3A8PA

Crystal structure of the tiam2 phccex domain
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
238
structure length
232
Chain Sequence
b'VVRKAGWLFFKPLVTLQKERKLELVARRKWKQYWVTLKGCTLLFYETYGKSAPRCALFAEDSIVQSVPEHPKKEHVFCLSNSCGDVYLFQATSQTDLENWVTAIHSACASLFAKKHGKEDTVRLLKSQTRSLLQKIDMDSKMKKMAELQLSVVSDPKNRKAIENQIRQWEQNLEKFHMDLFRMRCYLASLQGGELPNPKSLLAATSRPSKLALGRLGVLSVSSFHALVCSRD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords T-lymphoma invasion and metastasis-inducing protein 2
publication title The PHCCEx domain of Tiam1/2 is a novel protein- and membrane-binding module
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
total genus 75
structure length 232
sequence length 238
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
A PF18385 Tiam_CC_Ex T-lymphoma invasion and metastasis CC-Ex domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3a8pA01
2KUPA 1IRSA 4C0AA 2M14A 2QKLA 2I5CA 5GOWB 2IFSA 3PSCA 2W2WA 4GMXB 5DI9B 4P7IA 3WYFB 4HAUB 2RGNB 2V76A 3SYXA 4YONA 1U29A 1H10A 1J19A 1M7RA 5CLQB 2D9XA 2HTHB 2VKIA 1BAKA 5KQ4A 2K2JA 2YF0A 1B55A 1FOEA 1EVHA 4CHMA 2Z0PA 4GXBA 2L2IA 5C79A 5FI1A 4TYZA 4Z2MB 2H7DA 5D3VA 4HB2B 1MAIA 3GYPA 3PP2A 3UZTA 1PMSA 1RRPB 4A6FB 4GZUA 4K2PA 4HAWB 4F7GA 4TKNA 3X23A 1W1GA 1QQGA 1EGXA 4BBKA 3HQCA 1DBHA 1U5DA 4DXAB 2DX5A 5J3TA 2MKRA 2RLOA 1QC6A 3KSYA 4WJ7A 1WGQA 1EAZA 1XKEA 4IOYX 3TO1A 4PNKA 2YS1A 1X1GA 1TJ6A 4A6HA 1ZC4B 2D11A 4K81A 4ZRJA 4KVGB 1X05A 3KZ1A 5C5BA 1V88A 3QBVB 5JHGA 2Y8FA 1BTNA 4D0NB 2CY4A 1Y5OA 2COFA 1WVHA 1V5MA 2P0DA 2R0DA 1NI2A 4H8SA 1DDWA 2D9WA 4DX90 5J3QA 1UNRA 1P5TA 2YT1A 2AL6A 2EJ8A 1FHXA 2DHJA 5HE3A 3ODOA 1X11A 2ZPYA 2COAA 1ZC3B 3HW2B 4XWXA 1WGUA 2EC1A 4B6HA 4NSWA 1LW3A 2LYDA 2DLWA 4HAVB 4HATB 1LB1A 2UZSA 3F0WA 3PVLA 4GMVA 3KRWA 3M1IB 1Z87A 1DDMA 5LOPB 4Y94A 2Y8GA 5KCVA 2D10A 2VSZA 4F7UP 2QKMA 1M7EA 5D3XA 1FB8A 1Q67A 2E2XA 3VIAA 1XR0B 3FM8C 1FAOA 1GC7A 1OY2A 3AU5A 5HE2A 4KHAA 2X18A 1FHWA 2P0FA 1X86A 3V5WA 3WA0A 4A6FA 3A8QA 1ISNA 3KRXA 1KZGA 3U8ZA 1V61A 1UPRA 1U27A 3MPXA 2J0MA 1XCGA 2UZRA 2I5FA 5J3YA 2RNRB 3U7DA 2ROZB 1P6SA 1FHOA 4GPTB 3IVFA 1DDVA 1U5FA 1U5EA 2FJLA 2MDXA 2GS0A 1GC6A 2I1JA 4EKUA 4HAZB 2HE7A 2Q13A 3D8EA 1P3RA 2DTCA 1ZM0A 5D3YA 2YRYA 2LOZA 2DYQA 2LOXA 3AU4A 5KQ1A 4HDQA 1OMWA 3MDBC 2NZ8B 5CLLB 1WG7A 4HDOA 2L1CA 2R09A 1WI1A 1DYNA 2D9YA 2CAYA 3PVUA 5DIFB 3BJIA 3PVWA 2DKQA 1MPHA 4KAXB 3ULCA 2RSGA 3AJ4A 2OQBA 5DHFB 3ZDTA 2MFQA 3ODXA 2ROVA 2IYBA 2PZ1A 1MK7B 3P6AA 1I2HA 2CRFA 3FSSA 4A5KA 1ZSQA 1EF1A 4KHOA 5JHHA 3O96A 2DX1A 2YSZA 5C16A 1MKEA 1MK9B 2M38A 3HK0A 2BCJA 4IAPA 5EFXA 5L81A 2DKPA 2ELAA 1BTKA 4MK0A 2N23A 2DHKA 2DFKA 1SHCA 2DYNA 2AEHA 2W2XC 2I1KA 3ML4A 2DN6A 1XX0A 2YS5A 1PLSA 1X1FA 4WVFB 2Y7BA 4WSFA 3ULBA 3SNHA 1K5GB 4PQ0A 5FI0A 4CHJA 1DROA 3D8FA 2CY5A 2J0JA 2JP2A 5D3WA 3PEGA 2NMBA 2EMTA 2P0HA 1V5UA 4Z2NA 3DXDA 2DA0A 3FEHA 2K2UA 1OQNA 5D27A 2D4QA 2GCLA 1AQCA 4IFSA 2YT0A 3SO6A 5C6RA 2K00A 3TW1A 4K17A 4A6KA 