3SV1A

Crystal structure of app peptide bound rat mint2 parm
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
190
structure length
163
Chain Sequence
GSEDLIDGIIFAANYLGSTQLLSERNPSKNIRMMQAQEAVSRVKRMQKAAKIKKKANQTLTEVDLFISTQRIKVLNADTQETMMDHALRTISYIADIGNIVVLMARRRYKMICHVFESEDAQLIAQSIGQAFSVAYQEFLRANGINPEDLSQKEYSDIINTQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Amyloid beta A4 precursor protein-binding family A member 2
publication title Open-closed motion of Mint2 regulates APP metabolism
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Protein binding
total genus 40
structure length 163
sequence length 190
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2011-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00640 PID Phosphotyrosine interaction domain (PTB/PID)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3sv1A00
3PVUA 2CAYA 3QBVB 4DBBA 2UZSA 1RRPB 1ZC3B 3QWMA 1DDVA 4MK0A 4MY6A 2D9VA 1WGQA 3QIJA 2K2JA 2ELBA 4Z2MB 2MWNB 3F0WA 2GJYA 2LOZA 4EMOA 1NU2A 1XX0A 3TW1A 2Y8GA 3GYOA 2QKMA 3KY9A 3AU5A 4HDOA 2Y7BA 2RNRB 2COFA 1FAOA 2DTCA 3ODOA 4A6HA 2NZ8B 4A5KA 3MPXA 3DXDA 2QKLA 4K81A 4WSFA 2DHJA 3U7DA 3PP2A 2I1JA 2X18A 3KRWA 2D11A 2N23A 2LG1A 4HB2B 5C16A 1PFJA 3D8DA 4KHBB 5J3YA 5KQ4A 5C79A 1FOEA 2AEHA 1J19A 1ZC4B 1DYNA 2GCJA 1U5EA 1OMWA 4HAWB 2I5FA 2E2XA 2N0YA 2D9YA 3GYPA 2KUPA 1EGXA 1EAZA 5JHHA 2ROVA 1UPRA 2L1CA 1UPQA 2DN6A 3ULBA 5LOPB 2MDXA 1M7RA 5D3VA 3AU4A 2J59M 1FHWA 1X05A 1NTVA 1P3RA 5HE0A 5C5BA 2J0MA 1Y19B 3KSYA 2YS5A 4YONA 4WVFB 4PNKA 3LJUX 1MIXA 4WJ7A 2YS1A 1J0WA 3OANA 2DKPA 5LONB 4D0NB 1DDMA 2G35A 4HHVA 2D9WA 3PVWA 4K17A 2HTHB 2Z0PA 2K2UA 2DFKA 4BBKA 3CIKA 1BAKA 1GC6A 2YT1A 1V5UA 1W1HA 2P0HA 3D8EA 2DLWA 2EC1A 2YT0A 1XKEA 1U2BA 4DX90 3ODWA 1WJ1A 2LKOA 2YRYA 2ADZA 2VRWB 1U5GA 1MK7B 2D10A 3U8ZA 3ZDTA 1TXDA 1V5MA 1MAIA 4H8SA 4GXBA 3A8QA 4HAVB 4KHOA 4ZRIA 2I5CA 2D4QA 4F7UP 4TYZA 4F7HA 1DROA 1ZVRA 2YVCA 3FSSA 2RVBB 3RCPA 2DX1A 1V61A 