2Z14A

Crystal structure of the n-terminal duf1126 in human ef-hand domain containing 2 protein
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
121
structure length
116
Chain Sequence
b'SGWVAFDKQVLSFDAYLEEEVLDKSQTNYRIRYYKIYFYPEDDTIQVNEPELLQGTSIRRHRITLPPPDEDQFYTVYHFNVGTEVVFYGRTFKIYDCDAFTRNFLRKIGVKVNPPV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EF-hand domain-containing family member C2
publication title Crystal structure of the N-terminal DUF1126 in human ef-hand domain containing 2 protein
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 23
structure length 116
sequence length 121
ec nomenclature
pdb deposition date 2007-05-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.170 Mainly Beta Roll PH-domain like PH-domain like 2z14A00
2Z13A 2Z14A
chains in the Genus database with same CATH superfamily
3PVLA 3D8DA 1IRSA 3UZTA 4TYZA 3BINA 5LONB 2V76A 1M7EA 2D9YA 4NY0A 1V88A 3HIEA 4YONA 1UPRA 3AJ4A 4L1RA 4MK0A 1U5DA 2E2XA 2J0KA 1EF1A 4D0NB 1UEFA 1XX0A 1X86A 1UNPA 5FI1A 3HSAA 4HSIA 1DDVA 3A8PA 1FOEA 5IRSA 3X23A 1Y19B 4GPTB 2KCJA 4HAWB 3NWAA 2PZ1A 2Y8FA 3SYXA 3DXDA 4F7GA 2JP2A 2DHJA 4DBBA 1MAIA 4EJNA 1TQZA 2N0YA 4L6EA 4QJ4B 2QKMA 2Z13A 3PVUA 3U8ZA 2J0JA 4B6HA 2YRYA 2DLWA 3ODOA 1WG7A 4C0AA 5KQ4A 1NI2A 2K2UA 4HAYB 3PG7A 2DFKA 2K8EA 2IYBA 1U27A 2MFQA 2MKRA 2ELAA 1V61A 4A6FA 2K2JA 1WGUA 2D9WA 3KY9A 1XKEA 4K2OA 5JP4A 2COCA 2H7DA 2CY4A 3NWDA 3TW1A 4P7IA 1MI1A 4Z2MB 5JHHA 2D4QA 1FGZA 2Z0QA 1U5EA 3FSSA 4GZUA 4A5KA 4DIXA 2YF0A 2DHIA 3DCXA 1FGYA 1B55A 2BCJA 5DHFB 1Y5OA 3G9WA 4HATB 5DH9B 3A8QA 1PLSA 3ZVRA 3ULCA 2VRWB 3FM8C 4IOYX 1BWNA 4WJ7A 4QJ5B 1BTKA 2N23A 5L81A 3FEHA 2RLOA 4KHAA 1BTNA 1FHXA 1V5PA 2X18A 1U29A 3A58A 4TKNA 5D3WA 5GOWB 3ODWA 2ROVA 5D3XA 5J3YA 3TCAA 4H8SA 1NU2A 1U2BA 2KR0A 5C79A 3CXBB 3P7ZA 1SGHA 4HDQA 2H7EA 3N7CA 4OSNA 4WVFB 1XODA 3NW8A 2GCLA 5CLQB 1H10A 1ZVRA 3ML4A 1WI1A 2LG1A 3MPXA 5C5BB 2ZPYA 4ZRJA 4HB2B 4K81A 2M38A 3F5RA 1X1FA 2LOZA 2J59M 3KZ1A 1W1GA 1X11A 2CRFA 3OANA 3WYFB 4CHJA 