3A8PA

Crystal structure of the tiam2 phccex domain
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
238
structure length
232
Chain Sequence
VVRKAGWLFFKPLVTLQKERKLELVARRKWKQYWVTLKGCTLLFYETYGKSAPRCALFAEDSIVQSVPEHPKKEHVFCLSNSCGDVYLFQATSQTDLENWVTAIHSACASLFAKKHGKEDTVRLLKSQTRSLLQKIDMDSKMKKMAELQLSVVSDPKNRKAIENQIRQWEQNLEKFHMDLFRMRCYLASLQGGELPNPKSLLAATSRPSKLALGRLGVLSVSSFHALVCSRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords T-lymphoma invasion and metastasis-inducing protein 2
publication title The PHCCEx domain of Tiam1/2 is a novel protein- and membrane-binding module
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
total genus 75
structure length 232
sequence length 238
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
A PF18385 Tiam_CC_Ex T-lymphoma invasion and metastasis CC-Ex domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3a8pA01
4P7IA 5C5BA 3D8EA 2ROZB 1KZ7A 5D3YA 2W2XD 2CRFA 2BCJA 2W2WA 4EJNA 1TQZA 3ULBA 1XKEA 2J0MA 3KSYA 5HE0A 2R09A 5C6RA 1RJ2A 2DN6A 2I1KA 4GPTB 1XODA 2YT0A 2M38A 3T06A 2DYQA 5HE1A 1MAIA 3UZTA 1QC6A 4DBBA 4HAUB 4Z2NA 1MK9B 3DXDA 2GCJA 1N3HA 1M7EA 1TJ6A 3A8PA 1BAKA 1PLSA 3KZ1A 3TO1A 3SV1A 2P8VA 2MDXA 5DHAB 2FJLA 5DHFB 1U5GA 2DLWA 3CIKA 4GXBA 2R0DA 3DXEA 5J3TA 1X05A 2W2XC 1FHOA 3IVFA 1OY2A 5FI0A 3PVLA 2DFKA 1WI1A 2D9VA 2YS3A 2ADZA 2D9WA 4PNKA 1P3RA 4HB0B 1ZVRA 1FAOA 2Z0OA 3VOQA 3RCPA 1E5WA 1H10A 3SUZA 2MWNB 2EMSA 2Y8FA 4F7GA 5EFXA 1W1DA 2COCA 4Z2MB 5D3XA 3KRXA 1P5TA 2UZSA 3GYPA 3PZDA 4CHMA 2DX5A 2K2JA 2DYNA 1QQGA 1NU2A 4HDQA 4HB4B 3D8DA 3SNHA 4ZRKA 1XR0B 2D9ZA 3SYXA 2RLOA 2PZ1A 2Y8GA 1J0WA 1DBHA 3LJUX 3TCAA 3MDBC 2RVBB 5JP4A 2UZRA 4A6FA 1V5PA 4GMXB 2L1CA 2N23A 3PVUA 2CY5A 2IFSA 2M14A 4DX90 1MKEA 5DIFB 2D9XA 3QIJA 1XCGA 2MFQA 4MK0A 5C5BB 3WA0A 4H8SA 3DXCA 1NI2A 3D8FA 2D2QA 3U7DA 4IAPA 2CODA 4YONA 2COAA 4GMVA 5KQ4A 1Y19B 4A5KA 2D4QA 2ZPYA 2RSGA 1M7RA 3KRWA 4KHAA 1BTNA 4K17A 5D3WA 3HK0A 3HQCA 3V5WA 1SHCA 4GZUA 5C16A 1X11A 2VSZA 1EAZA 4K81A 2RNRB 1OMWA 4GN1A 4TKNA 1UEFA 3PEGA 1BTKA 4EMOA 3QWMA 5L81A 4A6HA 2LG1A 3N7CA 1WVHA 3ODWA 1MK7B 2YF0A 3G9WA 4TYZA 3M1IB 2YT1A 3OANA 3X23A 1XD4A 1ZC3B 4Y94A 2DX1A 5GOWB 1K5DB 1KZGA 4KVGB 2EC1A 2LOXA 5HE2A 1OQNA 3BJIA 4IOYX 1ZM0A 3FSSA 4NY0A 1UNQA 3U8ZA 1EGXA 4HAVB 2LKOA 1GC7A 1V88A 2YSZA 1Q67A 1GC6A 2NZ8B 1FGZA 2VRWB 2I5CA 2DHKA 3KY9A 5KCVA 3NSUA 3TFMA 1UNRA 4XWXA 4HAXB 1W1HA 2DA0A 3HW2B 1ZSQA 4A6FB 4D0NB 3VIAA 1W1GA 1K5GB 2Z0QA 2H7EA 2DKQA 3ODXA 1U27A 2V76A 4HB2B 3ULCA 4MT7A 4DXAB 3PP2A 4F7UP 4L6EA 1I7AA 4WJ7A 5HE3A 5DH9B 1U5DA 4HAZB 1PFJA 2ROVA 1X86A 2KUPA 1SGHA 5FI1A 5KQ1A 2YVCA 1GG3A 5J3YA 2YS5A 3F5RA 5JHGA 2OTXA 1DDWA 2P0HA 2ELBA 2H7DA 2IYBA 4PQ0A 1J19A 2Y7BA 1FB8A 2CY4A 4HB3B 3SO6A 4K2PA 3CXBB 1EF1A 1DDMA 2NMBA 2Z0PA 1X1GA 3ML4A 1RRPB 2DHIA 2G35A 3A98B 2EJ8A 1V5MA 4ZRJA 1Y5OA 4EKUA 1UPQA 1LB1A 1Z87A 1U5FA 4YL8A 1XX0A 3ZDTA 5J3QA 4B6HA 1LW3A 2I1JA 1FOEA 1U5EA 3PVWA 1WGQA 3O96A 3TVVA 1ISNA 