3SV1A

Crystal structure of app peptide bound rat mint2 parm
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
190
structure length
163
Chain Sequence
GSEDLIDGIIFAANYLGSTQLLSERNPSKNIRMMQAQEAVSRVKRMQKAAKIKKKANQTLTEVDLFISTQRIKVLNADTQETMMDHALRTISYIADIGNIVVLMARRRYKMICHVFESEDAQLIAQSIGQAFSVAYQEFLRANGINPEDLSQKEYSDIINTQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Open-closed motion of Mint2 regulates APP metabolism
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Protein binding
molecule keywords Amyloid beta A4 precursor protein-binding family A member 2
total genus 40
structure length 163
sequence length 190
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2011-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00640 PID Phosphotyrosine interaction domain (PTB/PID)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3sv1A00
4EJNA 3P7ZA 1FGYA 4L6EA 3TO1A 2D2QA 1LB1A 2RNRB 1KZ7A 2OTXA 1V61A 1U5DA 3FM8C 4Z2NA 2YS5A 4HAXB 1AQCA 1EGXA 1DYNA 1K5DB 2W2XC 4A5KA 2RUKB 2RVBB 1MK9B 1XX0A 4F7UP 2DN6A 5C5BA 2E2XA 2ADZA 1U5EA 2MWNB 3ULCA 2CRFA 3ML4A 2D9YA 3FEHA 4DX8A 1TQZA 2EC1A 1DBHA 1B55A 1QQGA 5JHHA 2D9ZA 1GG3A 1P3RA 1N3HA 4Y94A 3SUZA 1W1DA 3F0WA 1TJ6A 2D10A 2MKRA 5FI1A 1H4RA 4HAWB 1H10A 1NI2A 3PP2A 4KAXB 1RJ2A 1QC6A 2P8VA 4GZUA 2D9VA 3D8DA 4GMXB 1MIXA 4F7GA 1ZVRA 2Y7BA 3A8PA 3A8QA 2N23A 1FHXA 5CLLB 1E5WA 4A6KA 3M1IB 2YVCA 1PLSA 1TXDA 2Z0OA 2COFA 2Y8FA 2DLWA 2L1CA 1WG7A 5C6RA 3WA0A 3N7CA 1WGUA 4ZRKA 2YT1A 3VIAA 4IFSA 1UPQA 1J0WA 1W1GA 2AL6A 1DDVA 4BBKA 2KGXB 5C5BB 2DA0A 1OMWA 2COAA 4DBBA 3PVWA 1X05A 1U27A 2ELBA 4CHJA 2MDXA 1GC6A 2DFKA 2UZSA 2BCJA 1X1FA 4DXAB 1X11A 2R09A 1FAOA 2DHIA 1XKEA 2YS3A 2V76A 4WSFA 1EAZA 1WI1A 4HAUB 4B6HA 2I5FA 3PVUA 5J3QA 2ZPYA 1FHWA 2LULA 1WVHA 4GMVA 2YT0A 3QWMA 3VOQA 4IAPA 5LONB 4NSWA 1W1HA 3KSYA 4A6FB 3QBVB 4TKNA 5EFXA 3SNHA 5HE2A 1DDMA 2HE7A 3TCAA 2K2UA 3KY9A 4GXBA 2K00A 4D0NB 2G35A 2LOXA 4A6HA 1V5PA 1MK7B 1SHCA 3WYFB 1FOEA 1ISNA 2GS0A 1V88A 3ODWA 3TVVA 3LJUX 5C79A 1U2BA 2UVMA 1WGQA 1M7EA 1XCGA 3AJ4A 3BJIA 3MPXA 2PZ1A 1I7AA 4CYEA 2IYBA 3TFMA 3FSSA 2EMTA 3PEGA 3RCPA 1OY2A 4C0AA 3HQCA 3SV1A 2Q13A 4K2OA 4MT7A 3GYPA 4HB3B 4HDQA 2DYNA 5DH9B 2RLOA 5LOPB 3P6AA 5FI0A 2DKPA 2J0KA 1J19A 2ELAA 1EVHA 1KI1B 2ROVA 3GYOA 2R0DA 1MAIA 2AEHA 3KRXA 2VKIA 1ZC3B 2Z0QA 1FHOA 4WJ7A 3D8EA 4HAYB 2GCLA 3CIKA 4HATB 4GPTB 3ODOA 2DX5A 1FB8A 3PSCA 5DHAB 4IOYX 4P7IA 2DTCA 5DHFB 1BTNA 1WJ1A 2FJLA 3DXDA 2GJYA 2LOZA 3ZDTA 2HTHB 2YSZA 2J0JA 3UZTA 1AWEA 1SGHA 3G9WA 3PVLA 1UNRA 5JLJB 1ZC4B 4MK0A 1EF1A 3V5WA 2NMBA 2DHJA 5HE3A 3SYXA 2D9WA 1M7RA 5D3WA 5D3YA 1BTKA 1I2HA 1PMSA 1XODA 2M38A 2D9XA 5GOWB 3OANA 1NTYA 5D3XA 2I1JA 1RRPB 4CHMA 1Z87A 4NY0A 5HE0A 1WJMA 3ULBA 3T06A 3KRWA 2D11A 2H7EA 1K5GB 2YRYA 5KQ4A 3AU4A 5KCVA 2Y8GA 5DI9B 1PFJA 3PZDA 1OQNA 4HB4B 3DXCA 2LG1A 4Z2MB 4HB2B 2VSZA 2XQNM 2J59M 3U7DA 2CY4A 1BWNA 4K17A 3KZ1A 1GC7A 1P5TA 2CAYA 2X18A 2EJ8A 2W2XD 1FGZA 2CODA 2DKQA 1LW3A 