2Z14A

Crystal structure of the n-terminal duf1126 in human ef-hand domain containing 2 protein
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
121
structure length
116
Chain Sequence
SGWVAFDKQVLSFDAYLEEEVLDKSQTNYRIRYYKIYFYPEDDTIQVNEPELLQGTSIRRHRITLPPPDEDQFYTVYHFNVGTEVVFYGRTFKIYDCDAFTRNFLRKIGVKVNPPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EF-hand domain-containing family member C2
publication title Crystal structure of the N-terminal DUF1126 in human ef-hand domain containing 2 protein
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 23
structure length 116
sequence length 121
ec nomenclature
pdb deposition date 2007-05-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.170 Mainly Beta Roll PH-domain like PH-domain like 2z14A00
2Z13A 2Z14A
chains in the Genus database with same CATH superfamily
2DYNA 2L1CA 1H4RA 3PEGA 3WYFB 1OY2A 3OHMB 2UVMA 1FHOA 4B6HA 4PQ0A 3FM8C 3SNHA 1XX0A 1WI1A 1U27A 5M4YB 1M7EA 2X18A 2LOZA 1RRPB 2DYQA 5DHFB 3VOQA 2CAYA 3ZVRA 5KQ1A 2DA0A 4IOYX 4DX90 1PFJA 2R09A 2NMBA 1XD4A 4A6FA 1TQZA 1UNQA 3P7ZA 1J19A 4A6FB 3KZ1A 2ROZB 4QXAB 2KUPA 1P6SA 1I7AA 3RCPA 1UNPA 2ADZA 5LOPB 3ULBA 3WA0A 1M7RA 1ZSQA 4KHBA 3SV1A 3F0WA 4KHBB 4HB3B 4Z2NA 1TJ6A 3PSCA 1LB1A 2KCJA 2M14A 2Z4DA 5C79A 1EGXA 4DBBA 2CRFA 2QKLA 2LULA 3M1IB 2MKRA 1WGUA 4MY6A 1UPQA 2ROVA 5D27A 4D6WA 4HB0B 3U12A 2CODA 2VRWB 4KHOA 2H7EA 3D8EA 1PMSA 3A8PA 4NY0A 2KGXB 2KIGA 2LKOA 2J0JA 4HAXB 4GMXB 2DFKA 2GCLA 2D9VA 1NI2A 1WG7A 2K2UA 1DDVA 4CSQA 2I5FA 3PG7A 2H7DA 2ELAA 3D8DA 4CHMA 1V5PA 4F7HA 1U2BA 1ZC4B 2ELBA 1NTVA 1LW3A 1ZC3B 2Y7BA 2N0YA 1WVHA 5C6RA 5D3XA 2I5CA 3TO1A 1KZ7A 2DLWA 4H8SA 2M38A 5D3YA 1E5WA 3PVLA 2G35A 2RRFA 4GXBA 4GZUA 3A98B 2NZ8B 1ZVRA 1T77A 2AL6A 1Y5OA 3KY9A 1FOEA 3NWFA 1K5DB 1Q67A 3KRXA 3UZTA 1X1GA 2LYDA 2DX1A 1I2HA 2DTCA 1WJ1A 3O96A 2YT0A 2HE7A 2VSZA 3DXCA 3QBVB 3B77A 2KUQA 1QC6A 2D2QA 3P6AA 3PVUA 5HE2A 2GCJA 1ZYIA 1RJ2A 4K17A 1EVHA 1Y19B 3BJIA 3X23A 1GC6A 1W1DA 1MIXA 1AWEA 2W2XD 5FI1A 4CHJA 4KHAA 4HB2B 