2V76A 2L2IA 5C5BB 3V5WA 1H10A 4DX8A 4P7IA 1WJMA 1UNQA 3TO1A 1M7EA 5CLQB 1QC6A 2ELAA 2LOXA 1U27A 2DHIA 2Z0QA 2D9XA 4KAXB 3F5RA 1FB8A 4EKUA 1KZ7A 4HB4B 3SNHA 4KVGB 2J0KA 2IYBA 2DHKA 1MK9B 3HW2B 1U5DA 2GS0A 3ZVRA 2M38A 1TQZA 5D3XA 4HAXB 3TCAA 1ISNA 2CY4A 1ZSQA 3FM8C 2LYDA 4HAYB 3AJ4A 4F7GA 5D27A 3ULCA 4DXAB 1BTKA 2UZRA 1X1GA 2RUKB 4HATB 2D2QA 2CODA 3VOQA 5KQ1A 1DDWA 1I2HA 2H7DA 2VSZA 1SHCA 1XCGA 3P7ZA 2ZPYA 4IFSA 2ROZB 2COCA 2K00A 3PZDA 3UZTA 3HQCA 4XWXA 4IOYX 1X11A 5FI0A 3NSUA 1PMSA 2XQNM 4GPTB 1E5WA 2YF0A 4HB3B 3PSCA 3PVLA 4K2PA 4L6EA 1P6SA 3ML4A 1U29A 5HE3A 1X86A 1GG3A 2Q13A 2GCLA 1K5DB 1Y5OA 5DHFB 2EJ8A 4GMXB 1PLSA 1NTYA 3DXEA 1DBHA 3A98B 1I7AA 4HAZB 5HE1A 2DX5A 1AQCA 4HDQA 1AWEA 1GC7A 4IAPA 2I1KA 3PEGA 5J3TA 2W2WA 2MFQA 3O96A 3X23A 4GN1A 1IRSA 2NMBA 2P0FA 4Y94A 1XODA 2RSGA 1ZM0A 1K5GB 4K2OA 5C6RA 1OQNA 4PQ0A 2MKRA 2RGNB 2AL6A 2KGXB 3FEHA 1UNPA 2IFSA 3WA0A 1Q67A 2R09A 3BJIA 5HE2A 1FHOA 2VKIA 2R0DA 1UEFA 2LULA 5DIFB 4NSWA 2DYNA 2Z0OA 3WYFB 5J3QA 1W1DA 3T06A 1OY2A 3PG7A 1V89A 2P0DA 2COAA 2BCJA 1QQGA 1MPHA 4YL8A 3CXBB 3KZ1A 3IVFA 2PZ1A 5D3WA 2JP2A 2KCJA 1V88A 3KRXA 2P8VA 1EVHA 4A6FA 5DI9B 4CYEA 1WI1A 1MIZB 1W1GA 5DHAB 1TJ6A 4KHAA 1UNRA 4GMVA 1V5PA 4C0AA 1NI2A 3MDBC 1LB1A 1WVHA 4TKNA 3SYXA 2YS3A 5JP4A 1LW3A 3D8FA 3A8PA 4ZRKA 3DXCA 3ODXA 2W2XD 2DYQA 5EFXA 1P5TA 1WG7A 2HE7A 3HK0A 4GZUA 2CY5A 5D3YA 2EMTA 5CLLB 3P6AA 1BWNA 2DKQA 3M1IB 2CRFA 1BTNA 2UVMA 4CHMA 2Y8FA 1KI1B 3G9WA 3SO6A 4NY0A 1WGUA 5DH9B 5FI1A 1SGHA 2RLOA 4MT7A 5L81A 1B55A 4Z2NA 1N3HA 2H7EA 1KZGA 5GOWB 1H4RA 2YSZA 4ZRJA 5JLJB 2M14A 1MKEA 3BINA 1FHXA 1FGZA 1U5FA 5JHGA 4HAUB 4HB0B 3SV1A 5KCVA 1XD4A 4A6KA 3VIAA 2EMSA 3N7CA 1RJ2A 2DA0A 3SUZA 2J0JA 1FGYA 4EJNA 1X1FA 2OTXA 2FJLA 3TVVA 1EF1A 3TFMA 2W2XC 4B6HA 4CHJA 4A6FB 1Z87A 2D9ZA 1XR0B 2OQBA
chains in the Genus database with same CATH superfamily