1Y19B 4F7HA 4YL8A 1ZSQA 1XR0B 2J0MA 3HW2B 4K81A 4HAVB 3D8FA 2MFQA 2YF0A 3MDBC 1MIZB 4K2PA 5L81A 5D3VA 2L2IA 1UEFA 1BAKA 1NTVA 2LYDA 2UZRA 5D27A 1IRSA 1Y5OA 1MPHA 4GN1A 1NU2A 4ZRIA 2Z0PA 4HDOA 4XWXA 4PNKA 2JP2A 2DYQA 5HE1A 4MY6A 1V5UA 5JP4A 5DIFB 3X23A 4KVGB 4HAZB 1DDWA 2D4QA 2KCJA 4EMOA 3F5RA 1XD4A 1V5MA 2CY5A 4ZRJA 4DX90 1DROA 2I1KA 2P0DA 2NZ8B 4KHOA 3DXEA 3SO6A 5J3YA 3NSUA 1U5FA 3A98B 2K2JA 2OQBA 1ZM0A 3HK0A 2KUPA 1KZGA 1X1GA 1P6SA 1UNPA 2COCA 2EMSA 2ROZB 3CXBB 2P0FA 3BINA 1UNQA 2RGNB 3AU5A 2QKLA 1UPRA 1V89A 3ZVRA 4HHVA 1MKEA 4TYZA 4WVFB 5C16A 5JHGA 3O96A 5CLQB 1U29A 2QKMA 3PG7A 1Q67A 2W2WA 2P0HA 2LKOA 3QIJA 2DHKA 3IVFA 2GCJA 4YONA 2VRWB 4H8SA 3TW1A 5J3TA 2I5CA 1X86A 2N0YA 2H7DA 4PQ0A 3U8ZA 3ODXA 4KHBB 4EKUA 2YS1A 4A6FA 2RSGA 5KQ1A 2DX1A 2M14A 4KHAA 1U5GA 4HB0B 2IFSA
chains in the Genus database with same CATH superfamily
2Z4DA 4EJNA 3P7ZA 1FGYA 4L6EA 3TO1A 2D2QA 1LB1A 2RNRB 1KZ7A 2OTXA 1V61A 1U5DA 3FM8C 4Z2NA 2YS5A 4HAXB 1AQCA 1EGXA 1DYNA 1K5DB 2W2XC 4A5KA 2RUKB 2RVBB 1MK9B 1XX0A 4F7UP 2DN6A 5C5BA 2E2XA 2ADZA 1U5EA 2MWNB 3ULCA 2CRFA 4HSIA 3ML4A 2D9YA 3FEHA 4DX8A 4QJ4B 1TQZA 2EC1A 1DBHA 1B55A 1QQGA 5JHHA 2D9ZA 2FJUB 1GG3A 1P3RA 1T77A 1N3HA 4Y94A 3SUZA 1W1DA 3F0WA 1TJ6A 2D10A 2MKRA 5FI1A 1H4RA 4HAWB 1H10A 1NI2A 3PP2A 4KAXB 1RJ2A 1QC6A 2P8VA 4GZUA 2D9VA 3D8DA 4GMXB 1MIXA 4F7GA 1ZVRA 2Y7BA 3A8PA 3A8QA 2N23A 1FHXA 5CLLB 1E5WA 4A6KA 3M1IB 2YVCA 1PLSA 1TXDA 2Z0OA 2COFA 2Y8FA 2DLWA 2Z14A 2L1CA 1WG7A 4GNKB 5C6RA 3WA0A 3N7CA 1WGUA 4ZRKA 2YT1A 3VIAA 4IFSA 1UPQA 1J0WA 1W1GA 3U12A 2AL6A 1DDVA 4BBKA 2KGXB 5C5BB 2DA0A 1OMWA 2COAA 4DBBA 3PVWA 1X05A 1U27A 2ELBA 4CHJA 3FVCA 2MDXA 1GC6A 2DFKA 2UZSA 2BCJA 1X1FA 4DXAB 1X11A 2R09A 2KUQA 1FAOA 2DHIA 1XKEA 2YS3A 2V76A 4WSFA 4D6WA 2ZKMX 1EAZA 1WI1A 4HAUB 4B6HA 2I5FA 2K8EA 3PVUA 5J3QA 2ZPYA 1FHWA 2LULA 1WVHA 4GMVA 2YT0A 3QWMA 3VOQA 4IAPA 5LONB 2RRFA 4OSNA 4NSWA 1W1HA 3KSYA 4A6FB 2YT2A 3QBVB 4TKNA 5EFXA 3SNHA 5HE2A 1DDMA 2HE7A 3TCAA 4CSQA 2K2UA 3HIEA 3KY9A 4GXBA 2K00A 4D0NB 2G35A 5IRSA 2LOXA 4A6HA 1V5PA 1MK7B 1SHCA 3WYFB 1FOEA 1ISNA 2GS0A 1V88A 5I2MA 3NW8A 3ODWA 3TVVA 3LJUX 5C79A 1U2BA 2UVMA 1WGQA 2KIGA 1M7EA 1XCGA 3AJ4A 3BJIA 3MPXA 2PZ1A 1I7AA 4CYEA 2IYBA 3TFMA 3FSSA 2EMTA 3PEGA 3RCPA 1OY2A 4C0AA 3HQCA 3SV1A 2Q13A 4K2OA 4MT7A 3GYPA 4HB3B 4HDQA 2DYNA 5DH9B 2RLOA 5LOPB 3P6AA 5FI0A 2DKPA 2J0KA 1J19A 2ELAA 1EVHA 1KI1B 2ROVA 3NWAA 3GYOA 2R0DA 1MAIA 2AEHA 3KRXA 2VKIA 1ZC3B 2Z0QA 1FHOA 4WJ7A 3D8EA 4HAYB 2GCLA 3CIKA 4HATB 5LG4B 4GPTB 3ODOA 4DIXA 2DX5A 5M4YB 1FB8A 3PSCA 5DHAB 4IOYX 4P7IA 2DTCA 5DHFB 1BTNA 1WJ1A 2FJLA 3DXDA 4KHBA 2Z13A 2GJYA 2LOZA 3ZDTA 2HTHB 2YSZA 2J0JA 3UZTA 1AWEA 4OT1A 1SGHA 3G9WA 3PVLA 1UNRA 5JLJB 1ZC4B 4MK0A 1EF1A 3V5WA 2NMBA 2DHJA 5HE3A 3SYXA 2D9WA 1M7RA 5D3WA 5D3YA 1BTKA 1I2HA 1PMSA 1XODA 2M38A 2D9XA 5GOWB 3OANA 1NTYA 5D3XA 2I1JA 1RRPB 4CHMA 1Z87A 4NY0A 5HE0A 1WJMA 3ULBA 3T06A 3KRWA 2D11A 2H7EA 1K5GB 2YRYA 5KQ4A 3AU4A 5KCVA 2Y8GA 