1UEFA 3ODWA 3QWMA 1MIZB 2LKOA 2RUKB 1Y19B 3SUZA 4L6EA 4YL8A 2Z0OA 3N7CA 1FGYA 4HB4B 2CODA 1H4RA 3OANA 1I7AA 3D8DA 4MY6A 1UNQA 3A8PA 4ZRIA 2LULA 4HHVA 3DXCA 1MIXA 2RVBB 2MWNB 2GJYA 1W1DA 1U5GA 4EJNA 1UPQA 5HE0A 4CYEA 1XODA 1K5DB 2YS3A 3PG7A 2UVMA 2P8VA 1BWNA 1RJ2A 2J0KA 1TQZA 2GCJA 3DXEA 2D9VA 2G35A 1ZVRA 2EMSA 4KHBB 3KY9A 2D9ZA 4NY0A 1WJ1A 3QIJA 4HB3B 1SGHA 1NTVA 2J59M 2N0YA 3GYOA 3NSUA 3ZVRA 2XQNM 2COCA 1W1HA 3RCPA 2KGXB 4F7HA 3P7ZA 4GN1A 1PFJA 3VOQA 5JLJB 1NU2A 5HE1A 1UNPA 3G9WA 3BINA 1FGZA 2DHIA 3F5RA 2OTXA 5JP4A 3SV1A 3A98B 3LJUX 2W2XD 4EMOA 5DH9B 1U2BA 2VRWB 1GG3A 4K2OA 3T06A 2LG1A 3TVVA 1KZ7A 5C5BB 3CXBB 1V89A 1NTYA 2ELBA 2ADZA 3PZDA 4DX8A 4DBBA 1KI1B 2YVCA 1N3HA 2H7EA 1XD4A 5LONB 1V5PA 2Z0QA 5DHAB 3CIKA 1AWEA 4ZRKA 2D2QA 1WJMA 4MT7A 1J0WA 3TCAA 2KCJA 4HB0B 1E5WA 4HAXB 1TXDA 3TFMA 4HAYB
chains in the Genus database with same CATH superfamily
2KUPA 1IRSA 4C0AA 2M14A 2QKLA 2I5CA 5GOWB 2IFSA 3PSCA 2W2WA 4GMXB 5DI9B 4P7IA 3WYFB 4HAUB 2RGNB 2V76A 3SYXA 4YONA 1U29A 1H10A 1J19A 1M7RA 5CLQB 2D9XA 4L1RA 2HTHB 2VKIA 1BAKA 5KQ4A 2K2JA 2YF0A 1B55A 1FOEA 1EVHA 4CHMA 2Z0PA 4GXBA 2L2IA 5C79A 5FI1A 4TYZA 4Z2MB 2H7DA 5D3VA 4HB2B 1MAIA 3GYPA 3PP2A 3UZTA 1PMSA 1T77A 1RRPB 4A6FB 4GZUA 4K2PA 4HAWB 4F7GA 4TKNA 3X23A 1W1GA 4GNKB 1QQGA 1EGXA 4BBKA 3HQCA 1DBHA 1U5DA 4DXAB 2DX5A 5J3TA 2MKRA 2RLOA 1QC6A 3KSYA 4WJ7A 1WGQA 1EAZA 1XKEA 4IOYX 3TO1A 4PNKA 2YS1A 1X1GA 1TJ6A 4A6HA 1ZC4B 3DCXA 1MI1A 2D11A 4K81A 4ZRJA 4KVGB 1X05A 3KZ1A 5C5BA 1V88A 2FJUB 3QBVB 5JHGA 2Y8FA 1BTNA 4D0NB 2CY4A 1Y5OA 2COFA 1WVHA 1V5MA 2P0DA 3NWFA 2R0DA 1NI2A 2YT2A 4H8SA 1DDWA 2D9WA 4DX90 5I2MA 5J3QA 1UNRA 1P5TA 2YT1A 2AL6A 2EJ8A 1FHXA 2DHJA 5LG4B 5HE3A 3ODOA 1X11A 2ZPYA 2COAA 1ZC3B 3HW2B 4XWXA 2GUMA 1WGUA 2EC1A 4B6HA 4NSWA 1LW3A 2LYDA 2DLWA 4HAVB 4HATB 1LB1A 2UZSA 3F0WA 3PVLA 4GMVA 3KRWA 1ZYIA 3M1IB 1Z87A 1DDMA 5LOPB 4Y94A 2Y8GA 5KCVA 2D10A 2VSZA 4F7UP 2QKMA 3B77A 1M7EA 5D3XA 1FB8A 1Q67A 2E2XA 3VIAA 1XR0B 3FM8C 1FAOA 1GC7A 1OY2A 2KIEA 3AU5A 5HE2A 4KHAA 2X18A 1FHWA 2P0FA 1X86A 3V5WA 3WA0A 4A6FA 3A8QA 1ISNA 3KRXA 1KZGA 4KHBA 2K49A 4D6WA 3U8ZA 1V61A 1UPRA 1U27A 2J0MA 3MPXA 1XCGA 2UZRA 2I5FA 5J3YA 2RNRB 3U7DA 2ROZB 1P6SA 1FHOA 4GPTB 3IVFA 4HSIA 1DDVA 1U5FA 1U5EA 2FJLA 2MDXA 2GS0A 1GC6A 2I1JA 4EKUA 4HAZB 2HE7A 2Q13A 3D8EA 1P3RA 2DTCA 1ZM0A 5D3YA 2KUQA 2YRYA 2LOZA 2ZKMX 2DYQA 2LOXA 3AU4A 5KQ1A 4HDQA 1OMWA 3MDBC 2NZ8B 3NW8A 5CLLB 1WG7A 4HDOA 2L1CA 2R09A 1WI1A 1DYNA 2D9YA 2CAYA 3PVUA 5DIFB 3BJIA 3PVWA 2DKQA 1MPHA 4KAXB 3ULCA 2RSGA 3AJ4A 2Z14A 2OQBA 5DHFB 3ZDTA 2MFQA 3ODXA 2ROVA 2IYBA 2PZ1A 1MK7B 3P6AA 1I2HA 2CRFA 3FSSA 4A5KA 1ZSQA 1EF1A 2Z4DA 4KHOA 5JHHA 3O96A 2DX1A 2YSZA 5C16A 1MKEA 1MK9B 4OSNA 4QXAB 2M38A 3HK0A 3HSAA 2BCJA 4IAPA 5EFXA 5L81A 2DKPA 2ELAA 1BTKA 4MK0A 4OT1A 2N23A 4QJ3B 2DHKA 2DFKA 1SHCA 3NWDA 2DYNA 2AEHA 2W2XC 2I1KA 3ML4A 2DN6A 4QJ5B 1XX0A 2YS5A 1PLSA 4QJ4B 1X1FA 2R2YA 4WVFB 2Y7BA 4WSFA 3ULBA 3SNHA 1K5GB 4PQ0A 5FI0A 4CHJA 