4OSNA 2DX5A 2OTXA 5EFXA 4DXAB 4HAYB 2COFA 4GNKB 5J3YA 4A6HA 3A8QA 2W2XC 2L2IA 2IFSA 5HE0A 2Y8FA 3NSUA 4ZRJA 2D10A 5JP4A 1XODA 4Z2MB 1QQGA 3VIAA 3FEHA 1MPHA 1OQNA 3IVFA 2MWNB 3GYOA 1FGZA 3T06A 2DHKA 4HAUB 2GJYA 4TKNA 2DN6A 1DROA 3KSYA 3ODXA 1EAZA 4BBKA 2RGNB 2KIEA 5J3TA 2XQNM 4C0AA 4ZRIA 1IRSA 4XWXA 1OMWA 2EC1A 1WGQA 2DHIA 4HSIA 4MT7A 3LJUX 3NWDA 4EJNA 3AU5A 5KCVA 1FAOA 2D9WA 4OT1A 2J0KA 5JHHA 4QJ3B 4HB4B 1N3HA 2K00A 4DIXA 2V76A 4HAVB 1DBHA 4K81A 2OQBA 3QWMA 1DYNA 1NTYA 4Y94A 1U5GA 5D3WA 3PP2A 4WJ7A 5GOWB 5DIFB 2YSZA 1X11A 5D3VA 2VKIA 1H10A 4P7IA 2YS1A 2P0HA 4HATB 2LG1A 1V5MA 1AQCA 2GS0A 3PVWA 4QJ5B 2RSGA 1WJMA 2Q13A 2Z14A 5DHAB 2YS5A 5J3QA 1FHWA 2COAA 4TYZA 4HDOA 1V89A 4L1RA 2D9ZA 1KI1B 2EMSA 1V5UA 4QJ4B 2Y8GA 1W1GA 1KZGA 4HAWB 2CY5A 1W1HA 1EF1A 2Z0QA 1U29A 1GC7A 2YT1A 2Z0PA 5IRSA 1BTKA 3HSAA 1SGHA 2BCJA 3N7CA 4EKUA 3D8FA 1TXDA 3U8ZA 2FJUB 3FSSA 3TCAA 1FB8A 4YL8A 3HK0A 4L6EA 2RLOA 3SYXA 4GMVA 2UZSA 5FI0A 2RNRB 2D9YA 2D9XA 2K49A 4A5KA 2I1JA 1ZM0A 2Z13A 5HE1A 5HE3A 2MDXA 3PZDA 4GOUA 1MI1A 3SUZA 1K5GB 1U5DA 1MK9B 3U7DA 1MK7B 1XCGA 2RVBB 5L81A 3HIEA 4IAPA 4K2OA 1UNRA 4PNKA 1V88A 5C5BA 2FJLA 3GYPA 5C5BB 4HDQA 1XKEA 2GUMA 4GN1A 2YRYA 5CLQB 4DX8A 3NW8A 2P0FA 4ZRKA 3TVVA 2CY4A 3DXDA 3HW2B 2ZPYA 4YONA 2PZ1A 3FVCA 1BTNA 1X86A 2IYBA 1SHCA 4F7UP 4K2PA 3CIKA 4EMOA 2HTHB 2R0DA 4GPTB 5I2SA 1MIZB 3ML4A 1ISNA 1FHXA 2E2XA 1BWNA 2K8EA 3AJ4A 2Z0OA 5DI9B 1FGYA 4WVFB 2J59M 2P8VA 5JLJB 1NU2A 1MAIA 3TFMA 2KR0A 2JP2A 3AU4A 2ZKMX 4NSWA 1P3RA 1BAKA 3ZDTA 1V61A 2DHJA 3MPXA 3ULCA 5LONB 1UPRA 2YT2A 2EJ8A 2R2YA 5JHGA 1UEFA 1U5EA 2W2WA 5LG4B 4HHVA 2YF0A 3DCXA 2DKQA 4IFSA 1X1FA 4KAXB 3CXBB 2NBVA 2J0MA 3A58A 2K2JA 2MFQA 1U5FA 5KQ4A 2EMTA 4MK0A 3G9WA 1B55A 2YVCA 2UZRA 3NWAA 3OANA 1PLSA 3QIJA 1X05A 3ODOA 3SO6A 1DDWA 4F7GA 4KVGB 3V5WA 3TW1A 1DDMA 2D11A 3F5RA 2N23A 3KRWA 4HAZB 5CLLB 3HQCA 2COCA 3MDBC 1Z87A 5C16A 2RUKB 4CYEA 1XR0B 2Z59A 3BINA 2I1KA 2QKMA 2AEHA 5DH9B 3ODWA 4D0NB 4WSFA 5I2MA 1MKEA 2DKPA 2YS3A 1GG3A 1J0WA 4A6KA 3DXEA 2LOXA 1P5TA 2P0DA 2D4QA