5DI9B 1PFJA 3PZDA 1OQNA 4HB4B 3DXCA 2LG1A 4Z2MB 4HB2B 2VSZA 2XQNM 2J59M 3B77A 3U7DA 2CY4A 1BWNA 5I2SA 3HSAA 4K17A 3KZ1A 1GC7A 1P5TA 2CAYA 2X18A 2EJ8A 2W2XD 1FGZA 2CODA 2DKQA 3NWDA 1LW3A 4QXAB 1Y19B 4F7HA 2KR0A 4YL8A 1ZSQA 1XR0B 2J0MA 2KIEA 3DCXA 3HW2B 4K81A 4HAVB 3D8FA 2MFQA 3MDBC 2YF0A 2Z59A 1MIZB 4K2PA 5L81A 5D3VA 2L2IA 1UEFA 1BAKA 1NTVA 2LYDA 2UZRA 4QJ5B 5D27A 1IRSA 1Y5OA 1MPHA 4GN1A 1NU2A 4ZRIA 2Z0PA 4HDOA 4XWXA 4PNKA 2JP2A 2DYQA 5HE1A 4MY6A 1V5UA 5JP4A 5DIFB 3X23A 4KVGB 4HAZB 1DDWA 2D4QA 2GUMA 2KCJA 4EMOA 3F5RA 1XD4A 1V5MA 2CY5A 4ZRJA 4DX90 1DROA 2I1KA 2P0DA 2NZ8B 2R2YA 4KHOA 3DXEA 3SO6A 4L1RA 5J3YA 3NSUA 1U5FA 2K49A 3A98B 2K2JA 2OQBA 1ZM0A 3HK0A 2KUPA 1ZYIA 1KZGA 1X1GA 1P6SA 1UNPA 2COCA 2EMSA 2ROZB 3CXBB 2P0FA 3BINA 1UNQA 2RGNB 3AU5A 2QKLA 1UPRA 1V89A 3ZVRA 4HHVA 1MKEA 4TYZA 4WVFB 5C16A 3NWFA 5JHGA 3O96A 5CLQB 1U29A 2QKMA 3PG7A 1Q67A 2W2WA 4GOUA 2P0HA 2LKOA 3QIJA 2DHKA 3IVFA 2GCJA 4YONA 4QJ3B 2VRWB 4H8SA 3TW1A 5J3TA 2I5CA 1X86A 2N0YA 2H7DA 4PQ0A 3OHMB 3U8ZA 2NBVA 3ODXA 4KHBB 4EKUA 2YS1A 4A6FA 1MI1A 2RSGA 5KQ1A 2DX1A 2M14A 3A58A 4KHAA 1U5GA 4HB0B 2IFSA
chains in the Genus database with same CATH topology
4EJNA 3P7ZA 1FGYA 4L6EA 3TO1A 2D2QA 1LB1A 2RNRB 1KZ7A 2OTXA 1V61A 1U5DA 3FM8C 4Z2NA 2YS5A 4HAXB 1AQCA 1EGXA 1DYNA 1K5DB 2W2XC 4A5KA 2RUKB 2RVBB 1MK9B 1XX0A 4F7UP 2DN6A 5C5BA 2E2XA 2ADZA 1U5EA 2MWNB 3ULCA 2CRFA 3ML4A 2D9YA 3FEHA 4DX8A 1TQZA 2EC1A 1DBHA 1B55A 1QQGA 5JHHA 2D9ZA 1GG3A 1P3RA 1N3HA 4Y94A 3SUZA 1W1DA 3F0WA 1TJ6A 2D10A 2MKRA 5FI1A 1H4RA 4HAWB 1H10A 1NI2A 3PP2A 4KAXB 1RJ2A 1QC6A 2P8VA 4GZUA 2D9VA 3D8DA 4GMXB 1MIXA 4F7GA 1ZVRA 2Y7BA 3A8PA 3A8QA 2N23A 1FHXA 5CLLB 1E5WA 4A6KA 3M1IB 2YVCA 1PLSA 1TXDA 2Z0OA 2COFA 2Y8FA 2DLWA 2L1CA 1WG7A 5C6RA 3WA0A 3N7CA 1WGUA 4ZRKA 2YT1A 3VIAA 4IFSA 1UPQA 1J0WA 1W1GA 2AL6A 1DDVA 4BBKA 2KGXB 5C5BB 2DA0A 1OMWA 2COAA 4DBBA 3PVWA 1X05A 1U27A 2ELBA 4CHJA 2MDXA 1GC6A 2DFKA 2UZSA 2BCJA 1X1FA 4DXAB 1X11A 2R09A 1FAOA 2DHIA 1XKEA 2YS3A 2V76A 4WSFA 1EAZA 1WI1A 4HAUB 4B6HA 2I5FA 3PVUA 5J3QA 2ZPYA 1FHWA 2LULA 1WVHA 4GMVA 2YT0A 3QWMA 3VOQA 4IAPA 5LONB 4NSWA 1W1HA 3KSYA 4A6FB 3QBVB 4TKNA 5EFXA 3SNHA 5HE2A 1DDMA 2HE7A 3TCAA 2K2UA 3KY9A 4GXBA 2K00A 4D0NB 2G35A 2LOXA 4A6HA 1V5PA 1MK7B 1SHCA 3WYFB 1FOEA 1ISNA 2GS0A 1V88A 3ODWA 3TVVA 3LJUX 5C79A 1U2BA 2UVMA 1WGQA 1M7EA 1XCGA 3AJ4A 3BJIA 3MPXA 2PZ1A 1I7AA 4CYEA 2IYBA 3TFMA 3FSSA 2EMTA 3PEGA 3RCPA 1OY2A 4C0AA 3HQCA 3SV1A 2Q13A 4K2OA 4MT7A 3GYPA 4HB3B 4HDQA 2DYNA 5DH9B 2RLOA 5LOPB 3P6AA 5FI0A 2DKPA 2J0KA 1J19A 2ELAA 1EVHA 1KI1B 2ROVA 3GYOA 2R0DA 1MAIA 2AEHA 3KRXA 2VKIA 1ZC3B 2Z0QA 1FHOA 4WJ7A 3D8EA 4HAYB 2GCLA 3CIKA 4HATB 4GPTB 3ODOA 2DX5A 1FB8A 3PSCA 5DHAB 4IOYX 4P7IA 2DTCA 5DHFB 1BTNA 1WJ1A 2FJLA 3DXDA 2GJYA 2LOZA 3ZDTA 2HTHB 2YSZA 2J0JA 3UZTA 1AWEA 1SGHA 3G9WA 3PVLA 1UNRA 5JLJB 1ZC4B 4MK0A 1EF1A 3V5WA 2NMBA 2DHJA 5HE3A 3SYXA 2D9WA 1M7RA 5D3WA 5D3YA 1BTKA 1I2HA 1PMSA 1XODA 2M38A 2D9XA 5GOWB 3OANA 1NTYA 