4DIXA 1DROA 3D8FA 2CY5A 2J0JA 2JP2A 5D3WA 3PEGA 5I2SA 2NMBA 2EMTA 2P0HA 1V5UA 4Z2NA 3DXDA 2DA0A 3FEHA 2K2UA 1OQNA 5D27A 3OHMB 2D4QA 2GCLA 1AQCA 4IFSA 2YT0A 3SO6A 5C6RA 2K00A 3TW1A 4K17A 4A6KA 1UEFA 3ODWA 3U12A 3QWMA 1MIZB 3NWAA 2LKOA 2RUKB 1Y19B 3SUZA 4L6EA 4GOUA 4YL8A 2Z0OA 3N7CA 1FGYA 4HB4B 2CODA 1H4RA 3OANA 1I7AA 3D8DA 4MY6A 1UNQA 3A8PA 4ZRIA 2LULA 4HHVA 3DXCA 1MIXA 2RVBB 2MWNB 2GJYA 1W1DA 1U5GA 4EJNA 1UPQA 5HE0A 4CYEA 1XODA 1K5DB 2YS3A 3PG7A 2KR0A 2UVMA 2P8VA 1BWNA 1RJ2A 2J0KA 1TQZA 2GCJA 3DXEA 2D9VA 2G35A 1ZVRA 2EMSA 4KHBB 3KY9A 2D9ZA 4NY0A 1WJ1A 3QIJA 4HB3B 1SGHA 1NTVA 2J59M 2N0YA 3GYOA 3NSUA 3ZVRA 2XQNM 2COCA 1W1HA 5IRSA 3RCPA 2KGXB 4F7HA 3HIEA 3P7ZA 4GN1A 1PFJA 5M4YB 3VOQA 5JLJB 4CSQA 1NU2A 5HE1A 1UNPA 3G9WA 3BINA 2Z59A 1FGZA 2DHIA 3F5RA 2OTXA 5JP4A 3SV1A 3A98B 3LJUX 2W2XD 4EMOA 5DH9B 1U2BA 3FVCA 2VRWB 1GG3A 4K2OA 3T06A 2LG1A 3TVVA 1KZ7A 5C5BB 3CXBB 1V89A 3A58A 1NTYA 2ELBA 2ADZA 3PZDA 4DX8A 4DBBA 1KI1B 2YVCA 1N3HA 2H7EA 1XD4A 5LONB 1V5PA 2Z0QA 5DHAB 3CIKA 1AWEA 4ZRKA 2D2QA 1WJMA 4MT7A 1J0WA 3TCAA 2KCJA 4HB0B 2Z13A 2K8EA 2KIGA 2NBVA 1E5WA 2RRFA 4HAXB 1TXDA 3TFMA 4HAYB
chains in the Genus database with same CATH topology
2KUPA 1IRSA 4C0AA 2M14A 2QKLA 2I5CA 5GOWB 2IFSA 3PSCA 2W2WA 4GMXB 5DI9B 4P7IA 3WYFB 4HAUB 2RGNB 2V76A 3SYXA 4YONA 1U29A 1H10A 1J19A 1M7RA 5CLQB 2D9XA 2HTHB 2VKIA 1BAKA 5KQ4A 2K2JA 2YF0A 1B55A 1FOEA 1EVHA 4CHMA 2Z0PA 4GXBA 2L2IA 5C79A 5FI1A 4TYZA 4Z2MB 2H7DA 5D3VA 4HB2B 1MAIA 3GYPA 3PP2A 3UZTA 1PMSA 1RRPB 4A6FB 4GZUA 4K2PA 4HAWB 4F7GA 4TKNA 3X23A 1W1GA 1QQGA 1EGXA 4BBKA 3HQCA 1DBHA 1U5DA 4DXAB 2DX5A 5J3TA 2MKRA 2RLOA 1QC6A 3KSYA 4WJ7A 1WGQA 1EAZA 1XKEA 4IOYX 3TO1A 4PNKA 2YS1A 1X1GA 1TJ6A 4A6HA 1ZC4B 2D11A 4K81A 4ZRJA 4KVGB 1X05A 3KZ1A 5C5BA 1V88A 3QBVB 5JHGA 2Y8FA 1BTNA 4D0NB 2CY4A 1Y5OA 2COFA 1WVHA 1V5MA 2P0DA 2R0DA 1NI2A 4H8SA 1DDWA 2D9WA 4DX90 5J3QA 1UNRA 1P5TA 2YT1A 2AL6A 2EJ8A 1FHXA 2DHJA 5HE3A 3ODOA 1X11A 2ZPYA 2COAA 1ZC3B 3HW2B 4XWXA 1WGUA 2EC1A 4B6HA 4NSWA 1LW3A 2LYDA 2DLWA 4HAVB 4HATB 1LB1A 2UZSA 3F0WA 3PVLA 4GMVA 3KRWA 3M1IB 1Z87A 1DDMA 5LOPB 4Y94A 2Y8GA 5KCVA 2D10A 2VSZA 4F7UP 2QKMA 1M7EA 5D3XA 1FB8A 1Q67A 2E2XA 3VIAA 1XR0B 3FM8C 1FAOA 1GC7A 1OY2A 3AU5A 5HE2A 4KHAA 2X18A 1FHWA 2P0FA 1X86A 3V5WA 3WA0A 4A6FA 3A8QA 1ISNA 3KRXA 1KZGA 3U8ZA 1V61A 1UPRA 1U27A 3MPXA 2J0MA 1XCGA 2UZRA 2I5FA 5J3YA 2RNRB 3U7DA 2ROZB 1P6SA 1FHOA 4GPTB 3IVFA 1DDVA 1U5FA 1U5EA 2FJLA 2MDXA 2GS0A 1GC6A 2I1JA 4EKUA 4HAZB 2HE7A 2Q13A 3D8EA 1P3RA 2DTCA 1ZM0A 5D3YA 2YRYA 2LOZA 2DYQA 2LOXA 3AU4A 5KQ1A 4HDQA 1OMWA 3MDBC 2NZ8B 5CLLB 1WG7A 4HDOA 2L1CA 2R09A 1WI1A 1DYNA 2D9YA 2CAYA 3PVUA 5DIFB 3BJIA 3PVWA 2DKQA 1MPHA 4KAXB 3ULCA 2RSGA 3AJ4A 2OQBA 5DHFB 3ZDTA 2MFQA 3ODXA 2ROVA 2IYBA 2PZ1A 1MK7B 3P6AA 1I2HA 2CRFA 3FSSA 4A5KA 1ZSQA 1EF1A 4KHOA 5JHHA 3O96A 2DX1A 2YSZA 5C16A 1MKEA 1MK9B 2M38A 3HK0A 2BCJA 4IAPA 5EFXA 5L81A 2DKPA 2ELAA 1BTKA 4MK0A 2N23A 2DHKA 2DFKA 1SHCA 2DYNA 2AEHA 2W2XC 