chains in the Genus database with same CATH topology
4Z2NA 2RRFA 4GNKB 5LG4B 2K8EA 4CSQA 3GYPA 5I2SA 2GCJA 3OHMB 4HSIA 2Z4DA 4QJ5B 2K49A 2GUMA 4IFSA 1ZYIA 2Z13A 5IRSA 3NWFA 2NBVA 2Z14A 4QXAB 3NW8A 4GOUA 3A58A 3NWDA 4PQ0A 2KR0A 4Z2MB 3TVVA 2Z59A 2ZKMX 4D6WA 4L1RA 3GYOA 3U12A 3FVCA 4KHAA 4OT1A 2FJUB 3FSSA 4QJ3B 5M4YB 4KHOA 3NWAA 3TW1A 5I2MA 2YT2A 2KIGA 4KHBA 4KHBB 3HIEA 3TO1A 4DIXA 4QJ4B 2R2YA 4OSNA 2KIEA 2GCLA 2KUQA 4IOYX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z13 A;  2Z14 A; 
#chains in the Genus database with same CATH topology
 2DYN A;  2L1C A;  1H4R A;  3PEG A;  3WYF B;  1OY2 A;  3OHM B;  2UVM A;  1FHO A;  4B6H A;  4PQ0 A;  3FM8 C;  3SNH A;  1XX0 A;  1WI1 A;  1U27 A;  5M4Y B;  1M7E A;  2X18 A;  2LOZ A;  1RRP B;  2DYQ A;  5DHF B;  3VOQ A;  2CAY A;  3ZVR A;  5KQ1 A;  2DA0 A;  4IOY X;  4DX9 0;  1PFJ A;  2R09 A;  2NMB A;  1XD4 A;  4A6F A;  1TQZ A;  1UNQ A;  3P7Z A;  1J19 A;  4A6F B;  3KZ1 A;  2ROZ B;  4QXA B;  2KUP A;  1P6S A;  1I7A A;  3RCP A;  1UNP A;  2ADZ A;  5LOP B;  3ULB A;  3WA0 A;  1M7R A;  1ZSQ A;  4KHB A;  3SV1 A;  3F0W A;  4KHB B;  4HB3 B;  4Z2N A;  1TJ6 A;  3PSC A;  1LB1 A;  2KCJ A;  2M14 A;  2Z4D A;  5C79 A;  1EGX A;  4DBB A;  2CRF A;  2QKL A;  2LUL A;  3M1I B;  2MKR A;  1WGU A;  4MY6 A;  1UPQ A;  2ROV A;  5D27 A;  4D6W A;  4HB0 B;  3U12 A;  2COD A;  2VRW B;  4KHO A;  2H7E A;  3D8E A;  1PMS A;  3A8P A;  4NY0 A;  2KGX B;  2KIG A;  2LKO A;  2J0J A;  4HAX B;  4GMX B;  2DFK A;  2GCL A;  2D9V A;  1NI2 A;  1WG7 A;  2K2U A;  1DDV A;  4CSQ A;  2I5F A;  3PG7 A;  2H7D A;  2ELA A;  3D8D A;  4CHM A;  1V5P A;  4F7H A;  1U2B A;  1ZC4 B;  2ELB A;  1NTV A;  1LW3 A;  1ZC3 B;  2Y7B A;  2N0Y A;  1WVH A;  5C6R A;  5D3X A;  2I5C A;  3TO1 A;  1KZ7 A;  2DLW A;  4H8S A;  2M38 A;  5D3Y A;  1E5W A;  3PVL A;  2G35 A;  2RRF A;  4GXB A;  4GZU A;  3A98 B;  2NZ8 B;  1ZVR A;  1T77 A;  2AL6 A;  1Y5O A;  3KY9 A;  1FOE A;  3NWF A;  1K5D B;  1Q67 A;  3KRX A;  3UZT A;  1X1G A;  2LYD A;  2DX1 A;  1I2H A;  