3SV1A

Crystal structure of app peptide bound rat mint2 parm
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
190
structure length
163
Chain Sequence
GSEDLIDGIIFAANYLGSTQLLSERNPSKNIRMMQAQEAVSRVKRMQKAAKIKKKANQTLTEVDLFISTQRIKVLNADTQETMMDHALRTISYIADIGNIVVLMARRRYKMICHVFESEDAQLIAQSIGQAFSVAYQEFLRANGINPEDLSQKEYSDIINTQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Protein binding
molecule keywords Amyloid beta A4 precursor protein-binding family A member 2
publication title Open-closed motion of Mint2 regulates APP metabolism
pubmed doi rcsb
source organism Rattus norvegicus
total genus 40
structure length 163
sequence length 190
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2011-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00640 PID Phosphotyrosine interaction domain (PTB/PID)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3sv1A00
3GYPA 1AQCA 2D11A 3CXBB 3OANA 4MK0A 1PFJA 2LULA 2ROVA 1XD4A 3UZTA 3PZDA 2P0FA 2RUKB 3D8EA 1LW3A 2D9YA 2P0HA 2COAA 1U5GA 5L81A 4B6HA 3AJ4A 2W2XD 3LJUX 2ROZB 3DXCA 2G35A 1MK7B 3FEHA 4ZRKA 2D9ZA 2DN6A 3SNHA 3G9WA 1K5GB 2MWNB 2PZ1A 1Y5OA 2LKOA 3M1IB 2IYBA 1SGHA 1FAOA 5D3VA 1Y19B 1KZGA 1ZC4B 2YSZA 3PP2A 4HB3B 1BWNA 1V5UA 3TCAA 2Q13A 3ZVRA 3SO6A 3D8DA 4GN1A 3T06A 5C6RA 2Y7BA 1W1DA 1MK9B 4HB4B 3P6AA 1DROA 2YS1A 5HE1A 4A6KA 2DX5A 4GMVA 1ZVRA 4CHMA 3MDBC 1MPHA 1V5PA 4ZRIA 2KGXB 1SHCA 3AU5A 3TVVA 1WJMA 5FI0A 1U5FA 1J0WA 2M14A 1U27A 1PLSA 1EF1A 3F5RA 4EMOA 2X18A 5CLLB 3A8PA 2YVCA 1BAKA 1GG3A 2COFA 1U2BA 1EGXA 4ZRJA 2DKQA 3HK0A 5D3WA 1UNQA 4K2PA 1RJ2A 4IOYX 4A6FA 5DHAB 1P3RA 2CY4A 1X1FA 2RNRB 2I5CA 4TYZA 2ELBA 5J3QA 1U29A 4K17A 1FB8A 1V88A 2DYQA 4YL8A 4MY6A 4A6FB 2MFQA 4HAVB 4KVGB 1EAZA 1FGZA 2DYNA 4K2OA 5J3TA 2J0JA 2N23A 1QC6A 2DTCA 1B55A 1OQNA 3DXEA 2I1KA 3MPXA 5JHHA 2VSZA 4P7IA 1M7RA 4PQ0A 2DX1A 3HW2B 3SYXA 4F7UP 1FHOA 2DLWA 2OTXA 2LG1A 2YS3A 5LONB 2QKMA 1H4RA 2D4QA 3U7DA 5C16A 5C5BA 2Y8FA 1OY2A 2GCLA 1TQZA 4GXBA 3QWMA 2DKPA 2DHJA 1W1GA 4C0AA 4Y94A 3TW1A 1QQGA 4WVFB 2RSGA 2RVBB 3IVFA 5J3YA 4A5KA 5HE3A 3KRWA 4HAUB 1ZSQA 2R0DA 4F7GA 3KY9A 5HE2A 1AWEA 4GZUA 2H7DA 2W2XC 1MKEA 1UNRA 1I2HA 2M38A 1BTNA 2K2JA 1GC7A 5D3XA 2KCJA 1GC6A 4IAPA 2JP2A 2H7EA 1V5MA 5KCVA 3ODOA 1IRSA 2ADZA 1TXDA 1DDVA 3BJIA 2J0KA 1ZC3B 1WVHA 4NSWA 3KZ1A 2HE7A 3QIJA 4TKNA 5DIFB 2IFSA 1Z87A 1X11A 2RGNB 2D9VA 3DXDA 4KAXB 3AU4A 4KHOA 3ML4A 4HAYB 4YONA 1PMSA 4GMXB 2NZ8B 2CRFA 5LOPB 1NI2A 5DI9B 3PVLA 4XWXA 3VOQA 1P6SA 4DXAB 2OQBA 2UZRA 2MKRA 2COCA 1XKEA 2I1JA 2DA0A 2LOZA 2P0DA 2D10A 4BBKA 1DBHA 4HATB 3A98B 2R09A 4HB0B 1U5EA 2DHKA 1FHXA 5EFXA 1Q67A 2P8VA 3WYFB 2GCJA 4L6EA 2BCJA 4HDQA 1UPRA 5C79A 4Z2MB 4HAWB 3SV1A 1W1HA 2YF0A 2GJYA 3SUZA 2D9WA 2UVMA 2J59M 3O96A 4EJNA 3TFMA 3BINA 3PSCA 2CY5A 1ISNA 2RLOA 3N7CA 3PG7A 4IFSA 1UPQA 3TO1A 4HAZB 1XX0A 3ODXA 1DYNA 4H8SA 3ULCA 2Z0QA 3A8QA 2N0YA 2KUPA 4DBBA 3ULBA 2XQNM 3GYOA 1FHWA 1WGQA 1XODA 1WG7A 1DDWA 3RCPA 2Y8GA 1NU2A 1M7EA 4NY0A 