3PVUA 2CAYA 3QBVB 4DBBA 2UZSA 1RRPB 1ZC3B 3QWMA 4D6WA 1DDVA 4MK0A 4MY6A 2D9VA 1WGQA 3QIJA 2K2JA 2ELBA 4Z2MB 2MWNB 3F0WA 2GJYA 2LOZA 4EMOA 1NU2A 1XX0A 3TW1A 2Y8GA 3GYOA 2QKMA 3KY9A 3AU5A 4HDOA 2Y7BA 2RNRB 2COFA 3U12A 1FAOA 2DTCA 2R2YA 3ODOA 4A6HA 2NZ8B 4A5KA 3MPXA 3DXDA 2QKLA 4K81A 4WSFA 2DHJA 3U7DA 3PP2A 2I1JA 2X18A 2D11A 3KRWA 2N23A 2LG1A 3NWFA 4HB2B 5C16A 1PFJA 3D8DA 4KHBB 5J3YA 5KQ4A 5C79A 1FOEA 2AEHA 1J19A 1ZC4B 1DYNA 2GCJA 3NWAA 1U5EA 1OMWA 2Z14A 4HAWB 2FJUB 2E2XA 2I5FA 3A58A 2N0YA 2D9YA 3GYPA 4L1RA 2KUPA 4GOUA 3B77A 1EGXA 1EAZA 5JHHA 2ROVA 1UPRA 3NW8A 4GNKB 2L1CA 1UPQA 2DN6A 3HIEA 3ULBA 5LOPB 2MDXA 1M7RA 5D3VA 3AU4A 2J59M 1FHWA 1X05A 1NTVA 1P3RA 5HE0A 5C5BA 2J0MA 1Y19B 3KSYA 2YS5A 4YONA 4WVFB 4PNKA 3LJUX 1MIXA 4WJ7A 2YS1A 4KHBA 5LG4B 1J0WA 3OANA 2DKPA 5I2SA 5LONB 3OHMB 4D0NB 1DDMA 2G35A 4HHVA 5M4YB 2D9WA 3PVWA 4K17A 2HTHB 2Z0PA 2K2UA 2DFKA 4OT1A 4BBKA 3CIKA 1BAKA 1GC6A 2YT1A 1V5UA 1W1HA 2P0HA 3D8EA 2DLWA 2EC1A 2YT0A 1XKEA 1U2BA 2KIGA 4DX90 3ODWA 1WJ1A 2LKOA 2YRYA 2ADZA 2VRWB 1U5GA 1MK7B 2D10A 3U8ZA 3ZDTA 1TXDA 1V5MA 1MAIA 4H8SA 4GXBA 2Z4DA 3A8QA 4HAVB 2Z13A 4KHOA 2Z59A 4ZRIA 2I5CA 2D4QA 4F7UP 4TYZA 4F7HA 1DROA 1ZVRA 2YVCA 3FSSA 2RVBB 3RCPA 2DX1A 1V61A 2V76A 2L2IA 5C5BB 3V5WA 1H10A 4DX8A 4P7IA 1WJMA 1UNQA 4HSIA 3TO1A 1M7EA 5CLQB 1QC6A 2ELAA 2LOXA 1U27A 2DHIA 2Z0QA 5I2MA 2D9XA 4KAXB 3F5RA 1FB8A 4EKUA 1ZYIA 1KZ7A 4HB4B 3SNHA 1MI1A 4KVGB 2K49A 2J0KA 1T77A 2IYBA 2DHKA 4QXAB 1MK9B 3HW2B 1U5DA 2GS0A 3ZVRA 2M38A 1TQZA 3FVCA 5D3XA 4HAXB 3TCAA 1ISNA 2CY4A 1ZSQA 3FM8C 2LYDA 4HAYB 3AJ4A 4F7GA 5D27A 2GUMA 3ULCA 4DXAB 1BTKA 2UZRA 1X1GA 2RUKB 4HATB 2D2QA 2CODA 3VOQA 5KQ1A 1DDWA 1I2HA 2H7DA 2VSZA 1SHCA 1XCGA 3P7ZA 4OSNA 2ZPYA 4IFSA 2ROZB 4CSQA 2COCA 2K00A 3PZDA 3HSAA 3UZTA 3HQCA 4XWXA 2KR0A 4IOYX 1X11A 5FI0A 3NSUA 1PMSA 2XQNM 4GPTB 1E5WA 2YF0A 4HB3B 3PSCA 3PVLA 4K2PA 4L6EA 1P6SA 3ML4A 1U29A 5HE3A 1X86A 1GG3A 2Q13A 2GCLA 1K5DB 1Y5OA 5DHFB 2EJ8A 4GMXB 1PLSA 1NTYA 3DXEA 2K8EA 1DBHA 3A98B 1I7AA 4HAZB 5HE1A 2DX5A 1AQCA 4HDQA 1AWEA 1GC7A 4IAPA 2I1KA 3PEGA 5J3TA 2W2WA 2MFQA 