1UNPA 2L2IA 4IFSA 5JHHA 4HDOA 3ZVRA 2P0FA 3PSCA 2QKMA 2DTCA 2XQNM 4A6KA 4HATB 2HTHB 5C79A 2UVMA 2I5FA 1V61A 2KCJA 2RUKB 3AU4A 4MY6A 3GYOA 4HAWB 5D27A 1DROA 1V5UA 2J59M 2KGXB 5LOPB 3MPXA 3PG7A 2MKRA 2VKIA 2GJYA 1ZC4B 3QBVB 3WYFB 1I2HA 1TXDA 4WVFB 1U29A 3P6AA 2HE7A 2ELAA 2P0DA 3A8QA 4KAXB 1KI1B 1DYNA 2K2UA 2J0JA 4KHOA 1NTVA 2Q13A 2AEHA 2EMTA 1UPRA 1AQCA 2D10A 3F0WA 4CYEA 1EVHA 2GS0A 2LOZA 1BWNA 1PMSA 3BINA 4F7HA 1WG7A 2LYDA 3TW1A 2E2XA 2QKLA 4C0AA 1H4RA 1NTYA 4HAYB 5JLJB 1P6SA 4DX8A 1DDVA 3P7ZA 1AWEA 2YRYA 3AU5A 2COFA 3ODOA 5LONB 2K00A 4K2OA 4NSWA 5DI9B 1IRSA 1FHWA 2RGNB 2GCLA 2DHJA 5CLLB 1V89A 2CAYA 2LULA 2OQBA 4BBKA 2J0KA 4ZRIA 1MIZB 1WJMA 2DKPA 3FM8C 4KHBB 2N0YA 4CHJA 2JP2A 1FHXA 1MIXA 5D3VA 4HHVA 4WSFA 2D9YA 1FGYA 3AJ4A 1WJ1A 2YS1A 1U2BA 1MPHA 1X1FA 1B55A 2AL6A 3FEHA 1WGUA 5CLQB 2X18A 2D11A
chains in the Genus database with same CATH superfamily
4P7IA 5C5BA 3D8EA 2ROZB 1KZ7A 5D3YA 2W2XD 2CRFA 4L1RA 2BCJA 2W2WA 5I2MA 4EJNA 1TQZA 3ULBA 1XKEA 2J0MA 3KSYA 5HE0A 3HIEA 2R09A 3NWAA 5C6RA 1ZYIA 1RJ2A 2DN6A 2I1KA 4GPTB 1XODA 2YT0A 2M38A 3T06A 2DYQA 5HE1A 1MAIA 3UZTA 1QC6A 4DBBA 4HAUB 4Z2NA 2KIEA 1MK9B 3DXDA 2GCJA 1N3HA 1M7EA 1TJ6A 3A8PA 4GNKB 1BAKA 1PLSA 3KZ1A 3TO1A 3SV1A 2P8VA 2MDXA 5DHAB 2FJLA 5DHFB 1U5GA 2DLWA 3CIKA 4GXBA 2R0DA 3DXEA 5J3TA 1X05A 2W2XC 1FHOA 3IVFA 1OY2A 5FI0A 3PVLA 2DFKA 1WI1A 2D9VA 2YS3A 2ADZA 2D9WA 4PNKA 1P3RA 4HB0B 5LG4B 1ZVRA 2GUMA 1FAOA 2Z0OA 3VOQA 3RCPA 1E5WA 1H10A 3SUZA 2MWNB 2EMSA 2Y8FA 3DCXA 4F7GA 5EFXA 1W1DA 2COCA 4Z2MB 5D3XA 3KRXA 1P5TA 2UZSA 3GYPA 3PZDA 4CHMA 1MI1A 2DX5A 2K2JA 2DYNA 1QQGA 1NU2A 4HDQA 4HB4B 3D8DA 3SNHA 4ZRKA 1XR0B 2D9ZA 3SYXA 2RLOA 2PZ1A 2Y8GA 1J0WA 1DBHA 3LJUX 3TCAA 3OHMB 3MDBC 2RVBB 5JP4A 2UZRA 4A6FA 5M4YB 1V5PA 4GMXB 2L1CA 2Z14A 2N23A 3PVUA 2CY5A 2IFSA 2M14A 4DX90 1MKEA 5DIFB 2D9XA 2Z59A 1XCGA 2MFQA 3QIJA 4MK0A 5C5BB 3WA0A 4H8SA 3DXCA 1NI2A 3D8FA 2D2QA 4QJ5B 3U7DA 4IAPA 2CODA 3HSAA 1T77A 4YONA 2COAA 4GMVA 5KQ4A 1Y19B 4A5KA 2D4QA 2ZPYA 2RSGA 1M7RA 3KRWA 4KHAA 4HSIA 1BTNA 3NWFA 4K17A 5D3WA 3HK0A 3HQCA 3V5WA 1SHCA 4GZUA 5C16A 4QXAB 1X11A 2VSZA 1EAZA 4K81A 4DIXA 2RNRB 3NWDA 1OMWA 4GN1A 4TKNA 4KHBA 1UEFA 3PEGA 1BTKA 4EMOA 2K49A 3QWMA 5L81A 4A6HA 2LG1A 3N7CA 1WVHA 2K8EA 3ODWA 1MK7B 2YF0A 3G9WA 4TYZA 3M1IB 2YT1A 3OANA 5I2SA 3X23A 1XD4A 1ZC3B 4Y94A 2DX1A 5GOWB 1K5DB 1KZGA 4KVGB 2EC1A 2LOXA 5HE2A 1OQNA 3BJIA 4IOYX 1ZM0A 3FSSA 4NY0A 1UNQA 3U8ZA 1EGXA 4HAVB 2LKOA 1GC7A 1V88A 2YSZA 1Q67A 1GC6A 2NZ8B 1FGZA 2VRWB 3FVCA 2I5CA 2DHKA 3KY9A 5KCVA 3NSUA 3TFMA 1UNRA 4XWXA 4HAXB 1W1HA 2DA0A 3HW2B 1ZSQA 4QJ3B 4A6FB 4D0NB 3VIAA 1W1GA 1K5GB 2Z0QA 2H7EA 2KIGA 3A58A 2DKQA 3ODXA 1U27A 2V76A 4HB2B 3ULCA 4MT7A 2ZKMX 4QJ4B 4DXAB 3PP2A 4F7UP 4L6EA 1I7AA 4WJ7A 5HE3A 5DH9B 1U5DA 4HAZB 1PFJA 2KUQA 2ROVA 1X86A 2KUPA 1SGHA 5FI1A 5KQ1A 2YVCA 1GG3A 5J3YA 2YS5A 3F5RA 5JHGA 2R2YA 2OTXA 1DDWA 2P0HA 4GOUA 2ELBA 2H7DA 2IYBA 4PQ0A 1J19A 2Y7BA 1FB8A 2CY4A 2YT2A 4HB3B 3SO6A 4K2PA 