5C5BB 2EMTA 2Z0PA 1BTKA 1V61A 3D8FA 4DX90 1MIXA 2DFKA 5DH9B 1RRPB 1NTYA 5FI1A 5KQ1A 1WGUA 2D2QA 1X1GA 2YT0A 4K81A 1P5TA 1XCGA 1FOEA 2Z0OA 1TJ6A 1X86A 2D9XA 2VRWB 3KSYA 2EMSA 3PEGA 2YRYA 2V76A 5KQ4A 4HAXB 2K2UA 2I5FA 1X05A 4CYEA 3PVUA 5DHFB 4MT7A 2EJ8A 1KI1B 4DX8A 3U8ZA 2K00A 5D27A 4F7HA 2L1CA 1UNPA 3V5WA 1DDMA 5GOWB 3P7ZA 2ELAA 4GPTB 4EKUA 4WJ7A 1XR0B 5D3YA 2E2XA 1N3HA 2AEHA 1U5DA 3FSSA 3ODWA 3FM8C 5CLQB 2EC1A 4WSFA 4PNKA 3CIKA 3F0WA 2GS0A 4KHBB 3X23A 3VIAA 2L2IA 3PVWA 3HQCA 4HDOA 1ZM0A 1MAIA 3ZDTA 4HB2B 2HTHB 2DHIA 1OMWA 4CHJA 2UZSA 2LYDA 4HHVA 1LB1A 2J0MA 2MDXA 4A6HA 2CODA 4KHAA 1EVHA 1KZ7A 1MIZB 2CAYA 2YT1A 5HE0A 2NMBA 3KRXA 1WI1A 1H10A 2VKIA 1J19A 3NSUA 1WJ1A 5JHGA 2ZPYA 5JP4A 4D0NB 2YS5A 3WA0A 2FJLA 1I7AA 1K5DB 2W2WA 1UEFA 2QKLA 1FGYA 1E5WA 1V89A 2AL6A 5JLJB 3QBVB 1NTVA 4Z2NA 2LOXA
chains in the Genus database with same CATH superfamily
3GYPA 1AQCA 2D11A 3CXBB 3OANA 4MK0A 1PFJA 2LULA 2ROVA 1XD4A 3UZTA 3PZDA 2P0FA 2RUKB 3D8EA 1LW3A 2RRFA 2D9YA 2P0HA 2COAA 1U5GA 5L81A 4B6HA 3AJ4A 2W2XD 3LJUX 2ROZB 3DXCA 2G35A 3NWFA 1MK7B 3FEHA 4ZRKA 2D9ZA 2DN6A 3SNHA 3G9WA 1K5GB 2MWNB 2PZ1A 4GOUA 1Y5OA 2LKOA 3M1IB 2IYBA 1SGHA 1FAOA 5D3VA 1Y19B 1KZGA 1ZC4B 4L1RA 2YSZA 2KUQA 3PP2A 4HB3B 1BWNA 1V5UA 3TCAA 2Q13A 3ZVRA 4QJ4B 2Z59A 3SO6A 3D8DA 4GN1A 3T06A 5C6RA 2Y7BA 1W1DA 1MK9B 4HB4B 3P6AA 1DROA 2YS1A 5HE1A 4A6KA 2DX5A 4GMVA 1ZVRA 4CHMA 3MDBC 1MPHA 1V5PA 3B77A 3NWDA 4ZRIA 2KGXB 1SHCA 3AU5A 3TVVA 1WJMA 5FI0A 1J0WA 1U5FA 2M14A 1U27A 1PLSA 1EF1A 3F5RA 4EMOA 2Z4DA 2X18A 5CLLB 3A8PA 4D6WA 2YVCA 1BAKA 1GG3A 4DIXA 2COFA 1U2BA 1EGXA 4ZRJA 2DKQA 3HK0A 5D3WA 1UNQA 4K2PA 1RJ2A 4IOYX 4A6FA 5DHAB 4QJ3B 1P3RA 2CY4A 1X1FA 2RNRB 2I5CA 4TYZA 2ELBA 5J3QA 1U29A 4K17A 2R2YA 1FB8A 1V88A 2YT2A 2DYQA 3A58A 4YL8A 1ZYIA 4MY6A 4A6FB 2MFQA 4HAVB 4KVGB 1EAZA 1FGZA 2DYNA 4K2OA 4HSIA 5J3TA 2J0JA 2N23A 1QC6A 4GNKB 2DTCA 1B55A 2ZKMX 1OQNA 3DXEA 2I1KA 3MPXA 5JHHA 4QJ5B 2VSZA 4P7IA 1M7RA 4PQ0A 2Z14A 2DX1A 3HW2B 3SYXA 4F7UP 3DCXA 1FHOA 2DLWA 2OTXA 2LG1A 2YS3A 5LONB 2QKMA 1H4RA 5IRSA 2D4QA 3U7DA 5C16A 5C5BA 2Y8FA 1OY2A 2GCLA 1TQZA 4GXBA 3QWMA 2DKPA 2DHJA 1W1GA 4C0AA 4Y94A 3TW1A 1QQGA 4WVFB 2RSGA 2RVBB 3IVFA 3NWAA 5J3YA 4A5KA 5HE3A 3KRWA 4HAUB 1ZSQA 2R0DA 4F7GA 3KY9A 5HE2A 1AWEA 4GZUA 2H7DA 2W2XC 1MKEA 1UNRA 1I2HA 2M38A 1BTNA 2K2JA 1GC7A 5D3XA 2KCJA 1GC6A 4IAPA 2JP2A 2H7EA 1V5MA 5KCVA 3ODOA 1IRSA 2ADZA 1TXDA 1DDVA 3BJIA 3NW8A 2J0KA 1ZC3B 1WVHA 4NSWA 3KZ1A 2HE7A 3QIJA 4TKNA 2Z13A 5DIFB 2IFSA 2K8EA 1Z87A 1X11A 2RGNB 2D9VA 3DXDA 4KAXB 3AU4A 4KHOA 3ML4A 4HAYB 4YONA 1PMSA 2KIEA 4OSNA 2K49A 2NZ8B 4GMXB 2CRFA 5LOPB 1NI2A 5DI9B 3PVLA 4XWXA 3VOQA 1P6SA 4DXAB 2OQBA 2UZRA 2MKRA 2COCA 1XKEA 2I1JA 2DA0A 2LOZA 2P0DA 2D10A 4BBKA 1DBHA 4HATB 3A98B 2R09A 4HB0B 1U5EA 2KR0A 2DHKA 1FHXA 5EFXA 1Q67A 2P8VA 4QXAB 2GCJA 4L6EA 3WYFB 2BCJA 4HDQA 1UPRA 5C79A 4Z2MB 4HAWB 3SV1A 1W1HA 2YF0A 2GJYA 3SUZA 2D9WA 2UVMA 2J59M 3O96A 4EJNA 3TFMA 3BINA 3PSCA 2CY5A 1ISNA 