5D3XA 2I1JA 1RRPB 4CHMA 1Z87A 4NY0A 5HE0A 1WJMA 3ULBA 3T06A 3KRWA 2D11A 2H7EA 1K5GB 2YRYA 5KQ4A 3AU4A 5KCVA 2Y8GA 5DI9B 1PFJA 3PZDA 1OQNA 4HB4B 3DXCA 2LG1A 4Z2MB 4HB2B 2VSZA 2XQNM 2J59M 3U7DA 2CY4A 1BWNA 4K17A 3KZ1A 1GC7A 1P5TA 2CAYA 2X18A 2EJ8A 2W2XD 1FGZA 2CODA 2DKQA 1LW3A 1Y19B 4F7HA 4YL8A 1ZSQA 1XR0B 2J0MA 3HW2B 4K81A 4HAVB 3D8FA 2MFQA 2YF0A 3MDBC 1MIZB 4K2PA 5L81A 5D3VA 2L2IA 1UEFA 1BAKA 1NTVA 2LYDA 2UZRA 5D27A 1IRSA 1Y5OA 1MPHA 4GN1A 1NU2A 4ZRIA 2Z0PA 4HDOA 4XWXA 4PNKA 2JP2A 2DYQA 5HE1A 4MY6A 1V5UA 5JP4A 5DIFB 3X23A 4KVGB 4HAZB 1DDWA 2D4QA 2KCJA 4EMOA 3F5RA 1XD4A 1V5MA 2CY5A 4ZRJA 4DX90 1DROA 2I1KA 2P0DA 2NZ8B 4KHOA 3DXEA 3SO6A 5J3YA 3NSUA 1U5FA 3A98B 2K2JA 2OQBA 1ZM0A 3HK0A 2KUPA 1KZGA 1X1GA 1P6SA 1UNPA 2COCA 2EMSA 2ROZB 3CXBB 2P0FA 3BINA 1UNQA 2RGNB 3AU5A 2QKLA 1UPRA 1V89A 3ZVRA 4HHVA 1MKEA 4TYZA 4WVFB 5C16A 5JHGA 3O96A 5CLQB 1U29A 2QKMA 3PG7A 1Q67A 2W2WA 2P0HA 2LKOA 3QIJA 2DHKA 3IVFA 2GCJA 4YONA 2VRWB 4H8SA 3TW1A 5J3TA 2I5CA 1X86A 2N0YA 2H7DA 4PQ0A 3U8ZA 3ODXA 4KHBB 4EKUA 2YS1A 4A6FA 2RSGA 5KQ1A 2DX1A 2M14A 4KHAA 1U5GA 4HB0B 2IFSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EJN A;  3P7Z A;  1FGY A;  4L6E A;  3TO1 A;  2D2Q A;  1LB1 A;  2RNR B;  1KZ7 A;  2OTX A;  1V61 A;  1U5D A;  3FM8 C;  4Z2N A;  2YS5 A;  4HAX B;  1AQC A;  1EGX A;  1DYN A;  1K5D B;  2W2X C;  4A5K A;  2RUK B;  2RVB B;  1MK9 B;  1XX0 A;  4F7U P;  2DN6 A;  5C5B A;  2E2X A;  2ADZ A;  1U5E A;  2MWN B;  3ULC A;  2CRF A;  3ML4 A;  2D9Y A;  3FEH A;  4DX8 A;  1TQZ A;  2EC1 A;  1DBH A;  1B55 A;  1QQG A;  5JHH A;  2D9Z A;  1GG3 A;  1P3R A;  1N3H A;  4Y94 A;  3SUZ A;  1W1D A;  3F0W A;  1TJ6 A;  2D10 A;  2MKR A;  5FI1 A;  1H4R A;  4HAW B;  1H10 A;  1NI2 A;  3PP2 A;  4KAX B;  1RJ2 A;  1QC6 A;  2P8V A;  4GZU A;  2D9V A;  3D8D A;  4GMX B;  1MIX A;  4F7G A;  1ZVR A;  2Y7B A;  3A8P A;  3A8Q A;  2N23 A;  1FHX A;  5CLL B;  1E5W A;  4A6K A;  3M1I B;  2YVC A;  1PLS A;  1TXD A;  2Z0O A;  2COF A;  2Y8F A;  2DLW A;  2L1C A;  1WG7 A;  5C6R A;  3WA0 A;  3N7C A;  1WGU A;  4ZRK A;  2YT1 A;  3VIA A;  4IFS A;  1UPQ A;  1J0W A;  1W1G A;  2AL6 A;  1DDV A;  4BBK A;  2KGX B;  5C5B B;  2DA0 A;  1OMW A;  2COA A;  4DBB A;  3PVW A;  1X05 A;  1U27 A;  2ELB A;  4CHJ A;  2MDX A;  1GC6 A;  2DFK A;  2UZS A;  2BCJ A;  1X1F A;  4DXA B;  1X11 A;  2R09 A;  1FAO A;  2DHI A;  1XKE A;  2YS3 A;  2V76 A;  4WSF A;  1EAZ A;  1WI1 A;  4HAU B;  4B6H A;  2I5F A;  3PVU A;  5J3Q A;  2ZPY A;  1FHW A;  2LUL A;  1WVH A;  4GMV A;  2YT0 A;  3QWM A;  3VOQ A;  4IAP A;  5LON B;  4NSW A;  1W1H A;  3KSY A;  4A6F B;  3QBV B;  4TKN A;  5EFX A;  3SNH A;  5HE2 A;  1DDM A;  2HE7 A;  3TCA A;  2K2U A;  3KY9 A;  4GXB A;  2K00 A;  4D0N B;  2G35 A;  2LOX A;  4A6H A;  1V5P A;  1MK7 B;  1SHC A;  3WYF B;  1FOE A;  1ISN A;  2GS0 A;  1V88 A;  3ODW A;  3TVV A;  3LJU X;  5C79 A;  1U2B A;  2UVM A;  1WGQ A;  1M7E A;  1XCG A;  3AJ4 A;  3BJI A;  3MPX A;  2PZ1 A;  1I7A A;  4CYE