3CXBB 1EF1A 4D6WA 1DDMA 2Z4DA 2NMBA 2Z0PA 1X1GA 3ML4A 1RRPB 2DHIA 2G35A 2KR0A 5IRSA 3A98B 2EJ8A 1V5MA 4ZRJA 1Y5OA 4EKUA 1UPQA 1LB1A 1Z87A 1U5FA 4YL8A 2Z13A 1XX0A 3ZDTA 5J3QA 4B6HA 1LW3A 2I1JA 1FOEA 1U5EA 3PVWA 1WGQA 3O96A 3TVVA 1ISNA 1UNPA 2L2IA 4IFSA 5JHHA 4HDOA 3ZVRA 2P0FA 3PSCA 2QKMA 3NW8A 2DTCA 2XQNM 4A6KA 4HATB 2HTHB 5C79A 2UVMA 2I5FA 1V61A 2KCJA 2RUKB 3AU4A 4MY6A 3GYOA 4HAWB 5D27A 1DROA 1V5UA 2J59M 2KGXB 5LOPB 3MPXA 3PG7A 2MKRA 2VKIA 2GJYA 1ZC4B 3QBVB 3WYFB 1I2HA 1TXDA 4WVFB 1U29A 4OT1A 3P6AA 2HE7A 2ELAA 2P0DA 3A8QA 3B77A 4KAXB 1KI1B 1DYNA 2K2UA 2J0JA 4KHOA 1NTVA 2Q13A 2AEHA 2EMTA 1UPRA 1AQCA 2D10A 3F0WA 4CYEA 1EVHA 2GS0A 2LOZA 1BWNA 1PMSA 3BINA 4F7HA 1WG7A 2LYDA 3TW1A 2E2XA 2QKLA 2FJUB 4C0AA 1H4RA 1NTYA 4CSQA 4HAYB 5JLJB 1P6SA 4DX8A 1DDVA 3P7ZA 1AWEA 2YRYA 3AU5A 4OSNA 2COFA 3ODOA 5LONB 2RRFA 2K00A 4K2OA 3U12A 4NSWA 5DI9B 1IRSA 1FHWA 2RGNB 2GCLA 2DHJA 5CLLB 1V89A 2CAYA 2LULA 2OQBA 4BBKA 2J0KA 2NBVA 4ZRIA 1MIZB 1WJMA 2DKPA 3FM8C 4KHBB 2N0YA 4CHJA 2JP2A 1FHXA 1MIXA 5D3VA 4HHVA 4WSFA 2D9YA 1FGYA 3AJ4A 1WJ1A 2YS1A 1U2BA 1MPHA 1X1FA 1B55A 2AL6A 3FEHA 1WGUA 5CLQB 2X18A 2D11A
chains in the Genus database with same CATH topology
4P7IA 5C5BA 3D8EA 2ROZB 1KZ7A 5D3YA 2W2XD 2CRFA 2BCJA 2W2WA 4EJNA 1TQZA 3ULBA 1XKEA 2J0MA 3KSYA 5HE0A 2R09A 5C6RA 1RJ2A 2DN6A 2I1KA 4GPTB 1XODA 2YT0A 2M38A 3T06A 2DYQA 5HE1A 1MAIA 3UZTA 1QC6A 4DBBA 4HAUB 4Z2NA 1MK9B 3DXDA 2GCJA 1N3HA 1M7EA 1TJ6A 3A8PA 1BAKA 1PLSA 3KZ1A 3TO1A 3SV1A 2P8VA 2MDXA 5DHAB 2FJLA 5DHFB 1U5GA 2DLWA 3CIKA 4GXBA 2R0DA 3DXEA 5J3TA 1X05A 2W2XC 1FHOA 3IVFA 1OY2A 5FI0A 3PVLA 2DFKA 1WI1A 2D9VA 2YS3A 2ADZA 2D9WA 4PNKA 1P3RA 4HB0B 1ZVRA 1FAOA 2Z0OA 3VOQA 3RCPA 1E5WA 1H10A 3SUZA 2MWNB 2EMSA 2Y8FA 4F7GA 5EFXA 1W1DA 2COCA 4Z2MB 5D3XA 3KRXA 1P5TA 2UZSA 3GYPA 3PZDA 4CHMA 2DX5A 2K2JA 2DYNA 1QQGA 1NU2A 4HDQA 4HB4B 3D8DA 3SNHA 4ZRKA 1XR0B 2D9ZA 3SYXA 2RLOA 2PZ1A 2Y8GA 1J0WA 1DBHA 3LJUX 3TCAA 3MDBC 2RVBB 5JP4A 2UZRA 4A6FA 1V5PA 4GMXB 2L1CA 2N23A 3PVUA 2CY5A 2IFSA 2M14A 4DX90 1MKEA 5DIFB 2D9XA 3QIJA 1XCGA 2MFQA 4MK0A 5C5BB 3WA0A 4H8SA 3DXCA 1NI2A 3D8FA 2D2QA 3U7DA 4IAPA 2CODA 4YONA 2COAA 4GMVA 5KQ4A 1Y19B 4A5KA 2D4QA 2ZPYA 2RSGA 1M7RA 3KRWA 4KHAA 1BTNA 4K17A 5D3WA 3HK0A 3HQCA 3V5WA 1SHCA 4GZUA 5C16A 1X11A 2VSZA 1EAZA 4K81A 2RNRB 1OMWA 4GN1A 4TKNA 1UEFA 3PEGA 1BTKA 4EMOA 3QWMA 5L81A 4A6HA 2LG1A 3N7CA 1WVHA 3ODWA 1MK7B 2YF0A 3G9WA 4TYZA 3M1IB 2YT1A 3OANA 3X23A 1XD4A 1ZC3B 4Y94A 2DX1A 5GOWB 1K5DB 1KZGA 4KVGB 2EC1A 2LOXA 5HE2A 1OQNA 3BJIA 4IOYX 1ZM0A 3FSSA 4NY0A 1UNQA 3U8ZA 1EGXA 4HAVB 2LKOA 1GC7A 1V88A 2YSZA 1Q67A 1GC6A 2NZ8B 1FGZA 2VRWB 2I5CA 2DHKA 3KY9A 5KCVA 3NSUA 3TFMA 1UNRA 4XWXA 4HAXB 1W1HA 2DA0A 3HW2B 1ZSQA 4A6FB 4D0NB 3VIAA 1W1GA 1K5GB 2Z0QA 2H7EA 2DKQA 3ODXA 1U27A 2V76A 4HB2B 3ULCA 4MT7A 4DXAB 3PP2A 4F7UP 4L6EA 1I7AA 4WJ7A 5HE3A 5DH9B 1U5DA 4HAZB 1PFJA 2ROVA 1X86A 2KUPA 1SGHA 5FI1A 5KQ1A 2YVCA 1GG3A 5J3YA 2YS5A 3F5RA 5JHGA 2OTXA 1DDWA 2P0HA 2ELBA 