3O96A 3X23A 4GN1A 1IRSA 2NMBA 2P0FA 3DCXA 4Y94A 1XODA 2RSGA 1ZM0A 1K5GB 4K2OA 5C6RA 1OQNA 4PQ0A 2MKRA 2RGNB 2AL6A 2KGXB 3FEHA 1UNPA 2IFSA 2ZKMX 3WA0A 1Q67A 2R09A 3BJIA 5HE2A 1FHOA 2VKIA 2R0DA 1UEFA 2LULA 5DIFB 4NSWA 2DYNA 2Z0OA 3WYFB 5J3QA 1W1DA 3T06A 1OY2A 3PG7A 1V89A 2P0DA 2COAA 2BCJA 1QQGA 1MPHA 4YL8A 3CXBB 3KZ1A 3IVFA 2PZ1A 5D3WA 2JP2A 2KCJA 1V88A 3KRXA 2P8VA 1EVHA 4A6FA 5DI9B 4CYEA 1WI1A 1MIZB 1W1GA 5DHAB 1TJ6A 4KHAA 1UNRA 4GMVA 1V5PA 4C0AA 1NI2A 3MDBC 1LB1A 1WVHA 3NWDA 4TKNA 3SYXA 2YS3A 2RRFA 5JP4A 1LW3A 3D8FA 3A8PA 4ZRKA 3DXCA 3ODXA 2W2XD 2DYQA 5EFXA 1P5TA 1WG7A 2HE7A 3HK0A 4QJ5B 4GZUA 2CY5A 5D3YA 2EMTA 5CLLB 3P6AA 5IRSA 1BWNA 2DKQA 2YT2A 3M1IB 2CRFA 1BTNA 2UVMA 4CHMA 2Y8FA 1KI1B 4DIXA 3G9WA 3SO6A 4NY0A 1WGUA 5DH9B 5FI1A 1SGHA 2RLOA 4MT7A 5L81A 1B55A 4Z2NA 1N3HA 2H7EA 1KZGA 5GOWB 4QJ4B 1H4RA 2YSZA 2KIEA 4ZRJA 5JLJB 2M14A 1MKEA 3BINA 1FHXA 2NBVA 1FGZA 1U5FA 5JHGA 4HAUB 4HB0B 3SV1A 5KCVA 1XD4A 4A6KA 3VIAA 2EMSA 3N7CA 1RJ2A 2DA0A 3SUZA 2J0JA 1FGYA 2KUQA 4EJNA 1X1FA 2OTXA 2FJLA 3TVVA 1EF1A 3TFMA 2W2XC 4QJ3B 4B6HA 4CHJA 4A6FB 1Z87A 2D9ZA 1XR0B 2OQBA
chains in the Genus database with same CATH topology
3PVUA 2CAYA 3QBVB 4DBBA 2UZSA 1RRPB 1ZC3B 3QWMA 1DDVA 4MK0A 4MY6A 2D9VA 1WGQA 3QIJA 2K2JA 2ELBA 4Z2MB 2MWNB 3F0WA 2GJYA 2LOZA 4EMOA 1NU2A 1XX0A 3TW1A 2Y8GA 3GYOA 2QKMA 3KY9A 3AU5A 4HDOA 2Y7BA 2RNRB 2COFA 1FAOA 2DTCA 3ODOA 4A6HA 2NZ8B 4A5KA 3MPXA 3DXDA 2QKLA 4K81A 4WSFA 2DHJA 3U7DA 3PP2A 2I1JA 2X18A 3KRWA 2D11A 2N23A 2LG1A 4HB2B 5C16A 1PFJA 3D8DA 4KHBB 5J3YA 5KQ4A 5C79A 1FOEA 2AEHA 1J19A 1ZC4B 1DYNA 2GCJA 1U5EA 1OMWA 4HAWB 2I5FA 2E2XA 2N0YA 2D9YA 3GYPA 2KUPA 1EGXA 1EAZA 5JHHA 2ROVA 1UPRA 2L1CA 1UPQA 2DN6A 3ULBA 5LOPB 2MDXA 1M7RA 5D3VA 3AU4A 2J59M 1FHWA 1X05A 1NTVA 1P3RA 5HE0A 5C5BA 2J0MA 1Y19B 3KSYA 2YS5A 4YONA 4WVFB 4PNKA 3LJUX 1MIXA 4WJ7A 2YS1A 1J0WA 3OANA 2DKPA 5LONB 4D0NB 1DDMA 2G35A 4HHVA 2D9WA 3PVWA 4K17A 2HTHB 2Z0PA 2K2UA 2DFKA 4BBKA 3CIKA 1BAKA 