2I1KA 3ML4A 2DN6A 1XX0A 2YS5A 1PLSA 1X1FA 4WVFB 2Y7BA 4WSFA 3ULBA 3SNHA 1K5GB 4PQ0A 5FI0A 4CHJA 1DROA 3D8FA 2CY5A 2J0JA 2JP2A 5D3WA 3PEGA 2NMBA 2EMTA 2P0HA 1V5UA 4Z2NA 3DXDA 2DA0A 3FEHA 2K2UA 1OQNA 5D27A 2D4QA 2GCLA 1AQCA 4IFSA 2YT0A 3SO6A 5C6RA 2K00A 3TW1A 4K17A 4A6KA 1UEFA 3ODWA 3QWMA 1MIZB 2LKOA 2RUKB 1Y19B 3SUZA 4L6EA 4YL8A 2Z0OA 3N7CA 1FGYA 4HB4B 2CODA 1H4RA 3OANA 1I7AA 3D8DA 4MY6A 1UNQA 3A8PA 4ZRIA 2LULA 4HHVA 3DXCA 1MIXA 2RVBB 2MWNB 2GJYA 1W1DA 1U5GA 4EJNA 1UPQA 5HE0A 4CYEA 1XODA 1K5DB 2YS3A 3PG7A 2UVMA 2P8VA 1BWNA 1RJ2A 2J0KA 1TQZA 2GCJA 3DXEA 2D9VA 2G35A 1ZVRA 2EMSA 4KHBB 3KY9A 2D9ZA 4NY0A 1WJ1A 3QIJA 4HB3B 1SGHA 1NTVA 2J59M 2N0YA 3GYOA 3NSUA 3ZVRA 2XQNM 2COCA 1W1HA 3RCPA 2KGXB 4F7HA 3P7ZA 4GN1A 1PFJA 3VOQA 5JLJB 1NU2A 5HE1A 1UNPA 3G9WA 3BINA 1FGZA 2DHIA 3F5RA 2OTXA 5JP4A 3SV1A 3A98B 3LJUX 2W2XD 4EMOA 5DH9B 1U2BA 2VRWB 1GG3A 4K2OA 3T06A 2LG1A 3TVVA 1KZ7A 5C5BB 3CXBB 1V89A 1NTYA 2ELBA 2ADZA 3PZDA 4DX8A 4DBBA 1KI1B 2YVCA 1N3HA 2H7EA 1XD4A 5LONB 1V5PA 2Z0QA 5DHAB 3CIKA 1AWEA 4ZRKA 2D2QA 1WJMA 4MT7A 1J0WA 3TCAA 2KCJA 4HB0B 1E5WA 4HAXB 1TXDA 3TFMA 4HAYB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KUP A;  1IRS A;  4C0A A;  2M14 A;  2QKL A;  2I5C A;  5GOW B;  2IFS A;  3PSC A;  2W2W A;  4GMX B;  5DI9 B;  4P7I A;  3WYF B;  4HAU B;  2RGN B;  2V76 A;  3SYX A;  4YON A;  1U29 A;  1H10 A;  1J19 A;  1M7R A;  5CLQ B;  2D9X A;  2HTH B;  2VKI A;  1BAK A;  5KQ4 A;  2K2J A;  2YF0 A;  1B55 A;  1FOE A;  1EVH A;  4CHM A;  2Z0P A;  4GXB A;  2L2I A;  5C79 A;  5FI1 A;  4TYZ A;  4Z2M B;  2H7D A;  5D3V A;  4HB2 B;  1MAI A;  3GYP A;  3PP2 A;  3UZT A;  1PMS A;  1RRP B;  4A6F B;  4GZU A;  4K2P A;  4HAW B;  4F7G A;  4TKN A;  3X23 A;  1W1G A;  1QQG A;  1EGX A;  4BBK A;  3HQC A;  1DBH A;  1U5D A;  4DXA B;  2DX5 A;  5J3T A;  2MKR A;  2RLO A;  1QC6 A;  3KSY A;  4WJ7 A;  1WGQ A;  1EAZ A;  1XKE A;  4IOY X;  3TO1 A;  4PNK A;  2YS1 A;  1X1G A;  1TJ6 A;  4A6H A;  1ZC4 B;  2D11 A;  4K81 A;  4ZRJ A;  4KVG B;  1X05 A;  3KZ1 A;  5C5B A;  1V88 A;  3QBV B;  5JHG A;  2Y8F A;  1BTN A;  4D0N B;  2CY4 A;  1Y5O A;  2COF A;  1WVH A;  1V5M A;  2P0D A;  2R0D A;  1NI2 A;  4H8S A;  1DDW A;  2D9W A;  4DX9 0;  5J3Q A;  1UNR A;  1P5T A;  2YT1 A;  2AL6 A;  2EJ8 A;  1FHX A;  2DHJ A;  5HE3 A;  3ODO A;  1X11 A;  2ZPY A;  2COA A;  1ZC3 B;  3HW2 B;  4XWX A;  1WGU A;  2EC1 A;  4B6H A;  4NSW A;  1LW3 A;  2LYD A;  2DLW A;  4HAV B;  4HAT B;  1LB1 A;  2UZS A;  3F0W A;  3PVL A;  4GMV A;  3KRW A;  3M1I B;  1Z87 A;  1DDM A;  5LOP B;  4Y94 A;  2Y8G A;  5KCV A;  2D10 A;  2VSZ A;  4F7U P;  2QKM A;  1M7E A;  5D3X A;  1FB8 A;  1Q67 A;  2E2X A;  3VIA A;  1XR0 B;  3FM8 C;  1FAO A;  1GC7 A;  1OY2 A;  3AU5 A;  5HE2 A;  4KHA A;  2X18 A;  1FHW A;  2P0F A;  1X86 A;  3V5W A;  3WA0 A;  4A6F A;  3A8Q A;  1ISN A;  3KRX A;  1KZG A;  3U8Z A;  1V61 A;  1UPR A;  1U27 A;  3MPX A;  2J0M A;  1XCG A;  2UZR A;  2I5F A;  5J3Y A;  2RNR B;  3U7D A;  2ROZ B;  1P6S