A;  2IYB A;  3TFM A;  3FSS A;  2EMT A;  3PEG A;  3RCP A;  1OY2 A;  4C0A A;  3HQC A;  3SV1 A;  2Q13 A;  4K2O A;  4MT7 A;  3GYP A;  4HB3 B;  4HDQ A;  2DYN A;  5DH9 B;  2RLO A;  5LOP B;  3P6A A;  5FI0 A;  2DKP A;  2J0K A;  1J19 A;  2ELA A;  1EVH A;  1KI1 B;  2ROV A;  3GYO A;  2R0D A;  1MAI A;  2AEH A;  3KRX A;  2VKI A;  1ZC3 B;  2Z0Q A;  1FHO A;  4WJ7 A;  3D8E A;  4HAY B;  2GCL A;  3CIK A;  4HAT B;  4GPT B;  3ODO A;  2DX5 A;  1FB8 A;  3PSC A;  5DHA B;  4IOY X;  4P7I A;  2DTC A;  5DHF B;  1BTN A;  1WJ1 A;  2FJL A;  3DXD A;  2GJY A;  2LOZ A;  3ZDT A;  2HTH B;  2YSZ A;  2J0J A;  3UZT A;  1AWE A;  1SGH A;  3G9W A;  3PVL A;  1UNR A;  5JLJ B;  1ZC4 B;  4MK0 A;  1EF1 A;  3V5W A;  2NMB A;  2DHJ A;  5HE3 A;  3SYX A;  2D9W A;  1M7R A;  5D3W A;  5D3Y A;  1BTK A;  1I2H A;  1PMS A;  1XOD A;  2M38 A;  2D9X A;  5GOW B;  3OAN A;  1NTY A;  5D3X A;  2I1J A;  1RRP B;  4CHM A;  1Z87 A;  4NY0 A;  5HE0 A;  1WJM A;  3ULB A;  3T06 A;  3KRW A;  2D11 A;  2H7E A;  1K5G B;  2YRY A;  5KQ4 A;  3AU4 A;  5KCV A;  2Y8G A;  5DI9 B;  1PFJ A;  3PZD A;  1OQN A;  4HB4 B;  3DXC A;  2LG1 A;  4Z2M B;  4HB2 B;  2VSZ A;  2XQN M;  2J59 M;  3U7D A;  2CY4 A;  1BWN A;  4K17 A;  3KZ1 A;  1GC7 A;  1P5T A;  2CAY A;  2X18 A;  2EJ8 A;  2W2X D;  1FGZ A;  2COD A;  2DKQ A;  1LW3 A;  1Y19 B;  4F7H A;  4YL8 A;  1ZSQ A;  1XR0 B;  2J0M A;  3HW2 B;  4K81 A;  4HAV B;  3D8F A;  2MFQ A;  2YF0 A;  3MDB C;  1MIZ B;  4K2P A;  5L81 A;  5D3V A;  2L2I A;  1UEF A;  1BAK A;  1NTV A;  2LYD A;  2UZR A;  5D27 A;  1IRS A;  1Y5O A;  1MPH A;  4GN1 A;  1NU2 A;  4ZRI A;  2Z0P A;  4HDO A;  4XWX A;  4PNK A;  2JP2 A;  2DYQ A;  5HE1 A;  4MY6 A;  1V5U A;  5JP4 A;  5DIF B;  3X23 A;  4KVG B;  4HAZ B;  1DDW A;  2D4Q A;  2KCJ A;  4EMO A;  3F5R A;  1XD4 A;  1V5M A;  2CY5 A;  4ZRJ A;  4DX9 0;  1DRO A;  2I1K A;  2P0D A;  2NZ8 B;  4KHO A;  3DXE A;  3SO6 A;  5J3Y A;  3NSU A;  1U5F A;  3A98 B;  2K2J A;  2OQB A;  1ZM0 A;  3HK0 A;  2KUP A;  1KZG A;  1X1G A;  1P6S A;  1UNP A;  2COC A;  2EMS A;  2ROZ B;  3CXB B;  2P0F A;  3BIN A;  1UNQ A;  2RGN B;  3AU5 A;  2QKL A;  1UPR A;  1V89 A;  3ZVR A;  4HHV A;  1MKE A;  4TYZ A;  4WVF B;  5C16 A;  5JHG A;  3O96 A;  5CLQ B;  1U29 A;  2QKM A;  3PG7 A;  1Q67 A;  2W2W A;  2P0H A;  2LKO A;  3QIJ A;  2DHK A;  3IVF A;  2GCJ A;  4YON A;  2VRW B;  4H8S A;  3TW1 A;  5J3T A;  2I5C A;  1X86 A;  2N0Y A;  2H7D A;  4PQ0 A;  3U8Z A;  3ODX A;  4KHB B;  4EKU A;  2YS1 A;  4A6F A;  2RSG A;  5KQ1 A;  2DX1 A;  2M14 A;  4KHA A;  1U5G A;  4HB0 B;  2IFS A; 
#chains in the Genus database with same CATH topology