3AU5A 3KSYA 4F7UP 1J0WA 3NSUA 4XWXA 3A98B 1V5MA 2DKQA 5HE1A 2GCJA 1AQCA 2RNRB 4IFSA 3NWFA 2P0DA 2KGXB 4D6WA 1LB1A 2OQBA 1AWEA 2LKOA 1W1DA 4MY6A 4GMVA 3KRXA 4NSWA 2VSZA 1X05A 4CSQA 2COAA 2MWNB 2RUKB 5HE0A 1Z87A 5HE3A 4OT1A 5M4YB 4KVGB 2MDXA 2R2YA 3OHMB 2DHKA 2R09A 4HB4B 2L1CA 1GG3A 5J3QA 2D10A 1UNRA 4DX8A 4IAPA 1P5TA 2YS1A 2NZ8B 1X1GA 3T06A 4KHOA 1FHWA 3QBVB 4DX90 4HDOA 4QXAB 3M1IB 1NTVA 3HK0A 4HAUB 1LW3A 2D9VA 4F7HA 4KAXB 2GUMA 5C16A 4GOUA 5D3YA 4GNKB 1P3RA 2Q13A 1ZC4B 5LG4B 1TJ6A 2UZSA 2W2XC 4Z2NA 4DXAB 2I5CA 1WGQA 2GS0A 3PEGA 5C6RA 1N3HA 2K49A 3KRWA 1WVHA 1K5GB 1P6SA 2CODA 2L2IA 2HE7A 2VKIA 5HE2A 4Y94A 2J0MA 3TVVA 2D2QA 2W2WA 4HAVB 4CHMA 1ZM0A 1TXDA 1MIXA 1DBHA 1W1HA 3QIJA 3LJUX 1V89A 4A6KA 4WSFA 4HB0B 4PNKA 4A6FB 2DYNA 5I2SA 2IFSA 1PMSA 3RCPA 4QJ3B 4ZRKA 3ULBA 4ZRIA 1XD4A 2D11A 2GJYA 3O96A 1E5WA 3SV1A 2KUPA 1M7RA 5I2MA 4KHBB 1DDMA 1MIZB 1OMWA 2DTCA 5LOPB 1KZGA 2XQNM 5FI0A 3F0WA 3PVWA 4HHVA 2YS3A 2DX5A 1PFJA 1NTYA 2FJUB 2P8VA 2UZRA 4HB3B 3DXCA 3TO1A 1SHCA 5CLLB 3U7DA 2EMTA 2ELBA 2Z0PA 3GYPA 5KCVA 4GXBA 5J3TA 1GC7A 2ZKMX 3SUZA 2Y8GA 2P0HA 4HAXB 2QKLA 1ZYIA 2AL6A 2RVBB 3PZDA 2EC1A 3GYOA 5DHAB 3SNHA 2NMBA 2DYQA 2LOXA 3MDBC 1V5UA 1Q67A 3D8FA 3VIAA 1ZSQA 5D3VA 4EKUA 2DKPA 1WJ1A 2D9XA 1WJMA 2NBVA 2RGNB 3ZDTA 1FHOA 4MT7A 2OTXA 1QQGA 2YT0A 1QC6A 3HW2B 2DA0A 3VOQA 1GC6A 5JHGA 5DIFB 2M14A 4EMOA 1MPHA 2UVMA 2AEHA 1OQNA 2KUQA 2D9ZA 1U5GA 2CY5A 1H4RA 3DXEA 2ROZB 3P6AA 3WA0A 1UNQA 4PQ0A 3SO6A 2KIGA 1UPQA 5EFXA 4YL8A 1DROA 1BAKA 3V5WA 1EVHA 1K5DB 2Z59A 3IVFA 4HAZB 3B77A 1RJ2A 1ISNA 1XR0B 2EMSA 4GMXB 2KIEA 1XCGA 3FVCA 1U5FA 1FB8A 2I1KA 2LYDA 3PP2A 2RRFA 4KHBA 4GN1A 2I5FA 2I1JA 1T77A 1MK9B 2YS5A 1MKEA 2Z14A 4CYEA 2R0DA 1ZC3B 2EJ8A 5C5BA 5JLJB 2Z0OA 2Y7BA 2Z4DA 4K17A 2YT2A 2LULA 4BBKA 2YVCA 5D27A 2DN6A 3AU4A 3TFMA 1RRPB 2P0FA 2ADZA 2G35A 3CIKA 3HQCA 1OY2A 2RSGA 1I7AA 2HTHB 2K00A 2DX1A 3PSCA 1EGXA 1EAZA 1DYNA 1MK7B 1DDWA 3U12A 2FJLA 2W2XD 3ODXA 1KI1B 4K2PA 2COFA 2CAYA 1I2HA 3D8EA 2YT1A 3QWMA 3BJIA 4A6HA 1FAOA 1J19A 5DI9B 5KQ1A 2YSZA 1KZ7A