A;  1FHO A;  4GPT B;  3IVF A;  1DDV A;  1U5F A;  1U5E A;  2FJL A;  2MDX A;  2GS0 A;  1GC6 A;  2I1J A;  4EKU A;  4HAZ B;  2HE7 A;  2Q13 A;  3D8E A;  1P3R A;  2DTC A;  1ZM0 A;  5D3Y A;  2YRY A;  2LOZ A;  2DYQ A;  2LOX A;  3AU4 A;  5KQ1 A;  4HDQ A;  1OMW A;  3MDB C;  2NZ8 B;  5CLL B;  1WG7 A;  4HDO A;  2L1C A;  2R09 A;  1WI1 A;  1DYN A;  2D9Y A;  2CAY A;  3PVU A;  5DIF B;  3BJI A;  3PVW A;  2DKQ A;  1MPH A;  4KAX B;  3ULC A;  2RSG A;  3AJ4 A;  2OQB A;  5DHF B;  3ZDT A;  2MFQ A;  3ODX A;  2ROV A;  2IYB A;  2PZ1 A;  1MK7 B;  3P6A A;  1I2H A;  2CRF A;  3FSS A;  4A5K A;  1ZSQ A;  1EF1 A;  4KHO A;  5JHH A;  3O96 A;  2DX1 A;  2YSZ A;  5C16 A;  1MKE A;  1MK9 B;  2M38 A;  3HK0 A;  2BCJ A;  4IAP A;  5EFX A;  5L81 A;  2DKP A;  2ELA A;  1BTK A;  4MK0 A;  2N23 A;  2DHK A;  2DFK A;  1SHC A;  2DYN A;  2AEH A;  2W2X C;  2I1K A;  3ML4 A;  2DN6 A;  1XX0 A;  2YS5 A;  1PLS A;  1X1F A;  4WVF B;  2Y7B A;  4WSF A;  3ULB A;  3SNH A;  1K5G B;  4PQ0 A;  5FI0 A;  4CHJ A;  1DRO A;  3D8F A;  2CY5 A;  2J0J A;  2JP2 A;  5D3W A;  3PEG A;  2NMB A;  2EMT A;  2P0H A;  1V5U A;  4Z2N A;  3DXD A;  2DA0 A;  3FEH A;  2K2U A;  1OQN A;  5D27 A;  2D4Q A;  2GCL A;  1AQC A;  4IFS A;  2YT0 A;  3SO6 A;  5C6R A;  2K00 A;  3TW1 A;  4K17 A;  4A6K A;  1UEF A;  3ODW A;  3QWM A;  1MIZ B;  2LKO A;  2RUK B;  1Y19 B;  3SUZ A;  4L6E A;  4YL8 A;  2Z0O A;  3N7C A;  1FGY A;  4HB4 B;  2COD A;  1H4R A;  3OAN A;  1I7A A;  3D8D A;  4MY6 A;  1UNQ A;  3A8P A;  4ZRI A;  2LUL A;  4HHV A;  3DXC A;  1MIX A;  2RVB B;  2MWN B;  2GJY A;  1W1D A;  1U5G A;  4EJN A;  1UPQ A;  5HE0 A;  4CYE A;  1XOD A;  1K5D B;  2YS3 A;  3PG7 A;  2UVM A;  2P8V A;  1BWN A;  1RJ2 A;  2J0K A;  1TQZ A;  2GCJ A;  3DXE A;  2D9V A;  2G35 A;  1ZVR A;  2EMS A;  4KHB B;  3KY9 A;  2D9Z A;  4NY0 A;  1WJ1 A;  3QIJ A;  4HB3 B;  1SGH A;  1NTV A;  2J59 M;  2N0Y A;  3GYO A;  3NSU A;  3ZVR A;  2XQN M;  2COC A;  1W1H A;  3RCP A;  2KGX B;  4F7H A;  3P7Z A;  4GN1 A;  1PFJ A;  3VOQ A;  5JLJ B;  1NU2 A;  5HE1 A;  1UNP A;  3G9W A;  3BIN A;  1FGZ A;  2DHI A;  3F5R A;  2OTX A;  5JP4 A;  3SV1 A;  3A98 B;  3LJU X;  2W2X D;  4EMO A;  5DH9 B;  1U2B A;  2VRW B;  1GG3 A;  4K2O A;  3T06 A;  2LG1 A;  3TVV A;  1KZ7 A;  5C5B B;  3CXB B;  1V89 A;  1NTY A;  2ELB A;  2ADZ A;  3PZD A;  4DX8 A;  4DBB A;  1KI1 B;  2YVC A;  1N3H A;  2H7E A;  1XD4 A;  5LON B;  1V5P A;  2Z0Q A;  5DHA B;  3CIK A;  1AWE A;  4ZRK A;  2D2Q A;  1WJM A;  4MT7 A;  1J0W A;  3TCA A;  2KCJ A;  4HB0 B;  1E5W A;  4HAX B;  1TXD A;  3TFM A;  4HAY B; 
#chains in the Genus database with same CATH topology