2H7DA 2IYBA 4PQ0A 1J19A 2Y7BA 1FB8A 2CY4A 4HB3B 3SO6A 4K2PA 3CXBB 1EF1A 1DDMA 2NMBA 2Z0PA 1X1GA 3ML4A 1RRPB 2DHIA 2G35A 3A98B 2EJ8A 1V5MA 4ZRJA 1Y5OA 4EKUA 1UPQA 1LB1A 1Z87A 1U5FA 4YL8A 1XX0A 3ZDTA 5J3QA 4B6HA 1LW3A 2I1JA 1FOEA 1U5EA 3PVWA 1WGQA 3O96A 3TVVA 1ISNA 1UNPA 2L2IA 4IFSA 5JHHA 4HDOA 3ZVRA 2P0FA 3PSCA 2QKMA 2DTCA 2XQNM 4A6KA 4HATB 2HTHB 5C79A 2UVMA 2I5FA 1V61A 2KCJA 2RUKB 3AU4A 4MY6A 3GYOA 4HAWB 5D27A 1DROA 1V5UA 2J59M 2KGXB 5LOPB 3MPXA 3PG7A 2MKRA 2VKIA 2GJYA 1ZC4B 3QBVB 3WYFB 1I2HA 1TXDA 4WVFB 1U29A 3P6AA 2HE7A 2ELAA 2P0DA 3A8QA 4KAXB 1KI1B 1DYNA 2K2UA 2J0JA 4KHOA 1NTVA 2Q13A 2AEHA 2EMTA 1UPRA 1AQCA 2D10A 3F0WA 4CYEA 1EVHA 2GS0A 2LOZA 1BWNA 1PMSA 3BINA 4F7HA 1WG7A 2LYDA 3TW1A 2E2XA 2QKLA 4C0AA 1H4RA 1NTYA 4HAYB 5JLJB 1P6SA 4DX8A 1DDVA 3P7ZA 1AWEA 2YRYA 3AU5A 2COFA 3ODOA 5LONB 2K00A 4K2OA 4NSWA 5DI9B 1IRSA 1FHWA 2RGNB 2GCLA 2DHJA 5CLLB 1V89A 2CAYA 2LULA 2OQBA 4BBKA 2J0KA 4ZRIA 1MIZB 1WJMA 2DKPA 3FM8C 4KHBB 2N0YA 4CHJA 2JP2A 1FHXA 1MIXA 5D3VA 4HHVA 4WSFA 2D9YA 1FGYA 3AJ4A 1WJ1A 2YS1A 1U2BA 1MPHA 1X1FA 1B55A 2AL6A 3FEHA 1WGUA 5CLQB 2X18A 2D11A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P7I A;  5C5B A;  3D8E A;  2ROZ B;  1KZ7 A;  5D3Y A;  2W2X D;  2CRF A;  2BCJ A;  2W2W A;  4EJN A;  1TQZ A;  3ULB A;  1XKE A;  2J0M A;  3KSY A;  5HE0 A;  2R09 A;  5C6R A;  1RJ2 A;  2DN6 A;  2I1K A;  4GPT B;  1XOD A;  2YT0 A;  2M38 A;  3T06 A;  2DYQ A;  5HE1 A;  1MAI A;  3UZT A;  1QC6 A;  4DBB A;  4HAU B;  4Z2N A;  1MK9 B;  3DXD A;  2GCJ A;  1N3H A;  1M7E A;  1TJ6 A;  3A8P A;  1BAK A;  1PLS A;  3KZ1 A;  3TO1 A;  3SV1 A;  2P8V A;  2MDX A;  5DHA B;  2FJL A;  5DHF B;  1U5G A;  2DLW A;  3CIK A;  4GXB A;  2R0D A;  3DXE A;  5J3T A;  1X05 A;  2W2X C;  1FHO A;  3IVF A;  1OY2 A;  5FI0 A;  3PVL A;  2DFK A;  1WI1 A;  2D9V A;  2YS3 A;  2ADZ A;  2D9W A;  4PNK A;  1P3R A;  4HB0 B;  1ZVR A;  1FAO A;  2Z0O A;  3VOQ A;  3RCP A;  1E5W A;  1H10 A;  3SUZ A;  2MWN B;  2EMS A;  2Y8F A;  4F7G A;  5EFX A;  1W1D A;  2COC A;  4Z2M B;  5D3X A;  3KRX A;  1P5T A;  2UZS A;  3GYP A;  3PZD A;  4CHM A;  2DX5 A;  2K2J A;  2DYN A;  1QQG A;  1NU2 A;  4HDQ A;  4HB4 B;  3D8D A;  3SNH A;  4ZRK A;  1XR0 B;  2D9Z A;  3SYX A;  2RLO A;  2PZ1 A;  2Y8G A;  1J0W A;  1DBH A;  3LJU X;  3TCA A;  3MDB C;  2RVB B;  5JP4 A;  2UZR A;  4A6F A;  1V5P A;  4GMX B;  2L1C A;  2N23 A;  3PVU A;  2CY5 A;  2IFS A;  2M14 A;  4DX9 0;  1MKE A;  5DIF B;  2D9X A;  3QIJ A;  1XCG A;  2MFQ A;  4MK0 A;  5C5B B;  3WA0 A;  4H8S A;  3DXC A;  1NI2 A;  3D8F A;  2D2Q A;  3U7D A;  4IAP A;  2COD A;  4YON A;  2COA A;  4GMV A;  5KQ4 A;  1Y19 B;  4A5K A;  2D4Q A;  2ZPY A;  2RSG A;  1M7R A;  3KRW A;  4KHA A;  1BTN A;  4K17 A;  5D3W A;  3HK0 A;  3HQC A;  3V5W A;  1SHC A;  4GZU A;  5C16 A;  1X11 A;  2VSZ A;  1EAZ A;  4K81 A;  2RNR B;  1OMW A;  4GN1 A;  4TKN A;  1UEF A;  3PEG A;  1BTK A;  4EMO A;  3QWM A;  5L81 A;  4A6H A;  2LG1 A;  3N7C A;  1WVH A;  3ODW A;  1MK7 