 2Z4D A;  4EJN A;  3P7Z A;  1FGY A;  4L6E A;  3TO1 A;  2D2Q A;  1LB1 A;  2RNR B;  1KZ7 A;  2OTX A;  1V61 A;  1U5D A;  3FM8 C;  4Z2N A;  2YS5 A;  4HAX B;  1AQC A;  1EGX A;  1DYN A;  1K5D B;  2W2X C;  4A5K A;  2RUK B;  2RVB B;  1MK9 B;  1XX0 A;  4F7U P;  2DN6 A;  5C5B A;  2E2X A;  2ADZ A;  1U5E A;  2MWN B;  3ULC A;  2CRF A;  4HSI A;  3ML4 A;  2D9Y A;  3FEH A;  4DX8 A;  4QJ4 B;  1TQZ A;  2EC1 A;  1DBH A;  1B55 A;  1QQG A;  5JHH A;  2D9Z A;  2FJU B;  1GG3 A;  1P3R A;  1T77 A;  1N3H A;  4Y94 A;  3SUZ A;  1W1D A;  3F0W A;  1TJ6 A;  2D10 A;  2MKR A;  5FI1 A;  1H4R A;  4HAW B;  1H10 A;  1NI2 A;  3PP2 A;  4KAX B;  1RJ2 A;  1QC6 A;  2P8V A;  4GZU A;  2D9V A;  3D8D A;  4GMX B;  1MIX A;  4F7G A;  1ZVR A;  2Y7B A;  3A8P A;  3A8Q A;  2N23 A;  1FHX A;  5CLL B;  1E5W A;  4A6K A;  3M1I B;  2YVC A;  1PLS A;  1TXD A;  2Z0O A;  2COF A;  2Y8F A;  2DLW A;  2Z14 A;  2L1C A;  1WG7 A;  4GNK B;  5C6R A;  3WA0 A;  3N7C A;  1WGU A;  4ZRK A;  2YT1 A;  3VIA A;  4IFS A;  1UPQ A;  1J0W A;  1W1G A;  3U12 A;  2AL6 A;  1DDV A;  4BBK A;  2KGX B;  5C5B B;  2DA0 A;  1OMW A;  2COA A;  4DBB A;  3PVW A;  1X05 A;  1U27 A;  2ELB A;  4CHJ A;  3FVC A;  2MDX A;  1GC6 A;  2DFK A;  2UZS A;  2BCJ A;  1X1F A;  4DXA B;  1X11 A;  2R09 A;  2KUQ A;  1FAO A;  2DHI A;  1XKE A;  2YS3 A;  2V76 A;  4WSF A;  4D6W A;  2ZKM X;  1EAZ A;  1WI1 A;  4HAU B;  4B6H A;  2I5F A;  2K8E A;  3PVU A;  5J3Q A;  2ZPY A;  1FHW A;  2LUL A;  1WVH A;  4GMV A;  2YT0 A;  3QWM A;  3VOQ A;  4IAP A;  5LON B;  2RRF A;  4OSN A;  4NSW A;  1W1H A;  3KSY A;  4A6F B;  2YT2 A;  3QBV B;  4TKN A;  5EFX A;  3SNH A;  5HE2 A;  1DDM A;  2HE7 A;  3TCA A;  4CSQ A;  2K2U A;  3HIE A;  3KY9 A;  4GXB A;  2K00 A;  4D0N B;  2G35 A;  5IRS A;  2LOX A;  4A6H A;  1V5P A;  1MK7 B;  1SHC A;  3WYF B;  1FOE A;  1ISN A;  2GS0 A;  1V88 A;  5I2M A;  3NW8 A;  3ODW A;  3TVV A;  3LJU X;  5C79 A;  1U2B A;  2UVM A;  1WGQ A;  2KIG A;  1M7E A;  1XCG A;  3AJ4 A;  3BJI A;  3MPX A;  2PZ1 A;  1I7A A;  4CYE A;  2IYB A;  3TFM A;  3FSS A;  2EMT A;  3PEG A;  3RCP A;  1OY2 A;  4C0A A;  3HQC A;  3SV1 A;  2Q13 A;  4K2O A;  4MT7 A;  3GYP A;  4HB3 B;  4HDQ A;  2DYN A;  5DH9 B;  2RLO A;  5LOP B;  3P6A A;  5FI0 A;  2DKP A;  2J0K A;  1J19 A;  2ELA A;  1EVH A;  1KI1 B;  2ROV A;  3NWA A;  3GYO A;  2R0D A;  1MAI A;  2AEH A;  3KRX A;  2VKI A;  1ZC3 B;  2Z0Q A;  1FHO A;  4WJ7 A;  3D8E A;  4HAY B;  2GCL A;  3CIK A;  4HAT B;  5LG4 B;  4GPT B;  3ODO A;  4DIX A;  2DX5 A;  5M4Y B;  1FB8 A;  3PSC A;  5DHA B;  4IOY X;  4P7I A;  2DTC A;  5DHF B;  1BTN A;  1WJ1 A;  2FJL A;  3DXD A;  4KHB A;  2Z13 A;  2GJY A;  2LOZ A;  3ZDT A;  2HTH B;  2YSZ A;  2J0J A;  3UZT A;  1AWE A;  4OT1 A;  1SGH A;  3G9W A;  3PVL A;  1UNR A;  5JLJ B;  1ZC4 B;  4MK0 A;  1EF1 A;  3V5W A;  2NMB A;  2DHJ A;  5HE3 A;  3SYX A;  2D9W A;  1M7R A;  5D3W A;  5D3Y A;  1BTK A;  1I2H A;  1PMS A;  1XOD A;  2M38 A;  2D9X A;  5GOW B;  3OAN A;  1NTY A;  5D3X A;  2I1J A;  1RRP B;  4CHM A;  1Z87 A;  4NY0 A;  5HE0 A;  1WJM A;  3ULB A;  3T06 A;  3KRW A;  2D11 A;  2H7E A;  1K5G B;  2YRY A;  5KQ4 A;  3AU4 A;  5KCV A;  2Y8G A;  5DI9 B;  1PFJ A;  3PZD A;  1OQN A;  4HB4 B;  3DXC A;  2LG1 A;  4Z2M B;  4HB2 B;  2VSZ A;  2XQN M;  2J59 M;  3B77 A;  3U7D A;  2CY4 A;  1BWN A;  5I2S A;  3HSA A;  4K17 A;  3KZ1 A;  1GC7 A;  1P5T A;  