chains in the Genus database with same CATH topology
2K8EA 3GYPA 4Z2NA 2Z59A 2Z14A 3NWAA 4KHAA 3FSSA 2ZKMX 3A58A 4KHOA 4DIXA 2K49A 2KIEA 1ZYIA 2KUQA 2Z4DA 4QXAB 3FVCA 2YT2A 5I2SA 3U12A 3GYOA 4CSQA 3HIEA 4QJ4B 4QJ3B 4L1RA 2Z13A 2KR0A 2FJUB 3NWDA 2GUMA 4PQ0A 3TW1A 4GOUA 2KIGA 4Z2MB 4GNKB 3TVVA 2RRFA 5LG4B 3TO1A 2GCJA 4KHBA 4IOYX 4IFSA 2NBVA 4OT1A 4HSIA 5M4YB 4OSNA 3NWFA 5I2MA 2R2YA 3OHMB 4KHBB 5IRSA 3NW8A 4QJ5B 2GCLA 4D6WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z13 A;  2Z14 A; 
#chains in the Genus database with same CATH topology
 3PVL A;  3D8D A;  1IRS A;  3UZT A;  4TYZ A;  3BIN A;  5LON B;  2V76 A;  1M7E A;  2D9Y A;  4NY0 A;  1V88 A;  3HIE A;  4YON A;  1UPR A;  3AJ4 A;  4L1R A;  4MK0 A;  1U5D A;  2E2X A;  2J0K A;  1EF1 A;  4D0N B;  1UEF A;  1XX0 A;  1X86 A;  1UNP A;  5FI1 A;  3HSA A;  4HSI A;  1DDV A;  3A8P A;  1FOE A;  5IRS A;  3X23 A;  1Y19 B;  4GPT B;  2KCJ A;  4HAW B;  3NWA A;  2PZ1 A;  2Y8F A;  3SYX A;  3DXD A;  4F7G A;  2JP2 A;  2DHJ A;  4DBB A;  1MAI A;  4EJN A;  1TQZ A;  2N0Y A;  4L6E A;  4QJ4 B;  2QKM A;  2Z13 A;  3PVU A;  3U8Z A;  2J0J A;  4B6H A;  2YRY A;  2DLW A;  3ODO A;  1WG7 A;  4C0A A;  5KQ4 A;  1NI2 A;  2K2U A;  4HAY B;  3PG7 A;  2DFK A;  2K8E A;  2IYB A;  1U27 A;  2MFQ A;  2MKR A;  2ELA A;  1V61 A;  4A6F A;  2K2J A;  1WGU A;  2D9W A;  3KY9 A;  1XKE A;  4K2O A;  5JP4 A;  2COC A;  2H7D A;  2CY4 A;  3NWD A;  3TW1 A;  4P7I A;  1MI1 A;  4Z2M B;  5JHH A;  2D4Q A;  1FGZ A;  2Z0Q A;  1U5E A;  3FSS A;  4GZU A;  4A5K A;  4DIX A;  2YF0 A;  2DHI A;  3DCX A;  1FGY A;  1B55 A;  2BCJ A;  5DHF B;  1Y5O A;  3G9W A;  4HAT B;  5DH9 B;  3A8Q A;  1PLS A;  3ZVR A;  3ULC A;  2VRW B;  3FM8 C;  4IOY X;  1BWN A;  4WJ7 A;  4QJ5 B;  1BTK A;  2N23 A;  5L81 A;  3FEH A;  2RLO A;  4KHA A;  1BTN A;  1FHX A;  1V5P A;  2X18 A;  1U29 A;  3A58 A;  4TKN A;  5D3W A;  5GOW B;  3ODW A;  2ROV A;  5D3X A;  5J3Y A;  3TCA A;  4H8S A;  1NU2 A;  1U2B A;  2KR0 A;  5C79 A;  3CXB B;  3P7Z A;  1SGH A;  4HDQ A;  