2RLOA 3N7CA 3PG7A 4IFSA 1UPQA 3TO1A 3HIEA 4HAZB 4OT1A 1XX0A 3ODXA 1DYNA 4H8SA 3ULCA 2Z0QA 3A8QA 2N0YA 2KUPA 4DBBA 3ULBA 2XQNM 3GYOA 1FHWA 1WGQA 1XODA 1WG7A 1DDWA 3RCPA 2Y8GA 1NU2A 1M7EA 4NY0A 5C5BB 2EMTA 2Z0PA 1BTKA 1V61A 3D8FA 4DX90 1MIXA 2DFKA 5DH9B 1RRPB 1NTYA 5FI1A 5KQ1A 5M4YB 1WGUA 2D2QA 1X1GA 2YT0A 2GUMA 4K81A 1P5TA 1XCGA 1FOEA 2Z0OA 1TJ6A 1X86A 2FJUB 2D9XA 2VRWB 3KSYA 2EMSA 3PEGA 2YRYA 2V76A 5KQ4A 1T77A 4HAXB 2K2UA 2I5FA 5I2MA 1X05A 4CYEA 3PVUA 5DHFB 4MT7A 2EJ8A 1KI1B 4DX8A 3HSAA 2NBVA 1MI1A 3U8ZA 2K00A 5D27A 4F7HA 2L1CA 1UNPA 3V5WA 1DDMA 5GOWB 3P7ZA 2ELAA 4GPTB 4EKUA 4KHBA 4WJ7A 1XR0B 5I2SA 5D3YA 2E2XA 1N3HA 2AEHA 1U5DA 3FSSA 3ODWA 3FM8C 5CLQB 2EC1A 4WSFA 4PNKA 3CIKA 3F0WA 2GS0A 4KHBB 3X23A 3VIAA 2L2IA 3PVWA 3HQCA 4HDOA 1ZM0A 1MAIA 3ZDTA 4HB2B 2HTHB 2DHIA 1OMWA 4CHJA 4CSQA 2UZSA 3FVCA 2LYDA 4HHVA 1LB1A 2J0MA 2MDXA 4A6HA 2CODA 4KHAA 1EVHA 1KZ7A 1MIZB 2CAYA 2YT1A 5HE0A 2KIGA 2NMBA 3KRXA 1WI1A 1H10A 2VKIA 1J19A 5LG4B 3NSUA 1WJ1A 5JHGA 2ZPYA 5JP4A 4D0NB 2YS5A 3WA0A 2FJLA 1I7AA 1K5DB 2W2WA 3U12A 1UEFA 2QKLA 1FGYA 1E5WA 1V89A 2AL6A 5JLJB 3QBVB 1NTVA 3OHMB 4Z2NA 2LOXA
chains in the Genus database with same CATH topology
3GYPA 1AQCA 2D11A 3CXBB 3OANA 4MK0A 1PFJA 2LULA 2ROVA 1XD4A 3UZTA 3PZDA 2P0FA 2RUKB 3D8EA 1LW3A 2D9YA 2P0HA 2COAA 1U5GA 5L81A 4B6HA 3AJ4A 2W2XD 3LJUX 2ROZB 3DXCA 2G35A 1MK7B 3FEHA 4ZRKA 2D9ZA 2DN6A 3SNHA 3G9WA 1K5GB 2MWNB 2PZ1A 1Y5OA 2LKOA 3M1IB 2IYBA 1SGHA 1FAOA 5D3VA 1Y19B 1KZGA 1ZC4B 2YSZA 3PP2A 4HB3B 1BWNA 1V5UA 3TCAA 2Q13A 3ZVRA 3SO6A 3D8DA 4GN1A 3T06A 5C6RA 2Y7BA 1W1DA 1MK9B 4HB4B 3P6AA 1DROA 2YS1A 5HE1A 4A6KA 2DX5A 4GMVA 1ZVRA 4CHMA 3MDBC 1MPHA 1V5PA 4ZRIA 2KGXB 1SHCA 3AU5A 3TVVA 1WJMA 5FI0A 1U5FA 1J0WA 2M14A 1U27A 1PLSA 1EF1A 3F5RA 4EMOA 2X18A 5CLLB 3A8PA 2YVCA 1BAKA 1GG3A 2COFA 1U2BA 1EGXA 4ZRJA 2DKQA 3HK0A 5D3WA 1UNQA 4K2PA 1RJ2A 4IOYX 4A6FA 5DHAB 1P3RA 2CY4A 1X1FA 2RNRB 2I5CA 4TYZA 2ELBA 5J3QA 1U29A 4K17A 1FB8A 1V88A 2DYQA 4YL8A 4MY6A 4A6FB 2MFQA 4HAVB 4KVGB 1EAZA 1FGZA 2DYNA 4K2OA 5J3TA 2J0JA 2N23A 1QC6A 2DTCA 1B55A 1OQNA 3DXEA 2I1KA 3MPXA 5JHHA 2VSZA 4P7IA 1M7RA 4PQ0A 2DX1A 3HW2B 3SYXA 4F7UP 1FHOA 2DLWA 2OTXA 2LG1A 2YS3A 5LONB 2QKMA 1H4RA 2D4QA 3U7DA 5C16A 5C5BA 2Y8FA 1OY2A 2GCLA 1TQZA 4GXBA 3QWMA 2DKPA 2DHJA 1W1GA 4C0AA 4Y94A 3TW1A 1QQGA 4WVFB 2RSGA 2RVBB 3IVFA 5J3YA 4A5KA 5HE3A 3KRWA 4HAUB 1ZSQA 2R0DA 4F7GA 3KY9A 5HE2A 1AWEA 4GZUA 2H7DA 2W2XC 1MKEA 1UNRA 1I2HA 2M38A 1BTNA 2K2JA 1GC7A 5D3XA 2KCJA 1GC6A 4IAPA 2JP2A 2H7EA 1V5MA 5KCVA 3ODOA 1IRSA 2ADZA 1TXDA 1DDVA 3BJIA 2J0KA 1ZC3B 1WVHA 4NSWA 3KZ1A 2HE7A 3QIJA 4TKNA 5DIFB 2IFSA 1Z87A 1X11A 2RGNB 2D9VA 3DXDA 4KAXB 3AU4A 4KHOA 3ML4A 4HAYB 4YONA 1PMSA 4GMXB 2NZ8B 2CRFA 5LOPB 1NI2A 5DI9B 3PVLA 4XWXA 3VOQA 1P6SA 4DXAB 2OQBA 2UZRA 2MKRA 2COCA 1XKEA 2I1JA 2DA0A 2LOZA 2P0DA 2D10A 4BBKA 1DBHA 4HATB 3A98B 2R09A 4HB0B 1U5EA 2DHKA 1FHXA 5EFXA 1Q67A 2P8VA 3WYFB 2GCJA 4L6EA 2BCJA 4HDQA 1UPRA 5C79A 4Z2MB 4HAWB 