2CAY A;  2X18 A;  2EJ8 A;  2W2X D;  1FGZ A;  2COD A;  2DKQ A;  3NWD A;  1LW3 A;  4QXA B;  1Y19 B;  4F7H A;  2KR0 A;  4YL8 A;  1ZSQ A;  1XR0 B;  2J0M A;  2KIE A;  3DCX A;  3HW2 B;  4K81 A;  4HAV B;  3D8F A;  2MFQ A;  3MDB C;  2YF0 A;  2Z59 A;  1MIZ B;  4K2P A;  5L81 A;  5D3V A;  2L2I A;  1UEF A;  1BAK A;  1NTV A;  2LYD A;  2UZR A;  4QJ5 B;  5D27 A;  1IRS A;  1Y5O A;  1MPH A;  4GN1 A;  1NU2 A;  4ZRI A;  2Z0P A;  4HDO A;  4XWX A;  4PNK A;  2JP2 A;  2DYQ A;  5HE1 A;  4MY6 A;  1V5U A;  5JP4 A;  5DIF B;  3X23 A;  4KVG B;  4HAZ B;  1DDW A;  2D4Q A;  2GUM A;  2KCJ A;  4EMO A;  3F5R A;  1XD4 A;  1V5M A;  2CY5 A;  4ZRJ A;  4DX9 0;  1DRO A;  2I1K A;  2P0D A;  2NZ8 B;  2R2Y A;  4KHO A;  3DXE A;  3SO6 A;  4L1R A;  5J3Y A;  3NSU A;  1U5F A;  2K49 A;  3A98 B;  2K2J A;  2OQB A;  1ZM0 A;  3HK0 A;  2KUP A;  1ZYI A;  1KZG A;  1X1G A;  1P6S A;  1UNP A;  2COC A;  2EMS A;  2ROZ B;  3CXB B;  2P0F A;  3BIN A;  1UNQ A;  2RGN B;  3AU5 A;  2QKL A;  1UPR A;  1V89 A;  3ZVR A;  4HHV A;  1MKE A;  4TYZ A;  4WVF B;  5C16 A;  3NWF A;  5JHG A;  3O96 A;  5CLQ B;  1U29 A;  2QKM A;  3PG7 A;  1Q67 A;  2W2W A;  4GOU A;  2P0H A;  2LKO A;  3QIJ A;  2DHK A;  3IVF A;  2GCJ A;  4YON A;  4QJ3 B;  2VRW B;  4H8S A;  3TW1 A;  5J3T A;  2I5C A;  1X86 A;  2N0Y A;  2H7D A;  4PQ0 A;  3OHM B;  3U8Z A;  2NBV A;  3ODX A;  4KHB B;  4EKU A;  2YS1 A;  4A6F A;  1MI1 A;  2RSG A;  5KQ1 A;  2DX1 A;  2M14 A;  3A58 A;  4KHA A;  1U5G A;  4HB0 B;  2IFS A; 
#chains in the Genus database with same CATH homology
 4EJN A;  3P7Z A;  1FGY A;  4L6E A;  3TO1 A;  2D2Q A;  1LB1 A;  2RNR B;  1KZ7 A;  2OTX A;  1V61 A;  1U5D A;  3FM8 C;  4Z2N A;  2YS5 A;  4HAX B;  1AQC A;  1EGX A;  1DYN A;  1K5D B;  2W2X C;  4A5K A;  2RUK B;  2RVB B;  1MK9 B;  1XX0 A;  4F7U P;  2DN6 A;  5C5B A;  2E2X A;  2ADZ A;  1U5E A;  2MWN B;  3ULC A;  2CRF A;  3ML4 A;  2D9Y A;  3FEH A;  4DX8 A;  1TQZ A;  2EC1 A;  1DBH A;  1B55 A;  1QQG A;  5JHH A;  2D9Z A;  1GG3 A;  1P3R A;  1N3H A;  4Y94 A;  3SUZ A;  1W1D A;  3F0W A;  1TJ6 A;  2D10 A;  2MKR A;  5FI1 A;  1H4R A;  4HAW B;  1H10 A;  1NI2 A;  3PP2 A;  4KAX B;  1RJ2 A;  1QC6 A;  2P8V A;  4GZU A;  2D9V A;  3D8D A;  4GMX B;  1MIX A;  4F7G A;  1ZVR A;  2Y7B A;  3A8P A;  3A8Q A;  2N23 A;  1FHX A;  5CLL B;  1E5W A;  4A6K A;  3M1I B;  2YVC A;  1PLS A;  1TXD A;  2Z0O A;  2COF A;  2Y8F A;  2DLW A;  2L1C A;  1WG7 A;  5C6R A;  3WA0 A;  3N7C A;  1WGU A;  4ZRK A;  2YT1 A;  3VIA A;  4IFS A;  1UPQ A;  1J0W A;  1W1G A;  2AL6 A;  1DDV A;  4BBK A;  2KGX B;  5C5B B;  2DA0 A;  1OMW A;  2COA A;  4DBB A;  3PVW A;  1X05 A;  1U27 A;  2ELB A;  4CHJ A;  2MDX A;  1GC6 A;  2DFK A;  2UZS A;  2BCJ A;  1X1F A;  4DXA B;  1X11 A;  2R09 A;  1FAO A;  2DHI A;  1XKE A;  2YS3 A;  2V76 A;  4WSF A;  1EAZ A;  1WI1 A;  4HAU B;  4B6H A;  2I5F A;  3PVU A;  5J3Q A;  2ZPY A;  1FHW A;  2LUL A;  1WVH A;  4GMV A;  2YT0 A;  3QWM A;  3VOQ A;  4IAP A;  5LON B;  4NSW A;  1W1H A;  3KSY A;  