B;  2YF0 A;  3G9W A;  4TYZ A;  3M1I B;  2YT1 A;  3OAN A;  3X23 A;  1XD4 A;  1ZC3 B;  4Y94 A;  2DX1 A;  5GOW B;  1K5D B;  1KZG A;  4KVG B;  2EC1 A;  2LOX A;  5HE2 A;  1OQN A;  3BJI A;  4IOY X;  1ZM0 A;  3FSS A;  4NY0 A;  1UNQ A;  3U8Z A;  1EGX A;  4HAV B;  2LKO A;  1GC7 A;  1V88 A;  2YSZ A;  1Q67 A;  1GC6 A;  2NZ8 B;  1FGZ A;  2VRW B;  2I5C A;  2DHK A;  3KY9 A;  5KCV A;  3NSU A;  3TFM A;  1UNR A;  4XWX A;  4HAX B;  1W1H A;  2DA0 A;  3HW2 B;  1ZSQ A;  4A6F B;  4D0N B;  3VIA A;  1W1G A;  1K5G B;  2Z0Q A;  2H7E A;  2DKQ A;  3ODX A;  1U27 A;  2V76 A;  4HB2 B;  3ULC A;  4MT7 A;  4DXA B;  3PP2 A;  4F7U P;  4L6E A;  1I7A A;  4WJ7 A;  5HE3 A;  5DH9 B;  1U5D A;  4HAZ B;  1PFJ A;  2ROV A;  1X86 A;  2KUP A;  1SGH A;  5FI1 A;  5KQ1 A;  2YVC A;  1GG3 A;  5J3Y A;  2YS5 A;  3F5R A;  5JHG A;  2OTX A;  1DDW A;  2P0H A;  2ELB A;  2H7D A;  2IYB A;  4PQ0 A;  1J19 A;  2Y7B A;  1FB8 A;  2CY4 A;  4HB3 B;  3SO6 A;  4K2P A;  3CXB B;  1EF1 A;  1DDM A;  2NMB A;  2Z0P A;  1X1G A;  3ML4 A;  1RRP B;  2DHI A;  2G35 A;  3A98 B;  2EJ8 A;  1V5M A;  4ZRJ A;  1Y5O A;  4EKU A;  1UPQ A;  1LB1 A;  1Z87 A;  1U5F A;  4YL8 A;  1XX0 A;  3ZDT A;  5J3Q A;  4B6H A;  1LW3 A;  2I1J A;  1FOE A;  1U5E A;  3PVW A;  1WGQ A;  3O96 A;  3TVV A;  1ISN A;  1UNP A;  2L2I A;  4IFS A;  5JHH A;  4HDO A;  3ZVR A;  2P0F A;  3PSC A;  2QKM A;  2DTC A;  2XQN M;  4A6K A;  4HAT B;  2HTH B;  5C79 A;  2UVM A;  2I5F A;  1V61 A;  2KCJ A;  2RUK B;  3AU4 A;  4MY6 A;  3GYO A;  4HAW B;  5D27 A;  1DRO A;  1V5U A;  2J59 M;  2KGX B;  5LOP B;  3MPX A;  3PG7 A;  2MKR A;  2VKI A;  2GJY A;  1ZC4 B;  3QBV B;  3WYF B;  1I2H A;  1TXD A;  4WVF B;  1U29 A;  3P6A A;  2HE7 A;  2ELA A;  2P0D A;  3A8Q A;  4KAX B;  1KI1 B;  1DYN A;  2K2U A;  2J0J A;  4KHO A;  1NTV A;  2Q13 A;  2AEH A;  2EMT A;  1UPR A;  1AQC A;  2D10 A;  3F0W A;  4CYE A;  1EVH A;  2GS0 A;  2LOZ A;  1BWN A;  1PMS A;  3BIN A;  4F7H A;  1WG7 A;  2LYD A;  3TW1 A;  2E2X A;  2QKL A;  4C0A A;  1H4R A;  1NTY A;  4HAY B;  5JLJ B;  1P6S A;  4DX8 A;  1DDV A;  3P7Z A;  1AWE A;  2YRY A;  3AU5 A;  2COF A;  3ODO A;  5LON B;  2K00 A;  4K2O A;  4NSW A;  5DI9 B;  1IRS A;  1FHW A;  2RGN B;  2GCL A;  2DHJ A;  5CLL B;  1V89 A;  2CAY A;  2LUL A;  2OQB A;  4BBK A;  2J0K A;  4ZRI A;  1MIZ B;  1WJM A;  2DKP A;  3FM8 C;  4KHB B;  2N0Y A;  4CHJ A;  2JP2 A;  1FHX A;  1MIX A;  5D3V A;  4HHV A;  4WSF A;  2D9Y A;  1FGY A;  3AJ4 A;  1WJ1 A;  2YS1 A;  1U2B A;  1MPH A;  1X1F A;  1B55 A;  2AL6 A;  3FEH A;  1WGU A;  5CLQ B;  2X18 A;  2D11 A; 
#chains in the Genus database with same CATH topology