3SV1A 1W1HA 2YF0A 2GJYA 3SUZA 2D9WA 2UVMA 2J59M 3O96A 4EJNA 3TFMA 3BINA 3PSCA 2CY5A 1ISNA 2RLOA 3N7CA 3PG7A 4IFSA 1UPQA 3TO1A 4HAZB 1XX0A 3ODXA 1DYNA 4H8SA 3ULCA 2Z0QA 3A8QA 2N0YA 2KUPA 4DBBA 3ULBA 2XQNM 3GYOA 1FHWA 1WGQA 1XODA 1WG7A 1DDWA 3RCPA 2Y8GA 1NU2A 1M7EA 4NY0A 5C5BB 2EMTA 2Z0PA 1BTKA 1V61A 3D8FA 4DX90 1MIXA 2DFKA 5DH9B 1RRPB 1NTYA 5FI1A 5KQ1A 1WGUA 2D2QA 1X1GA 2YT0A 4K81A 1P5TA 1XCGA 1FOEA 2Z0OA 1TJ6A 1X86A 2D9XA 2VRWB 3KSYA 2EMSA 3PEGA 2YRYA 2V76A 5KQ4A 4HAXB 2K2UA 2I5FA 1X05A 4CYEA 3PVUA 5DHFB 4MT7A 2EJ8A 1KI1B 4DX8A 3U8ZA 2K00A 5D27A 4F7HA 2L1CA 1UNPA 3V5WA 1DDMA 5GOWB 3P7ZA 2ELAA 4GPTB 4EKUA 4WJ7A 1XR0B 5D3YA 2E2XA 1N3HA 2AEHA 1U5DA 3FSSA 3ODWA 3FM8C 5CLQB 2EC1A 4WSFA 4PNKA 3CIKA 3F0WA 2GS0A 4KHBB 3X23A 3VIAA 2L2IA 3PVWA 3HQCA 4HDOA 1ZM0A 1MAIA 3ZDTA 4HB2B 2HTHB 2DHIA 1OMWA 4CHJA 2UZSA 2LYDA 4HHVA 1LB1A 2J0MA 2MDXA 4A6HA 2CODA 4KHAA 1EVHA 1KZ7A 1MIZB 2CAYA 2YT1A 5HE0A 2NMBA 3KRXA 1WI1A 1H10A 2VKIA 1J19A 3NSUA 1WJ1A 5JHGA 2ZPYA 5JP4A 4D0NB 2YS5A 3WA0A 2FJLA 1I7AA 1K5DB 2W2WA 1UEFA 2QKLA 1FGYA 1E5WA 1V89A 2AL6A 5JLJB 3QBVB 1NTVA 4Z2NA 2LOXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GYP A;  1AQC A;  2D11 A;  3CXB B;  3OAN A;  4MK0 A;  1PFJ A;  2LUL A;  2ROV A;  1XD4 A;  3UZT A;  3PZD A;  2P0F A;  2RUK B;  3D8E A;  1LW3 A;  2D9Y A;  2P0H A;  2COA A;  1U5G A;  5L81 A;  4B6H A;  3AJ4 A;  2W2X D;  3LJU X;  2ROZ B;  3DXC A;  2G35 A;  1MK7 B;  3FEH A;  4ZRK A;  2D9Z A;  2DN6 A;  3SNH A;  3G9W A;  1K5G B;  2MWN B;  2PZ1 A;  1Y5O A;  2LKO A;  3M1I B;  2IYB A;  1SGH A;  1FAO A;  5D3V A;  1Y19 B;  1KZG A;  1ZC4 B;  2YSZ A;  3PP2 A;  4HB3 B;  1BWN A;  1V5U A;  3TCA A;  2Q13 A;  3ZVR A;  3SO6 A;  3D8D A;  4GN1 A;  3T06 A;  5C6R A;  2Y7B A;  1W1D A;  1MK9 B;  4HB4 B;  3P6A A;  1DRO A;  2YS1 A;  5HE1 A;  4A6K A;  2DX5 A;  4GMV A;  1ZVR A;  4CHM A;  3MDB C;  1MPH A;  1V5P A;  4ZRI A;  2KGX B;  1SHC A;  3AU5 A;  3TVV A;  1WJM A;  5FI0 A;  1U5F A;  1J0W A;  2M14 A;  1U27 A;  1PLS A;  1EF1 A;  3F5R A;  4EMO A;  2X18 A;  5CLL B;  3A8P A;  2YVC A;  1BAK A;  1GG3 A;  2COF A;  1U2B A;  1EGX A;  4ZRJ A;  2DKQ A;  3HK0 A;  5D3W A;  1UNQ A;  4K2P A;  1RJ2 A;  4IOY X;  4A6F A;  5DHA B;  1P3R A;  2CY4 A;  1X1F A;  2RNR B;  2I5C A;  4TYZ A;  2ELB A;  5J3Q A;  1U29 A;  4K17 A;  1FB8 A;  1V88 A;  2DYQ A;  4YL8 A;  4MY6 A;  4A6F B;  2MFQ A;  4HAV B;  4KVG B;  1EAZ A;  1FGZ A;  2DYN A;  4K2O A;  5J3T A;  2J0J A;  2N23 A;  1QC6 A;  2DTC A;  1B55 A;  1OQN A;  3DXE A;  2I1K A;  3MPX A;  5JHH A;  2VSZ A;  4P7I A;  1M7R A;  4PQ0 A;  2DX1 A;  3HW2 B;  3SYX A;  4F7U P;  1FHO A;  2DLW A;  2OTX A;  2LG1 A;  2YS3 A;  5LON B;  2QKM A;  1H4R A;  2D4Q A;  3U7D A;  5C16 A;  5C5B A;  2Y8F A;  1OY2 A;  2GCL A;  1TQZ A;  4GXB A;  3QWM A;  2DKP A;  2DHJ A;  1W1G A;  4C0A A;  4Y94 A;  3TW1 A;  1QQG A;  4WVF B;  2RSG A;  2RVB B;  3IVF A;  5J3Y A;  4A5K A;  5HE3 A;  3KRW A;  4HAU B;  1ZSQ A;  2R0D A;  4F7G A;  