2H7E A;  3N7C A;  4OSN A;  4WVF B;  1XOD A;  3NW8 A;  2GCL A;  5CLQ B;  1H10 A;  1ZVR A;  3ML4 A;  1WI1 A;  2LG1 A;  3MPX A;  5C5B B;  2ZPY A;  4ZRJ A;  4HB2 B;  4K81 A;  2M38 A;  3F5R A;  1X1F A;  2LOZ A;  2J59 M;  3KZ1 A;  1W1G A;  1X11 A;  2CRF A;  3OAN A;  3WYF B;  4CHJ A;  3AU5 A;  3KSY A;  4F7U P;  1J0W A;  3NSU A;  4XWX A;  3A98 B;  1V5M A;  2DKQ A;  5HE1 A;  2GCJ A;  1AQC A;  2RNR B;  4IFS A;  3NWF A;  2P0D A;  2KGX B;  4D6W A;  1LB1 A;  2OQB A;  1AWE A;  2LKO A;  1W1D A;  4MY6 A;  4GMV A;  3KRX A;  4NSW A;  2VSZ A;  1X05 A;  4CSQ A;  2COA A;  2MWN B;  2RUK B;  5HE0 A;  1Z87 A;  5HE3 A;  4OT1 A;  5M4Y B;  4KVG B;  2MDX A;  2R2Y A;  3OHM B;  2DHK A;  2R09 A;  4HB4 B;  2L1C A;  1GG3 A;  5J3Q A;  2D10 A;  1UNR A;  4DX8 A;  4IAP A;  1P5T A;  2YS1 A;  2NZ8 B;  1X1G A;  3T06 A;  4KHO A;  1FHW A;  3QBV B;  4DX9 0;  4HDO A;  4QXA B;  3M1I B;  1NTV A;  3HK0 A;  4HAU B;  1LW3 A;  2D9V A;  4F7H A;  4KAX B;  2GUM A;  5C16 A;  4GOU A;  5D3Y A;  4GNK B;  1P3R A;  2Q13 A;  1ZC4 B;  5LG4 B;  1TJ6 A;  2UZS A;  2W2X C;  4Z2N A;  4DXA B;  2I5C A;  1WGQ A;  2GS0 A;  3PEG A;  5C6R A;  1N3H A;  2K49 A;  3KRW A;  1WVH A;  1K5G B;  1P6S A;  2COD A;  2L2I A;  2HE7 A;  2VKI A;  5HE2 A;  4Y94 A;  2J0M A;  3TVV A;  2D2Q A;  2W2W A;  4HAV B;  4CHM A;  1ZM0 A;  1TXD A;  1MIX A;  1DBH A;  1W1H A;  3QIJ A;  3LJU X;  1V89 A;  4A6K A;  4WSF A;  4HB0 B;  4PNK A;  4A6F B;  2DYN A;  5I2S A;  2IFS A;  1PMS A;  3RCP A;  4QJ3 B;  4ZRK A;  3ULB A;  4ZRI A;  1XD4 A;  2D11 A;  2GJY A;  3O96 A;  1E5W A;  3SV1 A;  2KUP A;  1M7R A;  5I2M A;  4KHB B;  1DDM A;  1MIZ B;  1OMW A;  2DTC A;  5LOP B;  1KZG A;  2XQN M;  5FI0 A;  3F0W A;  3PVW A;  4HHV A;  2YS3 A;  2DX5 A;  1PFJ A;  1NTY A;  2FJU B;  2P8V A;  2UZR A;  4HB3 B;  3DXC A;  3TO1 A;  1SHC A;  5CLL B;  3U7D A;  2EMT A;  2ELB A;  2Z0P A;  3GYP A;  5KCV A;  4GXB A;  5J3T A;  1GC7 A;  2ZKM X;  3SUZ A;  2Y8G A;  2P0H A;  4HAX B;  2QKL A;  1ZYI A;  2AL6 A;  2RVB B;  3PZD A;  2EC1 A;  3GYO A;  5DHA