 4P7I A;  5C5B A;  3D8E A;  2ROZ B;  1KZ7 A;  5D3Y A;  2W2X D;  2CRF A;  4L1R A;  2BCJ A;  2W2W A;  5I2M A;  4EJN A;  1TQZ A;  3ULB A;  1XKE A;  2J0M A;  3KSY A;  5HE0 A;  3HIE A;  2R09 A;  3NWA A;  5C6R A;  1ZYI A;  1RJ2 A;  2DN6 A;  2I1K A;  4GPT B;  1XOD A;  2YT0 A;  2M38 A;  3T06 A;  2DYQ A;  5HE1 A;  1MAI A;  3UZT A;  1QC6 A;  4DBB A;  4HAU B;  4Z2N A;  2KIE A;  1MK9 B;  3DXD A;  2GCJ A;  1N3H A;  1M7E A;  1TJ6 A;  3A8P A;  4GNK B;  1BAK A;  1PLS A;  3KZ1 A;  3TO1 A;  3SV1 A;  2P8V A;  2MDX A;  5DHA B;  2FJL A;  5DHF B;  1U5G A;  2DLW A;  3CIK A;  4GXB A;  2R0D A;  3DXE A;  5J3T A;  1X05 A;  2W2X C;  1FHO A;  3IVF A;  1OY2 A;  5FI0 A;  3PVL A;  2DFK A;  1WI1 A;  2D9V A;  2YS3 A;  2ADZ A;  2D9W A;  4PNK A;  1P3R A;  4HB0 B;  5LG4 B;  1ZVR A;  2GUM A;  1FAO A;  2Z0O A;  3VOQ A;  3RCP A;  1E5W A;  1H10 A;  3SUZ A;  2MWN B;  2EMS A;  2Y8F A;  3DCX A;  4F7G A;  5EFX A;  1W1D A;  2COC A;  4Z2M B;  5D3X A;  3KRX A;  1P5T A;  2UZS A;  3GYP A;  3PZD A;  4CHM A;  1MI1 A;  2DX5 A;  2K2J A;  2DYN A;  1QQG A;  1NU2 A;  4HDQ A;  4HB4 B;  3D8D A;  3SNH A;  4ZRK A;  1XR0 B;  2D9Z A;  3SYX A;  2RLO A;  2PZ1 A;  2Y8G A;  1J0W A;  1DBH A;  3LJU X;  3TCA A;  3OHM B;  3MDB C;  2RVB B;  5JP4 A;  2UZR A;  4A6F A;  5M4Y B;  1V5P A;  4GMX B;  2L1C A;  2Z14 A;  2N23 A;  3PVU A;  2CY5 A;  2IFS A;  2M14 A;  4DX9 0;  1MKE A;  5DIF B;  2D9X A;  2Z59 A;  1XCG A;  2MFQ A;  3QIJ A;  4MK0 A;  5C5B B;  3WA0 A;  4H8S A;  3DXC A;  1NI2 A;  3D8F A;  2D2Q A;  4QJ5 B;  3U7D A;  4IAP A;  2COD A;  3HSA A;  1T77 A;  4YON A;  2COA A;  4GMV A;  5KQ4 A;  1Y19 B;  4A5K A;  2D4Q A;  2ZPY A;  2RSG A;  1M7R A;  3KRW A;  4KHA A;  4HSI A;  1BTN A;  3NWF A;  4K17 A;  5D3W A;  3HK0 A;  3HQC A;  3V5W A;  1SHC A;  4GZU A;  5C16 A;  4QXA B;  1X11 A;  2VSZ A;  1EAZ A;  4K81 A;  4DIX A;  2RNR B;  3NWD A;  1OMW A;  4GN1 A;  4TKN A;  4KHB A;  1UEF A;  3PEG A;  1BTK A;  4EMO A;  2K49 A;  3QWM A;  5L81 A;  4A6H A;  2LG1 A;  3N7C A;  1WVH A;  2K8E A;  3ODW A;  1MK7 B;  2YF0 A;  3G9W A;  4TYZ A;  3M1I B;  2YT1 A;  3OAN A;  5I2S A;  3X23 A;  1XD4 A;  1ZC3 B;  4Y94 A;  2DX1 A;  5GOW B;  1K5D B;  1KZG A;  4KVG B;  2EC1 A;  2LOX A;  5HE2 A;  1OQN A;  3BJI A;  4IOY X;  1ZM0 A;  3FSS A;  4NY0 A;  1UNQ A;  3U8Z A;  1EGX A;  4HAV B;  2LKO A;  1GC7 A;  1V88 A;  2YSZ A;  1Q67 A;  1GC6 A;  2NZ8 B;  1FGZ A;  2VRW B;  3FVC A;  2I5C A;  2DHK A;  3KY9 A;  5KCV A;  3NSU A;  3TFM A;  1UNR A;  4XWX A;  4HAX B;  1W1H A;  2DA0 A;  3HW2 B;  1ZSQ A;  4QJ3 B;  4A6F B;  4D0N B;  3VIA A;  1W1G A;  1K5G B;  2Z0Q A;  2H7E A;  2KIG A;  3A58 A;  2DKQ A;  3ODX A;  1U27 A;  2V76 A;  4HB2 B;  3ULC A;  4MT7 A;  2ZKM X;  4QJ4 B;  4DXA B;  3PP2 A;  4F7U P;  4L6E A;  1I7A A;  4WJ7 A;  5HE3 A;  5DH9 B;  1U5D A;  4HAZ B;  1PFJ A;  2KUQ A;  2ROV A;  1X86 A;  2KUP A;  1SGH A;  5FI1 A;  5KQ1 A;  2YVC A;  1GG3 A;  5J3Y A;  2YS5 A;  3F5R A;  5JHG A;  2R2Y A;  2OTX A;  1DDW A;  2P0H A;  4GOU A;  2ELB A;  2H7D A;  2IYB A;  4PQ0 A;  1J19 A;  2Y7B A;  1FB8 A;  2CY4 A;  2YT2 A;  4HB3 B;  3SO6 A;  4K2P A;  3CXB B;  1EF1 A;  4D6W A;  1DDM A;  2Z4D A;  2NMB A;  2Z0P A;  1X1G A;  3ML4 A;  1RRP B;  2DHI A;  2G35 A;  2KR0 A;  5IRS A;  3A98 B;  2EJ8 A;  1V5M A;  4ZRJ A;  1Y5O A;  4EKU A;  1UPQ A;  1LB1 A;  1Z87 A;  1U5F A;  4YL8 