2DTC A;  1WJ1 A;  3O96 A;  2YT0 A;  2HE7 A;  2VSZ A;  3DXC A;  3QBV B;  3B77 A;  2KUQ A;  1QC6 A;  2D2Q A;  3P6A A;  3PVU A;  5HE2 A;  2GCJ A;  1ZYI A;  1RJ2 A;  4K17 A;  1EVH A;  1Y19 B;  3BJI A;  3X23 A;  1GC6 A;  1W1D A;  1MIX A;  1AWE A;  2W2X D;  5FI1 A;  4CHJ A;  4KHA A;  4HB2 B;  4OSN A;  2DX5 A;  2OTX A;  5EFX A;  4DXA B;  4HAY B;  2COF A;  4GNK B;  5J3Y A;  4A6H A;  3A8Q A;  2W2X C;  2L2I A;  2IFS A;  5HE0 A;  2Y8F A;  3NSU A;  4ZRJ A;  2D10 A;  5JP4 A;  1XOD A;  4Z2M B;  1QQG A;  3VIA A;  3FEH A;  1MPH A;  1OQN A;  3IVF A;  2MWN B;  3GYO A;  1FGZ A;  3T06 A;  2DHK A;  4HAU B;  2GJY A;  4TKN A;  2DN6 A;  1DRO A;  3KSY A;  3ODX A;  1EAZ A;  4BBK A;  2RGN B;  2KIE A;  5J3T A;  2XQN M;  4C0A A;  4ZRI A;  1IRS A;  4XWX A;  1OMW A;  2EC1 A;  1WGQ A;  2DHI A;  4HSI A;  4MT7 A;  3LJU X;  3NWD A;  4EJN A;  3AU5 A;  5KCV A;  1FAO A;  2D9W A;  4OT1 A;  2J0K A;  5JHH A;  4QJ3 B;  4HB4 B;  1N3H A;  2K00 A;  4DIX A;  2V76 A;  4HAV B;  1DBH A;  4K81 A;  2OQB A;  3QWM A;  1DYN A;  1NTY A;  4Y94 A;  1U5G A;  5D3W A;  3PP2 A;  4WJ7 A;  5GOW B;  5DIF B;  2YSZ A;  1X11 A;  5D3V A;  2VKI A;  1H10 A;  4P7I A;  2YS1 A;  2P0H A;  4HAT B;  2LG1 A;  1V5M A;  1AQC A;  2GS0 A;  3PVW A;  4QJ5 B;  2RSG A;  1WJM A;  2Q13 A;  2Z14 A;  5DHA B;  2YS5 A;  5J3Q A;  1FHW A;  2COA A;  4TYZ A;  4HDO A;  1V89 A;  4L1R A;  2D9Z A;  1KI1 B;  2EMS A;  1V5U A;  4QJ4 B;  2Y8G A;  1W1G A;  1KZG A;  4HAW B;  2CY5 A;  1W1H A;  1EF1 A;  2Z0Q A;  1U29 A;  1GC7 A;  2YT1 A;  2Z0P A;  5IRS A;  1BTK A;  3HSA A;  1SGH A;  2BCJ A;  3N7C A;  4EKU A;  3D8F A;  1TXD A;  3U8Z A;  2FJU B;  3FSS A;  3TCA A;  1FB8 A;  4YL8 A;  3HK0 A;  4L6E A;  2RLO A;  3SYX A;  4GMV A;  2UZS A;  5FI0 A;  2RNR B;  2D9Y A;  2D9X A;  2K49 A;  4A5K A;  2I1J A;  1ZM0 A;  2Z13 A;  5HE1 A;  5HE3 A;  2MDX A;  3PZD A;  4GOU A;  1MI1 A;  3SUZ A;  1K5G B;  1U5D A;  1MK9 B;  3U7D A;  1MK7 B;  1XCG A;  2RVB B;  5L81 A;  3HIE A;  4IAP A;  4K2O A;  1UNR A;  4PNK A;  1V88 A;  5C5B A;  2FJL