B;  3SNH A;  2NMB A;  2DYQ A;  2LOX A;  3MDB C;  1V5U A;  1Q67 A;  3D8F A;  3VIA A;  1ZSQ A;  5D3V A;  4EKU A;  2DKP A;  1WJ1 A;  2D9X A;  1WJM A;  2NBV A;  2RGN B;  3ZDT A;  1FHO A;  4MT7 A;  2OTX A;  1QQG A;  2YT0 A;  1QC6 A;  3HW2 B;  2DA0 A;  3VOQ A;  1GC6 A;  5JHG A;  5DIF B;  2M14 A;  4EMO A;  1MPH A;  2UVM A;  2AEH A;  1OQN A;  2KUQ A;  2D9Z A;  1U5G A;  2CY5 A;  1H4R A;  3DXE A;  2ROZ B;  3P6A A;  3WA0 A;  1UNQ A;  4PQ0 A;  3SO6 A;  2KIG A;  1UPQ A;  5EFX A;  4YL8 A;  1DRO A;  1BAK A;  3V5W A;  1EVH A;  1K5D B;  2Z59 A;  3IVF A;  4HAZ B;  3B77 A;  1RJ2 A;  1ISN A;  1XR0 B;  2EMS A;  4GMX B;  2KIE A;  1XCG A;  3FVC A;  1U5F A;  1FB8 A;  2I1K A;  2LYD A;  3PP2 A;  2RRF A;  4KHB A;  4GN1 A;  2I5F A;  2I1J A;  1T77 A;  1MK9 B;  2YS5 A;  1MKE A;  2Z14 A;  4CYE A;  2R0D A;  1ZC3 B;  2EJ8 A;  5C5B A;  5JLJ B;  2Z0O A;  2Y7B A;  2Z4D A;  4K17 A;  2YT2 A;  2LUL A;  4BBK A;  2YVC A;  5D27 A;  2DN6 A;  3AU4 A;  3TFM A;  1RRP B;  2P0F A;  2ADZ A;  2G35 A;  3CIK A;  3HQC A;  1OY2 A;  2RSG A;  1I7A A;  2HTH B;  2K00 A;  2DX1 A;  3PSC A;  1EGX A;  1EAZ A;  1DYN A;  1MK7 B;  1DDW A;  3U12 A;  2FJL A;  2W2X D;  3ODX A;  1KI1 B;  4K2P A;  2COF A;  2CAY A;  1I2H A;  3D8E A;  2YT1 A;  3QWM A;  3BJI A;  4A6H A;  1FAO A;  1J19 A;  5DI9 B;  5KQ1 A;  2YSZ A;  1KZ7 A; 
#chains in the Genus database with same CATH homology
 2K8E A;  3GYP A;  4Z2N A;  2Z59 A;  2Z14 A;  3NWA A;  4KHA A;  3FSS A;  2ZKM X;  3A58 A;  4KHO A;  4DIX A;  2K49 A;  2KIE A;  1ZYI A;  2KUQ A;  2Z4D A;  4QXA B;  3FVC A;  2YT2 A;  5I2S A;  3U12 A;  3GYO A;  4CSQ A;  3HIE A;  4QJ4 B;  4QJ3 B;  4L1R A;  2Z13 A;  2KR0 A;  2FJU B;  3NWD A;  2GUM A;  4PQ0 A;  3TW1 A;  4GOU A;  2KIG A;  4Z2M B;  4GNK B;  3TVV A;  2RRF A;  5LG4 B;  3TO1 A;  2GCJ A;  4KHB A;  4IOY X;  4IFS A;  2NBV A;  4OT1 A;  4HSI A;  5M4Y B;  4OSN A;  3NWF A;  5I2M A;  2R2Y A;  3OHM B;  4KHB B;  5IRS A;  3NW8 A;  4QJ5 B;  2GCL A;  4D6W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...