A;  2Z13 A;  1XX0 A;  3ZDT A;  5J3Q A;  4B6H A;  1LW3 A;  2I1J A;  1FOE A;  1U5E A;  3PVW A;  1WGQ A;  3O96 A;  3TVV A;  1ISN A;  1UNP A;  2L2I A;  4IFS A;  5JHH A;  4HDO A;  3ZVR A;  2P0F A;  3PSC A;  2QKM A;  3NW8 A;  2DTC A;  2XQN M;  4A6K A;  4HAT B;  2HTH B;  5C79 A;  2UVM A;  2I5F A;  1V61 A;  2KCJ A;  2RUK B;  3AU4 A;  4MY6 A;  3GYO A;  4HAW B;  5D27 A;  1DRO A;  1V5U A;  2J59 M;  2KGX B;  5LOP B;  3MPX A;  3PG7 A;  2MKR A;  2VKI A;  2GJY A;  1ZC4 B;  3QBV B;  3WYF B;  1I2H A;  1TXD A;  4WVF B;  1U29 A;  4OT1 A;  3P6A A;  2HE7 A;  2ELA A;  2P0D A;  3A8Q A;  3B77 A;  4KAX B;  1KI1 B;  1DYN A;  2K2U A;  2J0J A;  4KHO A;  1NTV A;  2Q13 A;  2AEH A;  2EMT A;  1UPR A;  1AQC A;  2D10 A;  3F0W A;  4CYE A;  1EVH A;  2GS0 A;  2LOZ A;  1BWN A;  1PMS A;  3BIN A;  4F7H A;  1WG7 A;  2LYD A;  3TW1 A;  2E2X A;  2QKL A;  2FJU B;  4C0A A;  1H4R A;  1NTY A;  4CSQ A;  4HAY B;  5JLJ B;  1P6S A;  4DX8 A;  1DDV A;  3P7Z A;  1AWE A;  2YRY A;  3AU5 A;  4OSN A;  2COF A;  3ODO A;  5LON B;  2RRF A;  2K00 A;  4K2O A;  3U12 A;  4NSW A;  5DI9 B;  1IRS A;  1FHW A;  2RGN B;  2GCL A;  2DHJ A;  5CLL B;  1V89 A;  2CAY A;  2LUL A;  2OQB A;  4BBK A;  2J0K A;  2NBV A;  4ZRI A;  1MIZ B;  1WJM A;  2DKP A;  3FM8 C;  4KHB B;  2N0Y A;  4CHJ A;  2JP2 A;  1FHX A;  1MIX A;  5D3V A;  4HHV A;  4WSF A;  2D9Y A;  1FGY A;  3AJ4 A;  1WJ1 A;  2YS1 A;  1U2B A;  1MPH A;  1X1F A;  1B55 A;  2AL6 A;  3FEH A;  1WGU A;  5CLQ B;  2X18 A;  2D11 A; 
#chains in the Genus database with same CATH homology
 4P7I A;  5C5B A;  3D8E A;  2ROZ B;  1KZ7 A;  5D3Y A;  2W2X D;  2CRF A;  2BCJ A;  2W2W A;  4EJN A;  1TQZ A;  3ULB A;  1XKE A;  2J0M A;  3KSY A;  5HE0 A;  2R09 A;  5C6R A;  1RJ2 A;  2DN6 A;  2I1K A;  4GPT B;  1XOD A;  2YT0 A;  2M38 A;  3T06 A;  2DYQ A;  5HE1 A;  1MAI A;  3UZT A;  1QC6 A;  4DBB A;  4HAU B;  4Z2N A;  1MK9 B;  3DXD A;  2GCJ A;  1N3H A;  1M7E A;  1TJ6 A;  3A8P A;  1BAK A;  1PLS A;  3KZ1 A;  3TO1 A;  3SV1 A;  2P8V A;  2MDX A;  5DHA B;  2FJL A;  5DHF B;  1U5G A;  2DLW A;  3CIK A;  4GXB A;  2R0D A;  3DXE A;  5J3T A;  1X05 A;  2W2X C;  1FHO A;  3IVF A;  1OY2 A;  5FI0 A;  3PVL A;  2DFK A;  1WI1 A;  2D9V A;  2YS3 A;  2ADZ A;  2D9W A;  4PNK A;  1P3R A;  4HB0 B;  1ZVR A;  1FAO A;  2Z0O A;  3VOQ A;  3RCP A;  1E5W A;  1H10 A;  3SUZ A;  2MWN B;  2EMS A;  2Y8F A;  4F7G A;  5EFX A;  1W1D A;  2COC A;  4Z2M B;  5D3X A;  3KRX A;  1P5T A;  2UZS A;  3GYP A;  3PZD A;  4CHM A;  2DX5 A;  2K2J A;  2DYN A;  1QQG A;  1NU2 A;  4HDQ A;  4HB4 B;  3D8D A;  3SNH A;  4ZRK A;  1XR0 B;  2D9Z A;  3SYX A;  2RLO A;  2PZ1 A;  2Y8G A;  1J0W A;  1DBH A;  3LJU X;  3TCA A;  3MDB C;  2RVB B;  5JP4 A;  2UZR A;  4A6F A;  1V5P A;  4GMX B;  2L1C A;  2N23 A;  3PVU A;  2CY5 A;  2IFS A;  2M14 A;  4DX9 0;  1MKE A;  5DIF B;  2D9X A;  3QIJ A;  1XCG A;  2MFQ A;  4MK0 A;  5C5B B;  3WA0 A;  4H8S A;  3DXC A;  1NI2 A;  3D8F A;  2D2Q A;  3U7D A;  4IAP A;  2COD A;  4YON A;  2COA