 2KUP A;  1IRS A;  4C0A A;  2M14 A;  2QKL A;  2I5C A;  5GOW B;  2IFS A;  3PSC A;  2W2W A;  4GMX B;  5DI9 B;  4P7I A;  3WYF B;  4HAU B;  2RGN B;  2V76 A;  3SYX A;  4YON A;  1U29 A;  1H10 A;  1J19 A;  1M7R A;  5CLQ B;  2D9X A;  4L1R A;  2HTH B;  2VKI A;  1BAK A;  5KQ4 A;  2K2J A;  2YF0 A;  1B55 A;  1FOE A;  1EVH A;  4CHM A;  2Z0P A;  4GXB A;  2L2I A;  5C79 A;  5FI1 A;  4TYZ A;  4Z2M B;  2H7D A;  5D3V A;  4HB2 B;  1MAI A;  3GYP A;  3PP2 A;  3UZT A;  1PMS A;  1T77 A;  1RRP B;  4A6F B;  4GZU A;  4K2P A;  4HAW B;  4F7G A;  4TKN A;  3X23 A;  1W1G A;  4GNK B;  1QQG A;  1EGX A;  4BBK A;  3HQC A;  1DBH A;  1U5D A;  4DXA B;  2DX5 A;  5J3T A;  2MKR A;  2RLO A;  1QC6 A;  3KSY A;  4WJ7 A;  1WGQ A;  1EAZ A;  1XKE A;  4IOY X;  3TO1 A;  4PNK A;  2YS1 A;  1X1G A;  1TJ6 A;  4A6H A;  1ZC4 B;  3DCX A;  1MI1 A;  2D11 A;  4K81 A;  4ZRJ A;  4KVG B;  1X05 A;  3KZ1 A;  5C5B A;  1V88 A;  2FJU B;  3QBV B;  5JHG A;  2Y8F A;  1BTN A;  4D0N B;  2CY4 A;  1Y5O A;  2COF A;  1WVH A;  1V5M A;  2P0D A;  3NWF A;  2R0D A;  1NI2 A;  2YT2 A;  4H8S A;  1DDW A;  2D9W A;  4DX9 0;  5I2M A;  5J3Q A;  1UNR A;  1P5T A;  2YT1 A;  2AL6 A;  2EJ8 A;  1FHX A;  2DHJ A;  5LG4 B;  5HE3 A;  3ODO A;  1X11 A;  2ZPY A;  2COA A;  1ZC3 B;  3HW2 B;  4XWX A;  2GUM A;  1WGU A;  2EC1 A;  4B6H A;  4NSW A;  1LW3 A;  2LYD A;  2DLW A;  4HAV B;  4HAT B;  1LB1 A;  2UZS A;  3F0W A;  3PVL A;  4GMV A;  3KRW A;  1ZYI A;  3M1I B;  1Z87 A;  1DDM A;  5LOP B;  4Y94 A;  2Y8G A;  5KCV A;  2D10 A;  2VSZ A;  4F7U P;  2QKM A;  3B77 A;  1M7E A;  5D3X A;  1FB8 A;  1Q67 A;  2E2X A;  3VIA A;  1XR0 B;  3FM8 C;  1FAO A;  1GC7 A;  1OY2 A;  2KIE A;  3AU5 A;  5HE2 A;  4KHA A;  2X18 A;  1FHW A;  2P0F A;  1X86 A;  3V5W A;  3WA0 A;  4A6F A;  3A8Q A;  1ISN A;  3KRX A;  1KZG A;  4KHB A;  2K49 A;  4D6W A;  3U8Z A;  1V61 A;  1UPR A;  1U27 A;  2J0M A;  3MPX A;  1XCG A;  2UZR A;  2I5F A;  5J3Y A;  2RNR B;  3U7D A;  2ROZ B;  1P6S A;  1FHO A;  4GPT B;  3IVF A;  4HSI A;  1DDV A;  1U5F A;  1U5E A;  2FJL A;  2MDX A;  2GS0 A;  1GC6 A;  2I1J A;  4EKU A;  4HAZ B;  2HE7 A;  2Q13 A;  3D8E A;  1P3R A;  2DTC A;  1ZM0 A;  5D3Y A;  2KUQ A;  2YRY A;  2LOZ A;  2ZKM X;  2DYQ A;  2LOX A;  3AU4 A;  5KQ1 A;  4HDQ A;  1OMW A;  3MDB C;  2NZ8 B;  3NW8 A;  5CLL B;  1WG7 A;  4HDO A;  2L1C A;  2R09 A;  1WI1 A;  1DYN A;  2D9Y A;  2CAY A;  3PVU A;  5DIF B;  3BJI A;  3PVW A;  2DKQ A;  1MPH A;  4KAX B;  3ULC A;  2RSG A;  3AJ4 A;  2Z14 A;  2OQB A;  5DHF B;  3ZDT A;  2MFQ A;  3ODX A;  2ROV A;  2IYB A;  2PZ1 A;  1MK7 B;  3P6A A;  1I2H A;  2CRF A;  3FSS A;  4A5K A;  1ZSQ A;  1EF1 A;  2Z4D A;  4KHO A;  5JHH A;  3O96 A;  2DX1 A;  2YSZ A;  5C16 A;  1MKE A;  1MK9 B;  4OSN A;  4QXA B;  2M38 A;  3HK0 A;  3HSA A;  2BCJ A;  4IAP A;  5EFX A;  5L81 A;  2DKP A;  2ELA A;  1BTK A;  4MK0 A;  4OT1 A;  2N23 A;  4QJ3 B;  2DHK A;  2DFK A;  1SHC A;  3NWD A;  2DYN A;  2AEH A;  2W2X C;  2I1K A;  3ML4 A;  2DN6 A;  4QJ5 B;  1XX0 A;  2YS5 A;  1PLS A;  4QJ4 B;  1X1F A;  2R2Y A;  4WVF B;  2Y7B A;  4WSF A;  3ULB A;  3SNH A;  1K5G B;  4PQ0 A;  5FI0 A;  4CHJ A;  4DIX A;  1DRO A;  3D8F A;  2CY5 A;  2J0J A;  2JP2 A;  5D3W A;  3PEG A;  5I2S A;  2NMB A;  2EMT A;  2P0H A;  1V5U A;  4Z2N A;  3DXD A;  2DA0 A;  3FEH A;  2K2U A;  1OQN A;  5D27 A;  3OHM B;  2D4Q A;  2GCL A;  1AQC A;  4IFS