3KY9 A;  5HE2 A;  1AWE A;  4GZU A;  2H7D A;  2W2X C;  1MKE A;  1UNR A;  1I2H A;  2M38 A;  1BTN A;  2K2J A;  1GC7 A;  5D3X A;  2KCJ A;  1GC6 A;  4IAP A;  2JP2 A;  2H7E A;  1V5M A;  5KCV A;  3ODO A;  1IRS A;  2ADZ A;  1TXD A;  1DDV A;  3BJI A;  2J0K A;  1ZC3 B;  1WVH A;  4NSW A;  3KZ1 A;  2HE7 A;  3QIJ A;  4TKN A;  5DIF B;  2IFS A;  1Z87 A;  1X11 A;  2RGN B;  2D9V A;  3DXD A;  4KAX B;  3AU4 A;  4KHO A;  3ML4 A;  4HAY B;  4YON A;  1PMS A;  4GMX B;  2NZ8 B;  2CRF A;  5LOP B;  1NI2 A;  5DI9 B;  3PVL A;  4XWX A;  3VOQ A;  1P6S A;  4DXA B;  2OQB A;  2UZR A;  2MKR A;  2COC A;  1XKE A;  2I1J A;  2DA0 A;  2LOZ A;  2P0D A;  2D10 A;  4BBK A;  1DBH A;  4HAT B;  3A98 B;  2R09 A;  4HB0 B;  1U5E A;  2DHK A;  1FHX A;  5EFX A;  1Q67 A;  2P8V A;  3WYF B;  2GCJ A;  4L6E A;  2BCJ A;  4HDQ A;  1UPR A;  5C79 A;  4Z2M B;  4HAW B;  3SV1 A;  1W1H A;  2YF0 A;  2GJY A;  3SUZ A;  2D9W A;  2UVM A;  2J59 M;  3O96 A;  4EJN A;  3TFM A;  3BIN A;  3PSC A;  2CY5 A;  1ISN A;  2RLO A;  3N7C A;  3PG7 A;  4IFS A;  1UPQ A;  3TO1 A;  4HAZ B;  1XX0 A;  3ODX A;  1DYN A;  4H8S A;  3ULC A;  2Z0Q A;  3A8Q A;  2N0Y A;  2KUP A;  4DBB A;  3ULB A;  2XQN M;  3GYO A;  1FHW A;  1WGQ A;  1XOD A;  1WG7 A;  1DDW A;  3RCP A;  2Y8G A;  1NU2 A;  1M7E A;  4NY0 A;  5C5B B;  2EMT A;  2Z0P A;  1BTK A;  1V61 A;  3D8F A;  4DX9 0;  1MIX A;  2DFK A;  5DH9 B;  1RRP B;  1NTY A;  5FI1 A;  5KQ1 A;  1WGU A;  2D2Q A;  1X1G A;  2YT0 A;  4K81 A;  1P5T A;  1XCG A;  1FOE A;  2Z0O A;  1TJ6 A;  1X86 A;  2D9X A;  2VRW B;  3KSY A;  2EMS A;  3PEG A;  2YRY A;  2V76 A;  5KQ4 A;  4HAX B;  2K2U A;  2I5F A;  1X05 A;  4CYE A;  3PVU A;  5DHF B;  4MT7 A;  2EJ8 A;  1KI1 B;  4DX8 A;  3U8Z A;  2K00 A;  5D27 A;  4F7H A;  2L1C A;  1UNP A;  3V5W A;  1DDM A;  5GOW B;  3P7Z A;  2ELA A;  4GPT B;  4EKU A;  4WJ7 A;  1XR0 B;  5D3Y A;  2E2X A;  1N3H A;  2AEH A;  1U5D A;  3FSS A;  3ODW A;  3FM8 C;  5CLQ B;  2EC1 A;  4WSF A;  4PNK A;  3CIK A;  3F0W A;  2GS0 A;  4KHB B;  3X23 A;  3VIA A;  2L2I A;  3PVW A;  3HQC A;  4HDO A;  1ZM0 A;  1MAI A;  3ZDT A;  4HB2 B;  2HTH B;  2DHI A;  1OMW A;  4CHJ A;  2UZS A;  2LYD A;  4HHV A;  1LB1 A;  2J0M A;  2MDX A;  4A6H A;  2COD A;  4KHA A;  1EVH A;  1KZ7 A;  1MIZ B;  2CAY A;  2YT1 A;  5HE0 A;  2NMB A;  3KRX A;  1WI1 A;  1H10 A;  2VKI A;  1J19 A;  3NSU A;  1WJ1 A;  5JHG A;  2ZPY A;  5JP4 A;  4D0N B;  2YS5 A;  3WA0 A;  2FJL A;  1I7A A;  1K5D B;  2W2W A;  1UEF A;  2QKL A;  1FGY A;  1E5W A;  1V89 A;  2AL6 A;  5JLJ B;  3QBV B;  1NTV A;  4Z2N A;  2LOX A; 
#chains in the Genus database with same CATH topology