1GC6A 2YT1A 1V5UA 1W1HA 2P0HA 3D8EA 2DLWA 2EC1A 2YT0A 1XKEA 1U2BA 4DX90 3ODWA 1WJ1A 2LKOA 2YRYA 2ADZA 2VRWB 1U5GA 1MK7B 2D10A 3U8ZA 3ZDTA 1TXDA 1V5MA 1MAIA 4H8SA 4GXBA 3A8QA 4HAVB 4KHOA 4ZRIA 2I5CA 2D4QA 4F7UP 4TYZA 4F7HA 1DROA 1ZVRA 2YVCA 3FSSA 2RVBB 3RCPA 2DX1A 1V61A 2V76A 2L2IA 5C5BB 3V5WA 1H10A 4DX8A 4P7IA 1WJMA 1UNQA 3TO1A 1M7EA 5CLQB 1QC6A 2ELAA 2LOXA 1U27A 2DHIA 2Z0QA 2D9XA 4KAXB 3F5RA 1FB8A 4EKUA 1KZ7A 4HB4B 3SNHA 4KVGB 2J0KA 2IYBA 2DHKA 1MK9B 3HW2B 1U5DA 2GS0A 3ZVRA 2M38A 1TQZA 5D3XA 4HAXB 3TCAA 1ISNA 2CY4A 1ZSQA 3FM8C 2LYDA 4HAYB 3AJ4A 4F7GA 5D27A 3ULCA 4DXAB 1BTKA 2UZRA 1X1GA 2RUKB 4HATB 2D2QA 2CODA 3VOQA 5KQ1A 1DDWA 1I2HA 2H7DA 2VSZA 1SHCA 1XCGA 3P7ZA 2ZPYA 4IFSA 2ROZB 2COCA 2K00A 3PZDA 3UZTA 3HQCA 4XWXA 4IOYX 1X11A 5FI0A 3NSUA 1PMSA 2XQNM 4GPTB 1E5WA 2YF0A 4HB3B 3PSCA 3PVLA 4K2PA 4L6EA 1P6SA 3ML4A 1U29A 5HE3A 1X86A 1GG3A 2Q13A 2GCLA 1K5DB 1Y5OA 5DHFB 2EJ8A 4GMXB 1PLSA 1NTYA 3DXEA 1DBHA 3A98B 1I7AA 4HAZB 5HE1A 2DX5A 1AQCA 4HDQA 1AWEA 1GC7A 4IAPA 2I1KA 3PEGA 5J3TA 2W2WA 2MFQA 3O96A 3X23A 4GN1A 1IRSA 2NMBA 2P0FA 4Y94A 1XODA 2RSGA 1ZM0A 1K5GB 4K2OA 5C6RA 1OQNA 4PQ0A 2MKRA 2RGNB 2AL6A 2KGXB 3FEHA 1UNPA 2IFSA 3WA0A 1Q67A 2R09A 3BJIA 5HE2A 1FHOA 2VKIA 2R0DA 1UEFA 2LULA 5DIFB 4NSWA 2DYNA 2Z0OA 3WYFB 5J3QA 1W1DA 3T06A 1OY2A 3PG7A 1V89A 2P0DA 2COAA 2BCJA 1QQGA 1MPHA 4YL8A 3CXBB 3KZ1A 3IVFA 2PZ1A 5D3WA 2JP2A 2KCJA 1V88A 3KRXA 2P8VA 1EVHA 4A6FA 5DI9B 4CYEA 1WI1A 1MIZB 1W1GA 5DHAB 1TJ6A 4KHAA 1UNRA 4GMVA 1V5PA 4C0AA 1NI2A 3MDBC 1LB1A 1WVHA 4TKNA 3SYXA 2YS3A 5JP4A 1LW3A 3D8FA 3A8PA 4ZRKA 3DXCA 3ODXA 2W2XD 2DYQA 5EFXA 1P5TA 1WG7A 2HE7A 3HK0A 4GZUA 2CY5A 5D3YA 2EMTA 5CLLB 3P6AA 1BWNA 2DKQA 3M1IB 2CRFA 1BTNA 2UVMA 4CHMA 2Y8FA 1KI1B 3G9WA 3SO6A 4NY0A 1WGUA 5DH9B 5FI1A 1SGHA 2RLOA 4MT7A 5L81A 1B55A 4Z2NA 1N3HA 2H7EA 1KZGA 5GOWB 1H4RA 2YSZA 4ZRJA 5JLJB 2M14A 1MKEA 3BINA 1FHXA 1FGZA 1U5FA 5JHGA 4HAUB 4HB0B 3SV1A 5KCVA 1XD4A 4A6KA 3VIAA 2EMSA 3N7CA 1RJ2A 2DA0A 