A;  4GMV A;  5KQ4 A;  1Y19 B;  4A5K A;  2D4Q A;  2ZPY A;  2RSG A;  1M7R A;  3KRW A;  4KHA A;  1BTN A;  4K17 A;  5D3W A;  3HK0 A;  3HQC A;  3V5W A;  1SHC A;  4GZU A;  5C16 A;  1X11 A;  2VSZ A;  1EAZ A;  4K81 A;  2RNR B;  1OMW A;  4GN1 A;  4TKN A;  1UEF A;  3PEG A;  1BTK A;  4EMO A;  3QWM A;  5L81 A;  4A6H A;  2LG1 A;  3N7C A;  1WVH A;  3ODW A;  1MK7 B;  2YF0 A;  3G9W A;  4TYZ A;  3M1I B;  2YT1 A;  3OAN A;  3X23 A;  1XD4 A;  1ZC3 B;  4Y94 A;  2DX1 A;  5GOW B;  1K5D B;  1KZG A;  4KVG B;  2EC1 A;  2LOX A;  5HE2 A;  1OQN A;  3BJI A;  4IOY X;  1ZM0 A;  3FSS A;  4NY0 A;  1UNQ A;  3U8Z A;  1EGX A;  4HAV B;  2LKO A;  1GC7 A;  1V88 A;  2YSZ A;  1Q67 A;  1GC6 A;  2NZ8 B;  1FGZ A;  2VRW B;  2I5C A;  2DHK A;  3KY9 A;  5KCV A;  3NSU A;  3TFM A;  1UNR A;  4XWX A;  4HAX B;  1W1H A;  2DA0 A;  3HW2 B;  1ZSQ A;  4A6F B;  4D0N B;  3VIA A;  1W1G A;  1K5G B;  2Z0Q A;  2H7E A;  2DKQ A;  3ODX A;  1U27 A;  2V76 A;  4HB2 B;  3ULC A;  4MT7 A;  4DXA B;  3PP2 A;  4F7U P;  4L6E A;  1I7A A;  4WJ7 A;  5HE3 A;  5DH9 B;  1U5D A;  4HAZ B;  1PFJ A;  2ROV A;  1X86 A;  2KUP A;  1SGH A;  5FI1 A;  5KQ1 A;  2YVC A;  1GG3 A;  5J3Y A;  2YS5 A;  3F5R A;  5JHG A;  2OTX A;  1DDW A;  2P0H A;  2ELB A;  2H7D A;  2IYB A;  4PQ0 A;  1J19 A;  2Y7B A;  1FB8 A;  2CY4 A;  4HB3 B;  3SO6 A;  4K2P A;  3CXB B;  1EF1 A;  1DDM A;  2NMB A;  2Z0P A;  1X1G A;  3ML4 A;  1RRP B;  2DHI A;  2G35 A;  3A98 B;  2EJ8 A;  1V5M A;  4ZRJ A;  1Y5O A;  4EKU A;  1UPQ A;  1LB1 A;  1Z87 A;  1U5F A;  4YL8 A;  1XX0 A;  3ZDT A;  5J3Q A;  4B6H A;  1LW3 A;  2I1J A;  1FOE A;  1U5E A;  3PVW A;  1WGQ A;  3O96 A;  3TVV A;  1ISN A;  1UNP A;  2L2I A;  4IFS A;  5JHH A;  4HDO A;  3ZVR A;  2P0F A;  3PSC A;  2QKM A;  2DTC A;  2XQN M;  4A6K A;  4HAT B;  2HTH B;  5C79 A;  2UVM A;  2I5F A;  1V61 A;  2KCJ A;  2RUK B;  3AU4 A;  4MY6 A;  3GYO A;  4HAW B;  5D27 A;  1DRO A;  1V5U A;  2J59 M;  2KGX B;  5LOP B;  3MPX A;  3PG7 A;  2MKR A;  2VKI A;  2GJY A;  1ZC4 B;  3QBV B;  3WYF B;  1I2H A;  1TXD A;  4WVF B;  1U29 A;  3P6A A;  2HE7 A;  2ELA A;  2P0D A;  3A8Q A;  4KAX B;  1KI1 B;  1DYN A;  2K2U A;  2J0J A;  4KHO A;  1NTV A;  2Q13 A;  2AEH A;  2EMT A;  1UPR A;  1AQC A;  2D10 A;  3F0W A;  4CYE A;  1EVH A;  2GS0 A;  2LOZ A;  1BWN A;  1PMS A;  3BIN A;  4F7H A;  1WG7 A;  2LYD A;  3TW1 A;  2E2X A;  2QKL A;  4C0A A;  1H4R A;  1NTY A;  4HAY B;  5JLJ B;  1P6S A;  4DX8 A;  1DDV A;  3P7Z A;  1AWE A;  2YRY A;  3AU5 A;  2COF A;  3ODO A;  5LON B;  2K00 A;  4K2O A;  4NSW A;  5DI9 B;  1IRS A;  1FHW A;  2RGN B;  2GCL A;  2DHJ A;  5CLL B;  1V89 A;  2CAY A;  2LUL A;  2OQB A;  4BBK A;  2J0K A;  4ZRI A;  1MIZ B;  1WJM A;  2DKP A;  3FM8 C;  4KHB B;  2N0Y A;  4CHJ A;  2JP2 A;  1FHX A;  1MIX A;  5D3V A;  4HHV A;  4WSF A;  2D9Y A;  1FGY A;  3AJ4 A;  1WJ1 A;  2YS1 A;  1U2B A;  1MPH A;  1X1F A;  1B55 A;  2AL6 A;  3FEH A;  1WGU A;  5CLQ B;  2X18 A;  2D11 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...