HAW B;  1TJ6 A;  1FOE A;  5HE0 A;  1OY2 A;  1MK9 B;  2NMB A;  3DXD A;  4F7H A;  4PQ0 A;  5L81 A;  4A6F A;  2L2I A;  3ULC A;  3OAN A;  2K49 A;  2UZR A;  3ODW A;  2P0F A;  1KZ7 A;  2M14 A;  2ROZ B;  3FSS A;  2DA0 A;  4Z2N A;  2AL6 A;  4DX9 0;  4CYE A;  1FGZ A;  5C16 A;  1V5U A;  1MIZ B;  1J0W A;  1XR0 B;  2LG1 A;  2KR0 A;  2YT2 A;  4GPT B;  1E5W A;  2GJY A;  1NU2 A;  2GUM A;  2EJ8 A;  4K2P A;  1N3H A;  3UZT A;  3IVF A;  2HTH B;  3B77 A;  2ZKM X;  2P0D A;  4PNK A;  3WA0 A;  1BTN A;  4XWX A;  3ML4 A;  1H10 A;  5KQ1 A;  1Z87 A;  2LOZ A;  4GMX B;  2CY5 A;  2V76 A;  3DXE A;  3AJ4 A;  5IRS A;  3HK0 A;  4OT1 A;  5I2S A;  1I7A A;  2GCL A;  3KSY A;  2K8E A;  4WSF A;  5JHH A;  4MT7 A;  3KRW A;  2ZPY A;  3BJI A;  2W2X C;  3HQC A;  2DN6 A;  2N23 A;  4GXB A;  4Y94 A;  1MPH A;  3PVU A;  4QJ5 B;  5KCV A;  4HAY B;  2IFS A;  1EF1 A;  2GCJ A;  1V88 A;  2DHJ A;  2JP2 A;  3TO1 A;  4B6H A;  1AQC A;  2MKR A;  3SYX A;  2BCJ A;  2KIE A;  2RGN B;  2DYN A;  1SHC A;  2YS1 A;  1K5G B;  4A6H A;  2P0H A;  2EMS A;  4CHJ A;  3X23 A;  3KY9 A;  4HAV B;  1X11 A;  3FVC A;  4IOY X;  4D0N B;  3O96 A;  5C6R A;  3CIK A;  2RLO A;  2Z4D A;  3ODX A;  2YF0 A;  1ZYI A;  1X05 A;  2J59 M;  1IRS A;  1W1G A;  1FHW A;  4ZRJ A;  2YT1 A;  2DYQ A;  3TFM A;  4D6W A;  2XQN M;  2Y7B A;  1DBH A;  1EVH A;  1W1D A;  1MAI A;  2QKM A;  1ZSQ A;  3D8E A;  3ULB A;  4HDQ A;  3NWD A;  1U5E A;  3NWA A;  2NZ8 B;  1I2H A;  2DX5 A;  5LOP B;  2D11 A;  4DIX A;  3RCP A;  5HE3 A;  2D9X A;  4IAP A;  2J0J A;  1KI1 B;  2UVM A;  1WGU A;  5LG4 B;  2LKO A;  1XCG A;  3GYO A;  3D8D A;  1FHO A;  4EJN A;  1NTV A;  1XKE A;  1M7R A;  3DCX A;  4HAX B;  2KUP A;  4CHM A;  3BIN A;  4KAX B;  1P3R A;  1B55 A;  2LYD A;  1MI1 A;  3TVV A;  2DHK A;  2D9Y A;  4BBK A;  1UPQ A;  3A8P A;  2MDX A;  2Z0P A;  3U12 A;  2P8V A;  3OHM B;  2OTX A;  4HB3 B;  3V5W A;  4HAT B;  2RSG A;  3FEH A;  2NBV A;  1RRP B;  1ZC4 B;  2COA A;  4MY6 A;  5DH9 B;  5JP4 A;  2RNR B;  4C0A A;  3G9W A;  2LUL A;  4HHV A;  1WGQ A;  3KZ1 A;  1V5M A;  2GS0 A;  5I2M A;  1X1G A;  4EMO A;  4GN1 A;  2YT0 A;  2Q13 A;  1WI1 A;  2COF A;  2K00 A;  1U2B A;  2MWN B;  2H7E A;  1KZG A;  5DHF B;  5HE2 A;  1UNP A;  5C5B B;  2W2W A;  2COD A;  3HIE A;  2KCJ A;  4K81 A;  4WVF B;  4GZU A;  2D4Q A;  2VSZ A; 
#chains in the Genus database with same CATH homology
 2GCL A;  2YT2 A;  3GYP A;  4L1R A;  3TVV A;  4DIX A;  3NW8 A;  2KIE A;  4GNK B;  2K8E A;  4KHB B;  4OT1 A;  4QJ4 B;  4D6W A;  2GUM A;  4CSQ A;  4Z2M B;  5I2M A;  3U12 A;  4GOU A;  2KUQ A;  4PQ0 A;  2ZKM X;  3OHM B;  4QJ3 B;  5LG4 B;  2Z13 A;  2K49 A;  4HSI A;  3GYO A;  2Z59 A;  2Z14 A;  2R2Y A;  2KIG A;  4OSN A;  2NBV A;  4KHA A;  3FVC A;  4IOY X;  4QJ5 B;  3NWD A;  4KHB A;  2FJU B;  3FSS A;  4QXA B;  3TW1 A;  4Z2N A;  5M4Y B;  3NWA A;  3HIE A;  2Z4D A;  2GCJ A;  2RRF A;  3A58 A;  1ZYI A;  4KHO A;  3TO1 A;  5IRS A;  4IFS A;  5I2S A;  3NWF A;  2KR0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...