A;  2YT0 A;  3SO6 A;  5C6R A;  2K00 A;  3TW1 A;  4K17 A;  4A6K A;  1UEF A;  3ODW A;  3U12 A;  3QWM A;  1MIZ B;  3NWA A;  2LKO A;  2RUK B;  1Y19 B;  3SUZ A;  4L6E A;  4GOU A;  4YL8 A;  2Z0O A;  3N7C A;  1FGY A;  4HB4 B;  2COD A;  1H4R A;  3OAN A;  1I7A A;  3D8D A;  4MY6 A;  1UNQ A;  3A8P A;  4ZRI A;  2LUL A;  4HHV A;  3DXC A;  1MIX A;  2RVB B;  2MWN B;  2GJY A;  1W1D A;  1U5G A;  4EJN A;  1UPQ A;  5HE0 A;  4CYE A;  1XOD A;  1K5D B;  2YS3 A;  3PG7 A;  2KR0 A;  2UVM A;  2P8V A;  1BWN A;  1RJ2 A;  2J0K A;  1TQZ A;  2GCJ A;  3DXE A;  2D9V A;  2G35 A;  1ZVR A;  2EMS A;  4KHB B;  3KY9 A;  2D9Z A;  4NY0 A;  1WJ1 A;  3QIJ A;  4HB3 B;  1SGH A;  1NTV A;  2J59 M;  2N0Y A;  3GYO A;  3NSU A;  3ZVR A;  2XQN M;  2COC A;  1W1H A;  5IRS A;  3RCP A;  2KGX B;  4F7H A;  3HIE A;  3P7Z A;  4GN1 A;  1PFJ A;  5M4Y B;  3VOQ A;  5JLJ B;  4CSQ A;  1NU2 A;  5HE1 A;  1UNP A;  3G9W A;  3BIN A;  2Z59 A;  1FGZ A;  2DHI A;  3F5R A;  2OTX A;  5JP4 A;  3SV1 A;  3A98 B;  3LJU X;  2W2X D;  4EMO A;  5DH9 B;  1U2B A;  3FVC A;  2VRW B;  1GG3 A;  4K2O A;  3T06 A;  2LG1 A;  3TVV A;  1KZ7 A;  5C5B B;  3CXB B;  1V89 A;  3A58 A;  1NTY A;  2ELB A;  2ADZ A;  3PZD A;  4DX8 A;  4DBB A;  1KI1 B;  2YVC A;  1N3H A;  2H7E A;  1XD4 A;  5LON B;  1V5P A;  2Z0Q A;  5DHA B;  3CIK A;  1AWE A;  4ZRK A;  2D2Q A;  1WJM A;  4MT7 A;  1J0W A;  3TCA A;  2KCJ A;  4HB0 B;  2Z13 A;  2K8E A;  2KIG A;  2NBV A;  1E5W A;  2RRF A;  4HAX B;  1TXD A;  3TFM A;  4HAY B; 
#chains in the Genus database with same CATH homology
 2KUP A;  1IRS A;  4C0A A;  2M14 A;  2QKL A;  2I5C A;  5GOW B;  2IFS A;  3PSC A;  2W2W A;  4GMX B;  5DI9 B;  4P7I A;  3WYF B;  4HAU B;  2RGN B;  2V76 A;  3SYX A;  4YON A;  1U29 A;  1H10 A;  1J19 A;  1M7R A;  5CLQ B;  2D9X A;  2HTH B;  2VKI A;  1BAK A;  5KQ4 A;  2K2J A;  2YF0 A;  1B55 A;  1FOE A;  1EVH A;  4CHM A;  2Z0P A;  4GXB A;  2L2I A;  5C79 A;  5FI1 A;  4TYZ A;  4Z2M B;  2H7D A;  5D3V A;  4HB2 B;  1MAI A;  3GYP A;  3PP2 A;  3UZT A;  1PMS A;  1RRP B;  4A6F B;  4GZU A;  4K2P A;  4HAW B;  4F7G A;  4TKN A;  3X23 A;  1W1G A;  1QQG A;  1EGX A;  4BBK A;  3HQC A;  1DBH A;  1U5D A;  4DXA B;  2DX5 A;  5J3T A;  2MKR A;  2RLO A;  1QC6 A;  3KSY A;  4WJ7 A;  1WGQ A;  1EAZ A;  1XKE A;  4IOY X;  3TO1 A;  4PNK A;  2YS1 A;  1X1G A;  1TJ6 A;  4A6H A;  1ZC4 B;  2D11 A;  4K81 A;  4ZRJ A;  4KVG B;  1X05 A;  3KZ1 A;  5C5B A;  1V88 A;  3QBV B;  5JHG A;  2Y8F A;  1BTN A;  4D0N B;  2CY4 A;  1Y5O A;  2COF A;  1WVH A;  1V5M A;  2P0D A;  2R0D A;  1NI2 A;  4H8S A;  1DDW A;  2D9W A;  4DX9 0;  5J3Q A;  1UNR A;  1P5T A;  2YT1 A;  2AL6 A;  2EJ8 A;  1FHX A;  2DHJ A;  5HE3 A;  3ODO A;  1X11 A;  2ZPY A;  2COA A;  1ZC3 B;  3HW2 B;  4XWX A;  1WGU A;  2EC1 A;  4B6H A;  4NSW A;  1LW3 A;  2LYD A;  2DLW A;  4HAV B;  4HAT B;  1LB1 A;  2UZS A;  3F0W A;  3PVL A;  4GMV A;  3KRW A;  3M1I B;  1Z87 A;  1DDM A;  5LOP B;  4Y94 A;  2Y8G A;  5KCV A;  2D10 A;  2VSZ A;  4F7U P;  2QKM