3SUZA 2J0JA 1FGYA 4EJNA 1X1FA 2OTXA 2FJLA 3TVVA 1EF1A 3TFMA 2W2XC 4B6HA 4CHJA 4A6FB 1Z87A 2D9ZA 1XR0B 2OQBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PVU A;  2CAY A;  3QBV B;  4DBB A;  2UZS A;  1RRP B;  1ZC3 B;  3QWM A;  1DDV A;  4MK0 A;  4MY6 A;  2D9V A;  1WGQ A;  3QIJ A;  2K2J A;  2ELB A;  4Z2M B;  2MWN B;  3F0W A;  2GJY A;  2LOZ A;  4EMO A;  1NU2 A;  1XX0 A;  3TW1 A;  2Y8G A;  3GYO A;  2QKM A;  3KY9 A;  3AU5 A;  4HDO A;  2Y7B A;  2RNR B;  2COF A;  1FAO A;  2DTC A;  3ODO A;  4A6H A;  2NZ8 B;  4A5K A;  3MPX A;  3DXD A;  2QKL A;  4K81 A;  4WSF A;  2DHJ A;  3U7D A;  3PP2 A;  2I1J A;  2X18 A;  3KRW A;  2D11 A;  2N23 A;  2LG1 A;  4HB2 B;  5C16 A;  1PFJ A;  3D8D A;  4KHB B;  5J3Y A;  5KQ4 A;  5C79 A;  1FOE A;  2AEH A;  1J19 A;  1ZC4 B;  1DYN A;  2GCJ A;  1U5E A;  1OMW A;  4HAW B;  2I5F A;  2E2X A;  2N0Y A;  2D9Y A;  3GYP A;  2KUP A;  1EGX A;  1EAZ A;  5JHH A;  2ROV A;  1UPR A;  2L1C A;  1UPQ A;  2DN6 A;  3ULB A;  5LOP B;  2MDX A;  1M7R A;  5D3V A;  3AU4 A;  2J59 M;  1FHW A;  1X05 A;  1NTV A;  1P3R A;  5HE0 A;  5C5B A;  2J0M A;  1Y19 B;  3KSY A;  2YS5 A;  4YON A;  4WVF B;  4PNK A;  3LJU X;  1MIX A;  4WJ7 A;  2YS1 A;  1J0W A;  3OAN A;  2DKP A;  5LON B;  4D0N B;  1DDM A;  2G35 A;  4HHV A;  2D9W A;  3PVW A;  4K17 A;  2HTH B;  2Z0P A;  2K2U A;  2DFK A;  4BBK A;  3CIK A;  1BAK A;  1GC6 A;  2YT1 A;  1V5U A;  1W1H A;  2P0H A;  3D8E A;  2DLW A;  2EC1 A;  2YT0 A;  1XKE A;  1U2B A;  4DX9 0;  3ODW A;  1WJ1 A;  2LKO A;  2YRY A;  2ADZ A;  2VRW B;  1U5G A;  1MK7 B;  2D10 A;  3U8Z A;  3ZDT A;  1TXD A;  1V5M A;  1MAI A;  4H8S A;  4GXB A;  3A8Q A;  4HAV B;  4KHO A;  4ZRI A;  2I5C A;  2D4Q A;  4F7U P;  4TYZ A;  4F7H A;  1DRO A;  1ZVR A;  2YVC A;  3FSS A;  2RVB B;  3RCP A;  2DX1 A;  1V61 A;  2V76 A;  2L2I A;  5C5B B;  3V5W A;  1H10 A;  4DX8 A;  4P7I A;  1WJM A;  1UNQ A;  3TO1 A;  1M7E A;  5CLQ B;  1QC6 A;  2ELA A;  2LOX A;  1U27 A;  2DHI A;  2Z0Q A;  2D9X A;  4KAX B;  