A;  3GYP A;  5C5B B;  4HDQ A;  1XKE A;  2GUM A;  4GN1 A;  2YRY A;  5CLQ B;  4DX8 A;  3NW8 A;  2P0F A;  4ZRK A;  3TVV A;  2CY4 A;  3DXD A;  3HW2 B;  2ZPY A;  4YON A;  2PZ1 A;  3FVC A;  1BTN A;  1X86 A;  2IYB A;  1SHC A;  4F7U P;  4K2P A;  3CIK A;  4EMO A;  2HTH B;  2R0D A;  4GPT B;  5I2S A;  1MIZ B;  3ML4 A;  1ISN A;  1FHX A;  2E2X A;  1BWN A;  2K8E A;  3AJ4 A;  2Z0O A;  5DI9 B;  1FGY A;  4WVF B;  2J59 M;  2P8V A;  5JLJ B;  1NU2 A;  1MAI A;  3TFM A;  2KR0 A;  2JP2 A;  3AU4 A;  2ZKM X;  4NSW A;  1P3R A;  1BAK A;  3ZDT A;  1V61 A;  2DHJ A;  3MPX A;  3ULC A;  5LON B;  1UPR A;  2YT2 A;  2EJ8 A;  2R2Y A;  5JHG A;  1UEF A;  1U5E A;  2W2W A;  5LG4 B;  4HHV A;  2YF0 A;  3DCX A;  2DKQ A;  4IFS A;  1X1F A;  4KAX B;  3CXB B;  2NBV A;  2J0M A;  3A58 A;  2K2J A;  2MFQ A;  1U5F A;  5KQ4 A;  2EMT A;  4MK0 A;  3G9W A;  1B55 A;  2YVC A;  2UZR A;  3NWA A;  3OAN A;  1PLS A;  3QIJ A;  1X05 A;  3ODO A;  3SO6 A;  1DDW A;  4F7G A;  4KVG B;  3V5W A;  3TW1 A;  1DDM A;  2D11 A;  3F5R A;  2N23 A;  3KRW A;  4HAZ B;  5CLL B;  3HQC A;  2COC A;  3MDB C;  1Z87 A;  5C16 A;  2RUK B;  4CYE A;  1XR0 B;  2Z59 A;  3BIN A;  2I1K A;  2QKM A;  2AEH A;  5DH9 B;  3ODW A;  4D0N B;  4WSF A;  5I2M A;  1MKE A;  2DKP A;  2YS3 A;  1GG3 A;  1J0W A;  4A6K A;  3DXE A;  2LOX A;  1P5T A;  2P0D A;  2D4Q A; 
#chains in the Genus database with same CATH homology
 4Z2N A;  2RRF A;  4GNK B;  5LG4 B;  2K8E A;  4CSQ A;  3GYP A;  5I2S A;  2GCJ A;  3OHM B;  4HSI A;  2Z4D A;  4QJ5 B;  2K49 A;  2GUM A;  4IFS A;  1ZYI A;  2Z13 A;  5IRS A;  3NWF A;  2NBV A;  2Z14 A;  4QXA B;  3NW8 A;  4GOU A;  3A58 A;  3NWD A;  4PQ0 A;  2KR0 A;  4Z2M B;  3TVV A;  2Z59 A;  2ZKM X;  4D6W A;  4L1R A;  3GYO A;  3U12 A;  3FVC A;  4KHA A;  4OT1 A;  2FJU B;  3FSS A;  4QJ3 B;  5M4Y B;  4KHO A;  3NWA A;  3TW1 A;  5I2M A;  2YT2 A;  2KIG A;  4KHB A;  4KHB B;  3HIE A;  3TO1 A;  4DIX A;  4QJ4 B;  2R2Y A;  4OSN A;  2KIE A;  2GCL A;  2KUQ A;  4IOY X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...