 3GYP A;  1AQC A;  2D11 A;  3CXB B;  3OAN A;  4MK0 A;  1PFJ A;  2LUL A;  2ROV A;  1XD4 A;  3UZT A;  3PZD A;  2P0F A;  2RUK B;  3D8E A;  1LW3 A;  2RRF A;  2D9Y A;  2P0H A;  2COA A;  1U5G A;  5L81 A;  4B6H A;  3AJ4 A;  2W2X D;  3LJU X;  2ROZ B;  3DXC A;  2G35 A;  3NWF A;  1MK7 B;  3FEH A;  4ZRK A;  2D9Z A;  2DN6 A;  3SNH A;  3G9W A;  1K5G B;  2MWN B;  2PZ1 A;  4GOU A;  1Y5O A;  2LKO A;  3M1I B;  2IYB A;  1SGH A;  1FAO A;  5D3V A;  1Y19 B;  1KZG A;  1ZC4 B;  4L1R A;  2YSZ A;  2KUQ A;  3PP2 A;  4HB3 B;  1BWN A;  1V5U A;  3TCA A;  2Q13 A;  3ZVR A;  4QJ4 B;  2Z59 A;  3SO6 A;  3D8D A;  4GN1 A;  3T06 A;  5C6R A;  2Y7B A;  1W1D A;  1MK9 B;  4HB4 B;  3P6A A;  1DRO A;  2YS1 A;  5HE1 A;  4A6K A;  2DX5 A;  4GMV A;  1ZVR A;  4CHM A;  3MDB C;  1MPH A;  1V5P A;  3B77 A;  3NWD A;  4ZRI A;  2KGX B;  1SHC A;  3AU5 A;  3TVV A;  1WJM A;  5FI0 A;  1J0W A;  1U5F A;  2M14 A;  1U27 A;  1PLS A;  1EF1 A;  3F5R A;  4EMO A;  2Z4D A;  2X18 A;  5CLL B;  3A8P A;  4D6W A;  2YVC A;  1BAK A;  1GG3 A;  4DIX A;  2COF A;  1U2B A;  1EGX A;  4ZRJ A;  2DKQ A;  3HK0 A;  5D3W A;  1UNQ A;  4K2P A;  1RJ2 A;  4IOY X;  4A6F A;  5DHA B;  4QJ3 B;  1P3R A;  2CY4 A;  1X1F A;  2RNR B;  2I5C A;  4TYZ A;  2ELB A;  5J3Q A;  1U29 A;  4K17 A;  2R2Y A;  1FB8 A;  1V88 A;  2YT2 A;  2DYQ A;  3A58 A;  4YL8 A;  1ZYI A;  4MY6 A;  4A6F B;  2MFQ A;  4HAV B;  4KVG B;  1EAZ A;  1FGZ A;  2DYN A;  4K2O A;  4HSI A;  5J3T A;  2J0J A;  2N23 A;  1QC6 A;  4GNK B;  2DTC A;  1B55 A;  2ZKM X;  1OQN A;  3DXE A;  2I1K A;  3MPX A;  5JHH A;  4QJ5 B;  2VSZ A;  4P7I A;  1M7R A;  4PQ0 A;  2Z14 A;  2DX1 A;  3HW2 B;  3SYX A;  4F7U P;  3DCX A;  1FHO A;  2DLW A;  2OTX A;  2LG1 A;  2YS3 A;  5LON B;  2QKM A;  1H4R A;  5IRS A;  2D4Q A;  3U7D A;  5C16 A;  5C5B A;  2Y8F A;  1OY2 A;  2GCL A;  1TQZ A;  4GXB A;  3QWM A;  2DKP A;  2DHJ A;  1W1G A;  4C0A A;  4Y94 A;  3TW1 A;  1QQG A;  4WVF B;  2RSG A;  2RVB B;  3IVF A;  3NWA A;  5J3Y A;  4A5K A;  5HE3 A;  3KRW A;  4HAU B;  1ZSQ A;  2R0D A;  4F7G A;  3KY9 A;  5HE2 A;  1AWE A;  4GZU A;  2H7D A;  2W2X C;  1MKE A;  1UNR A;  1I2H A;  2M38 A;  1BTN A;  2K2J A;  1GC7 A;  5D3X A;  2KCJ A;  1GC6 A;  4IAP A;  2JP2 A;  2H7E A;  1V5M A;  5KCV A;  3ODO A;  1IRS A;  2ADZ A;  1TXD A;  1DDV A;  3BJI A;  3NW8 A;  2J0K A;  1ZC3 B;  1WVH A;  4NSW A;  3KZ1 A;  2HE7 A;  3QIJ A;  4TKN A;  2Z13 A;  5DIF B;  2IFS A;  2K8E A;  1Z87 A;  1X11 A;  2RGN B;  2D9V A;  3DXD A;  4KAX B;  3AU4 A;  4KHO A;  3ML4 A;  4HAY B;  4YON A;  1PMS A;  2KIE A;  4OSN A;  2K49 A;  2NZ8 B;  4GMX B;  2CRF A;  5LOP B;  1NI2 A;  5DI9 B;  3PVL A;  4XWX A;  3VOQ A;  1P6S A;  4DXA B;  2OQB A;  2UZR A;  2MKR A;  2COC A;  1XKE A;  2I1J A;  2DA0 A;  2LOZ A;  2P0D A;  2D10 A;  4BBK A;  1DBH A;  4HAT B;  3A98 B;  2R09 A;  4HB0 B;  1U5E A;  2KR0 A;  2DHK A;  1FHX A;  5EFX A;  1Q67 A;  2P8V A;  4QXA B;  2GCJ A;  4L6E A;  3WYF B;  2BCJ A;  4HDQ A;  1UPR A;  5C79 A;  4Z2M B;  4HAW B;  3SV1 A;  1W1H A;  2YF0 A;  2GJY A;  3SUZ A;  2D9W A;  2UVM A;  2J59 M;  3O96 A;  4EJN A;  3TFM A;  3BIN A;  3PSC A;  2CY5 A;  1ISN A;  2RLO A;  3N7C A;  3PG7 A;  4IFS A;  1UPQ A;  3TO1 A;  3HIE A;  4HAZ B;  4OT1 A;  1XX0 A;  3ODX A;  1DYN A;  4H8S A;  3ULC A;  2Z0Q A;  3A8Q A;  2N0Y A;  2KUP A;  4DBB A;  3ULB A;  2XQN M;  3GYO A;  1FHW A;  1WGQ A;  