A;  1M7E A;  5D3X A;  1FB8 A;  1Q67 A;  2E2X A;  3VIA A;  1XR0 B;  3FM8 C;  1FAO A;  1GC7 A;  1OY2 A;  3AU5 A;  5HE2 A;  4KHA A;  2X18 A;  1FHW A;  2P0F A;  1X86 A;  3V5W A;  3WA0 A;  4A6F A;  3A8Q A;  1ISN A;  3KRX A;  1KZG A;  3U8Z A;  1V61 A;  1UPR A;  1U27 A;  3MPX A;  2J0M A;  1XCG A;  2UZR A;  2I5F A;  5J3Y A;  2RNR B;  3U7D A;  2ROZ B;  1P6S A;  1FHO A;  4GPT B;  3IVF A;  1DDV A;  1U5F A;  1U5E A;  2FJL A;  2MDX A;  2GS0 A;  1GC6 A;  2I1J A;  4EKU A;  4HAZ B;  2HE7 A;  2Q13 A;  3D8E A;  1P3R A;  2DTC A;  1ZM0 A;  5D3Y A;  2YRY A;  2LOZ A;  2DYQ A;  2LOX A;  3AU4 A;  5KQ1 A;  4HDQ A;  1OMW A;  3MDB C;  2NZ8 B;  5CLL B;  1WG7 A;  4HDO A;  2L1C A;  2R09 A;  1WI1 A;  1DYN A;  2D9Y A;  2CAY A;  3PVU A;  5DIF B;  3BJI A;  3PVW A;  2DKQ A;  1MPH A;  4KAX B;  3ULC A;  2RSG A;  3AJ4 A;  2OQB A;  5DHF B;  3ZDT A;  2MFQ A;  3ODX A;  2ROV A;  2IYB A;  2PZ1 A;  1MK7 B;  3P6A A;  1I2H A;  2CRF A;  3FSS A;  4A5K A;  1ZSQ A;  1EF1 A;  4KHO A;  5JHH A;  3O96 A;  2DX1 A;  2YSZ A;  5C16 A;  1MKE A;  1MK9 B;  2M38 A;  3HK0 A;  2BCJ A;  4IAP A;  5EFX A;  5L81 A;  2DKP A;  2ELA A;  1BTK A;  4MK0 A;  2N23 A;  2DHK A;  2DFK A;  1SHC A;  2DYN A;  2AEH A;  2W2X C;  2I1K A;  3ML4 A;  2DN6 A;  1XX0 A;  2YS5 A;  1PLS A;  1X1F A;  4WVF B;  2Y7B A;  4WSF A;  3ULB A;  3SNH A;  1K5G B;  4PQ0 A;  5FI0 A;  4CHJ A;  1DRO A;  3D8F A;  2CY5 A;  2J0J A;  2JP2 A;  5D3W A;  3PEG A;  2NMB A;  2EMT A;  2P0H A;  1V5U A;  4Z2N A;  3DXD A;  2DA0 A;  3FEH A;  2K2U A;  1OQN A;  5D27 A;  2D4Q A;  2GCL A;  1AQC A;  4IFS A;  2YT0 A;  3SO6 A;  5C6R A;  2K00 A;  3TW1 A;  4K17 A;  4A6K A;  1UEF A;  3ODW A;  3QWM A;  1MIZ B;  2LKO A;  2RUK B;  1Y19 B;  3SUZ A;  4L6E A;  4YL8 A;  2Z0O A;  3N7C A;  1FGY A;  4HB4 B;  2COD A;  1H4R A;  3OAN A;  1I7A A;  3D8D A;  4MY6 A;  1UNQ A;  3A8P A;  4ZRI A;  2LUL A;  4HHV A;  3DXC A;  1MIX A;  2RVB B;  2MWN B;  2GJY A;  1W1D A;  1U5G A;  4EJN A;  1UPQ A;  5HE0 A;  4CYE A;  1XOD A;  1K5D B;  2YS3 A;  3PG7 A;  2UVM A;  2P8V A;  1BWN A;  1RJ2 A;  2J0K A;  1TQZ A;  2GCJ A;  3DXE A;  2D9V A;  2G35 A;  1ZVR A;  2EMS A;  4KHB B;  3KY9 A;  2D9Z A;  4NY0 A;  1WJ1 A;  3QIJ A;  4HB3 B;  1SGH A;  1NTV A;  2J59 M;  2N0Y A;  3GYO A;  3NSU A;  3ZVR A;  2XQN M;  2COC A;  1W1H A;  3RCP A;  2KGX B;  4F7H A;  3P7Z A;  4GN1 A;  1PFJ A;  3VOQ A;  5JLJ B;  1NU2 A;  5HE1 A;  1UNP A;  3G9W A;  3BIN A;  1FGZ A;  2DHI A;  3F5R A;  2OTX A;  5JP4 A;  3SV1 A;  3A98 B;  3LJU X;  2W2X D;  4EMO A;  5DH9 B;  1U2B A;  2VRW B;  1GG3 A;  4K2O A;  3T06 A;  2LG1 A;  3TVV A;  1KZ7 A;  5C5B B;  3CXB B;  1V89 A;  1NTY A;  2ELB A;  2ADZ A;  3PZD A;  4DX8 A;  4DBB A;  1KI1 B;  2YVC A;  1N3H A;  2H7E A;  1XD4 A;  5LON B;  1V5P A;  2Z0Q A;  5DHA B;  3CIK A;  1AWE A;  4ZRK A;  2D2Q A;  1WJM A;  4MT7 A;  1J0W A;  3TCA A;  2KCJ A;  4HB0 B;  1E5W A;  4HAX B;  1TXD A;  3TFM A;  4HAY B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...