4A6F B;  3QBV B;  4TKN A;  5EFX A;  3SNH A;  5HE2 A;  1DDM A;  2HE7 A;  3TCA A;  2K2U A;  3KY9 A;  4GXB A;  2K00 A;  4D0N B;  2G35 A;  2LOX A;  4A6H A;  1V5P A;  1MK7 B;  1SHC A;  3WYF B;  1FOE A;  1ISN A;  2GS0 A;  1V88 A;  3ODW A;  3TVV A;  3LJU X;  5C79 A;  1U2B A;  2UVM A;  1WGQ A;  1M7E A;  1XCG A;  3AJ4 A;  3BJI A;  3MPX A;  2PZ1 A;  1I7A A;  4CYE A;  2IYB A;  3TFM A;  3FSS A;  2EMT A;  3PEG A;  3RCP A;  1OY2 A;  4C0A A;  3HQC A;  3SV1 A;  2Q13 A;  4K2O A;  4MT7 A;  3GYP A;  4HB3 B;  4HDQ A;  2DYN A;  5DH9 B;  2RLO A;  5LOP B;  3P6A A;  5FI0 A;  2DKP A;  2J0K A;  1J19 A;  2ELA A;  1EVH A;  1KI1 B;  2ROV A;  3GYO A;  2R0D A;  1MAI A;  2AEH A;  3KRX A;  2VKI A;  1ZC3 B;  2Z0Q A;  1FHO A;  4WJ7 A;  3D8E A;  4HAY B;  2GCL A;  3CIK A;  4HAT B;  4GPT B;  3ODO A;  2DX5 A;  1FB8 A;  3PSC A;  5DHA B;  4IOY X;  4P7I A;  2DTC A;  5DHF B;  1BTN A;  1WJ1 A;  2FJL A;  3DXD A;  2GJY A;  2LOZ A;  3ZDT A;  2HTH B;  2YSZ A;  2J0J A;  3UZT A;  1AWE A;  1SGH A;  3G9W A;  3PVL A;  1UNR A;  5JLJ B;  1ZC4 B;  4MK0 A;  1EF1 A;  3V5W A;  2NMB A;  2DHJ A;  5HE3 A;  3SYX A;  2D9W A;  1M7R A;  5D3W A;  5D3Y A;  1BTK A;  1I2H A;  1PMS A;  1XOD A;  2M38 A;  2D9X A;  5GOW B;  3OAN A;  1NTY A;  5D3X A;  2I1J A;  1RRP B;  4CHM A;  1Z87 A;  4NY0 A;  5HE0 A;  1WJM A;  3ULB A;  3T06 A;  3KRW A;  2D11 A;  2H7E A;  1K5G B;  2YRY A;  5KQ4 A;  3AU4 A;  5KCV A;  2Y8G A;  5DI9 B;  1PFJ A;  3PZD A;  1OQN A;  4HB4 B;  3DXC A;  2LG1 A;  4Z2M B;  4HB2 B;  2VSZ A;  2XQN M;  2J59 M;  3U7D A;  2CY4 A;  1BWN A;  4K17 A;  3KZ1 A;  1GC7 A;  1P5T A;  2CAY A;  2X18 A;  2EJ8 A;  2W2X D;  1FGZ A;  2COD A;  2DKQ A;  1LW3 A;  1Y19 B;  4F7H A;  4YL8 A;  1ZSQ A;  1XR0 B;  2J0M A;  3HW2 B;  4K81 A;  4HAV B;  3D8F A;  2MFQ A;  2YF0 A;  3MDB C;  1MIZ B;  4K2P A;  5L81 A;  5D3V A;  2L2I A;  1UEF A;  1BAK A;  1NTV A;  2LYD A;  2UZR A;  5D27 A;  1IRS A;  1Y5O A;  1MPH A;  4GN1 A;  1NU2 A;  4ZRI A;  2Z0P A;  4HDO A;  4XWX A;  4PNK A;  2JP2 A;  2DYQ A;  5HE1 A;  4MY6 A;  1V5U A;  5JP4 A;  5DIF B;  3X23 A;  4KVG B;  4HAZ B;  1DDW A;  2D4Q A;  2KCJ A;  4EMO A;  3F5R A;  1XD4 A;  1V5M A;  2CY5 A;  4ZRJ A;  4DX9 0;  1DRO A;  2I1K A;  2P0D A;  2NZ8 B;  4KHO A;  3DXE A;  3SO6 A;  5J3Y A;  3NSU A;  1U5F A;  3A98 B;  2K2J A;  2OQB A;  1ZM0 A;  3HK0 A;  2KUP A;  1KZG A;  1X1G A;  1P6S A;  1UNP A;  2COC A;  2EMS A;  2ROZ B;  3CXB B;  2P0F A;  3BIN A;  1UNQ A;  2RGN B;  3AU5 A;  2QKL A;  1UPR A;  1V89 A;  3ZVR A;  4HHV A;  1MKE A;  4TYZ A;  4WVF B;  5C16 A;  5JHG A;  3O96 A;  5CLQ B;  1U29 A;  2QKM A;  3PG7 A;  1Q67 A;  2W2W A;  2P0H A;  2LKO A;  3QIJ A;  2DHK A;  3IVF A;  2GCJ A;  4YON A;  2VRW B;  4H8S A;  3TW1 A;  5J3T A;  2I5C A;  1X86 A;  2N0Y A;  2H7D A;  4PQ0 A;  3U8Z A;  3ODX A;  4KHB B;  4EKU A;  2YS1 A;  4A6F A;  2RSG A;  5KQ1 A;  2DX1 A;  2M14 A;  4KHA A;  1U5G A;  4HB0 B;  2IFS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...