1XOD A;  1WG7 A;  1DDW A;  3RCP A;  2Y8G A;  1NU2 A;  1M7E A;  4NY0 A;  5C5B B;  2EMT A;  2Z0P A;  1BTK A;  1V61 A;  3D8F A;  4DX9 0;  1MIX A;  2DFK A;  5DH9 B;  1RRP B;  1NTY A;  5FI1 A;  5KQ1 A;  5M4Y B;  1WGU A;  2D2Q A;  1X1G A;  2YT0 A;  2GUM A;  4K81 A;  1P5T A;  1XCG A;  1FOE A;  2Z0O A;  1TJ6 A;  1X86 A;  2FJU B;  2D9X A;  2VRW B;  3KSY A;  2EMS A;  3PEG A;  2YRY A;  2V76 A;  5KQ4 A;  1T77 A;  4HAX B;  2K2U A;  2I5F A;  5I2M A;  1X05 A;  4CYE A;  3PVU A;  5DHF B;  4MT7 A;  2EJ8 A;  1KI1 B;  4DX8 A;  3HSA A;  2NBV A;  1MI1 A;  3U8Z A;  2K00 A;  5D27 A;  4F7H A;  2L1C A;  1UNP A;  3V5W A;  1DDM A;  5GOW B;  3P7Z A;  2ELA A;  4GPT B;  4EKU A;  4KHB A;  4WJ7 A;  1XR0 B;  5I2S A;  5D3Y A;  2E2X A;  1N3H A;  2AEH A;  1U5D A;  3FSS A;  3ODW A;  3FM8 C;  5CLQ B;  2EC1 A;  4WSF A;  4PNK A;  3CIK A;  3F0W A;  2GS0 A;  4KHB B;  3X23 A;  3VIA A;  2L2I A;  3PVW A;  3HQC A;  4HDO A;  1ZM0 A;  1MAI A;  3ZDT A;  4HB2 B;  2HTH B;  2DHI A;  1OMW A;  4CHJ A;  4CSQ A;  2UZS A;  3FVC A;  2LYD A;  4HHV A;  1LB1 A;  2J0M A;  2MDX A;  4A6H A;  2COD A;  4KHA A;  1EVH A;  1KZ7 A;  1MIZ B;  2CAY A;  2YT1 A;  5HE0 A;  2KIG A;  2NMB A;  3KRX A;  1WI1 A;  1H10 A;  2VKI A;  1J19 A;  5LG4 B;  3NSU A;  1WJ1 A;  5JHG A;  2ZPY A;  5JP4 A;  4D0N B;  2YS5 A;  3WA0 A;  2FJL A;  1I7A A;  1K5D B;  2W2W A;  3U12 A;  1UEF A;  2QKL A;  1FGY A;  1E5W A;  1V89 A;  2AL6 A;  5JLJ B;  3QBV B;  1NTV A;  3OHM B;  4Z2N A;  2LOX A; 
#chains in the Genus database with same CATH homology
 3GYP A;  1AQC A;  2D11 A;  3CXB B;  3OAN A;  4MK0 A;  1PFJ A;  2LUL A;  2ROV A;  1XD4 A;  3UZT A;  3PZD A;  2P0F A;  2RUK B;  3D8E A;  1LW3 A;  2D9Y A;  2P0H A;  2COA A;  1U5G A;  5L81 A;  4B6H A;  3AJ4 A;  2W2X D;  3LJU X;  2ROZ B;  3DXC A;  2G35 A;  1MK7 B;  3FEH A;  4ZRK A;  2D9Z A;  2DN6 A;  3SNH A;  3G9W A;  1K5G B;  2MWN B;  2PZ1 A;  1Y5O A;  2LKO A;  3M1I B;  2IYB A;  1SGH A;  1FAO A;  5D3V A;  1Y19 B;  1KZG A;  1ZC4 B;  2YSZ A;  3PP2 A;  4HB3 B;  1BWN A;  1V5U A;  3TCA A;  2Q13 A;  3ZVR A;  3SO6 A;  3D8D A;  4GN1 A;  3T06 A;  5C6R A;  2Y7B A;  1W1D A;  1MK9 B;  4HB4 B;  3P6A A;  1DRO A;  2YS1 A;  5HE1 A;  4A6K A;  2DX5 A;  4GMV A;  1ZVR A;  4CHM A;  3MDB C;  1MPH A;  1V5P A;  4ZRI A;  2KGX B;  1SHC A;  3AU5 A;  3TVV A;  1WJM A;  5FI0 A;  1U5F A;  1J0W A;  2M14 A;  1U27 A;  1PLS A;  1EF1 A;  3F5R A;  4EMO A;  2X18 A;  5CLL B;  3A8P A;  2YVC A;  1BAK A;  1GG3 A;  2COF A;  1U2B A;  1EGX A;  4ZRJ A;  2DKQ A;  3HK0 A;  5D3W A;  1UNQ A;  4K2P A;  1RJ2 A;  4IOY X;  4A6F A;  5DHA B;  1P3R A;  2CY4 A;  1X1F A;  2RNR B;  2I5C A;  4TYZ A;  2ELB A;  5J3Q A;  1U29 A;  4K17 A;  1FB8 A;  1V88 A;  2DYQ A;  4YL8 A;  4MY6 A;  4A6F B;  2MFQ A;  4HAV B;  4KVG B;  1EAZ A;  1FGZ A;  2DYN A;  4K2O A;  5J3T A;  2J0J A;  2N23 A;  1QC6 A;  2DTC A;  1B55 A;  1OQN A;  3DXE A;  2I1K A;  3MPX A;  5JHH A;  2VSZ A;  4P7I A;  1M7R A;  4PQ0 A;  2DX1 A;  3HW2 B;  3SYX A;  4F7U P;  1FHO A;  2DLW A;  2OTX A;  2LG1 A;  2YS3 A;  5LON B;  2QKM A;  1H4R A;  2D4Q A;  3U7D A;  5C16 A;  5C5B A;  2Y8F A;  1OY2 A;  2GCL A;  1TQZ A;  4GXB A;  3QWM A;  2DKP A;  2DHJ A;  1W1G A;  4C0A A;  4Y94 A;  3TW1 A;  1QQG A;  4WVF B;  2RSG A;  2RVB B;  3IVF A;  5J3Y A;  4A5K A;  5HE3 A;  3KRW A;  4HAU B;  1ZSQ A;  2R0D A;  4F7G A;  3KY9 A;  5HE2 A;  1AWE A;  4GZU A;  2H7D A;  2W2X C;  1MKE A;  1UNR A;  1I2H A;  2M38 A;  1BTN A;  2K2J A;  1GC7 A;  5D3X A;  2KCJ A;  1GC6 A;  4IAP A;  2JP2 A;  2H7E A;  1V5M A;  5KCV A;  3ODO A;  1IRS A;  2ADZ A;  1TXD A;  1DDV A;  3BJI A;  2J0K A;  1ZC3 B;  1WVH A;  4NSW A;  3KZ1 A;  2HE7 A;  3QIJ A;  4TKN A;  5DIF B;  2IFS A;  1Z87 A;  1X11 A;  2RGN B;  2D9V A;  3DXD A;  4KAX B;  3AU4 A;  4KHO A;  3ML4 A;  4HAY B;  4YON A;  1PMS A;  4GMX B;  2NZ8 B;  2CRF A;  5LOP B;  1NI2 A;  5DI9 B;  3PVL A;  4XWX A;  3VOQ A;  1P6S A;  4DXA B;  2OQB A;  2UZR A;  2MKR A;  2COC A;  1XKE A;  2I1J A;  2DA0 A;  2LOZ A;  2P0D A;  2D10 A;  4BBK A;  1DBH A;  4HAT B;  3A98 B;  2R09 A;  4HB0 B;  1U5E A;  2DHK A;  1FHX A;  5EFX A;  1Q67 A;  2P8V A;  3WYF B;  2GCJ A;  4L6E A;  2BCJ A;  4HDQ A;  1UPR A;  5C79 A;  4Z2M B;  4HAW B;  3SV1 A;  1W1H A;  2YF0 A;  2GJY A;  3SUZ A;  2D9W A;  2UVM A;  2J59 M;  3O96 A;  4EJN A;  3TFM A;  3BIN A;  3PSC A;  2CY5 A;  1ISN A;  2RLO A;  3N7C A;  3PG7 A;  4IFS A;  1UPQ A;  3TO1 A;  4HAZ B;  1XX0 A;  3ODX A;  1DYN A;  4H8S A;  3ULC A;  2Z0Q A;  3A8Q A;  2N0Y A;  2KUP A;  4DBB A;  3ULB A;  2XQN M;  3GYO A;  1FHW A;  1WGQ A;  1XOD A;  1WG7 A;  1DDW A;  3RCP A;  2Y8G A;  1NU2 A;  1M7E A;  4NY0 A;  5C5B B;  2EMT A;  2Z0P A;  1BTK A;  1V61 A;  3D8F A;  4DX9 0;  1MIX A;  2DFK A;  5DH9 B;  1RRP B;  1NTY A;  5FI1 A;  5KQ1 A;  1WGU A;  2D2Q A;  1X1G A;  2YT0 A;  4K81 A;  1P5T A;  1XCG A;  1FOE A;  2Z0O A;  1TJ6 A;  1X86 A;  2D9X A;  2VRW B;  3KSY A;  2EMS A;  3PEG A;  2YRY A;  2V76 A;  5KQ4 A;  4HAX B;  2K2U A;  2I5F A;  1X05 A;  4CYE A;  3PVU A;  5DHF B;  4MT7 A;  2EJ8 A;  1KI1 B;  4DX8 A;  3U8Z A;  2K00 A;  5D27 A;  4F7H A;  2L1C A;  1UNP A;  3V5W A;  1DDM A;  5GOW B;  3P7Z A;  2ELA A;  4GPT B;  4EKU A;  4WJ7 A;  1XR0 B;  5D3Y A;  2E2X A;  1N3H A;  2AEH A;  1U5D A;  3FSS A;  3ODW A;  3FM8 C;  5CLQ B;  2EC1 A;  4WSF A;  4PNK A;  3CIK A;  3F0W A;  2GS0 A;  4KHB B;  3X23 A;  3VIA A;  2L2I A;  3PVW A;  3HQC A;  4HDO A;  1ZM0 A;  1MAI A;  3ZDT A;  4HB2 B;  2HTH B;  2DHI A;  1OMW A;  4CHJ A;  2UZS A;  2LYD A;  4HHV A;  1LB1 A;  2J0M A;  2MDX A;  4A6H A;  2COD A;  4KHA A;  1EVH A;  1KZ7 A;  1MIZ B;  2CAY A;  2YT1 A;  5HE0 A;  2NMB A;  3KRX A;  1WI1 A;  1H10 A;  2VKI A;  1J19 A;  3NSU A;  1WJ1 A;  5JHG A;  2ZPY A;  5JP4 A;  4D0N B;  2YS5 A;  3WA0 A;  2FJL A;  1I7A A;  1K5D B;  2W2W A;  1UEF A;  2QKL A;  1FGY A;  1E5W A;  1V89 A;  2AL6 A;  5JLJ B;  3QBV B;  1NTV A;  4Z2N A;  2LOX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...