3F5R A;  1FB8 A;  4EKU A;  1KZ7 A;  4HB4 B;  3SNH A;  4KVG B;  2J0K A;  2IYB A;  2DHK A;  1MK9 B;  3HW2 B;  1U5D A;  2GS0 A;  3ZVR A;  2M38 A;  1TQZ A;  5D3X A;  4HAX B;  3TCA A;  1ISN A;  2CY4 A;  1ZSQ A;  3FM8 C;  2LYD A;  4HAY B;  3AJ4 A;  4F7G A;  5D27 A;  3ULC A;  4DXA B;  1BTK A;  2UZR A;  1X1G A;  2RUK B;  4HAT B;  2D2Q A;  2COD A;  3VOQ A;  5KQ1 A;  1DDW A;  1I2H A;  2H7D A;  2VSZ A;  1SHC A;  1XCG A;  3P7Z A;  2ZPY A;  4IFS A;  2ROZ B;  2COC A;  2K00 A;  3PZD A;  3UZT A;  3HQC A;  4XWX A;  4IOY X;  1X11 A;  5FI0 A;  3NSU A;  1PMS A;  2XQN M;  4GPT B;  1E5W A;  2YF0 A;  4HB3 B;  3PSC A;  3PVL A;  4K2P A;  4L6E A;  1P6S A;  3ML4 A;  1U29 A;  5HE3 A;  1X86 A;  1GG3 A;  2Q13 A;  2GCL A;  1K5D B;  1Y5O A;  5DHF B;  2EJ8 A;  4GMX B;  1PLS A;  1NTY A;  3DXE A;  1DBH A;  3A98 B;  1I7A A;  4HAZ B;  5HE1 A;  2DX5 A;  1AQC A;  4HDQ A;  1AWE A;  1GC7 A;  4IAP A;  2I1K A;  3PEG A;  5J3T A;  2W2W A;  2MFQ A;  3O96 A;  3X23 A;  4GN1 A;  1IRS A;  2NMB A;  2P0F A;  4Y94 A;  1XOD A;  2RSG A;  1ZM0 A;  1K5G B;  4K2O A;  5C6R A;  1OQN A;  4PQ0 A;  2MKR A;  2RGN B;  2AL6 A;  2KGX B;  3FEH A;  1UNP A;  2IFS A;  3WA0 A;  1Q67 A;  2R09 A;  3BJI A;  5HE2 A;  1FHO A;  2VKI A;  2R0D A;  1UEF A;  2LUL A;  5DIF B;  4NSW A;  2DYN A;  2Z0O A;  3WYF B;  5J3Q A;  1W1D A;  3T06 A;  1OY2 A;  3PG7 A;  1V89 A;  2P0D A;  2COA A;  2BCJ A;  1QQG A;  1MPH A;  4YL8 A;  3CXB B;  3KZ1 A;  3IVF A;  2PZ1 A;  5D3W A;  2JP2 A;  2KCJ A;  1V88 A;  3KRX A;  2P8V A;  1EVH A;  4A6F A;  5DI9 B;  4CYE A;  1WI1 A;  1MIZ B;  1W1G A;  5DHA B;  1TJ6 A;  4KHA A;  1UNR A;  4GMV A;  1V5P A;  4C0A A;  1NI2 A;  3MDB C;  1LB1 A;  1WVH A;  4TKN A;  3SYX A;  2YS3 A;  5JP4 A;  1LW3 A;  3D8F A;  3A8P A;  4ZRK A;  3DXC A;  3ODX A;  2W2X D;  2DYQ A;  5EFX A;  1P5T A;  1WG7 A;  2HE7 A;  3HK0 A;  4GZU A;  2CY5 A;  5D3Y A;  2EMT A;  5CLL B;  3P6A A;  1BWN A;  2DKQ A;  3M1I B;  2CRF A;  1BTN A;  2UVM A;  4CHM A;  2Y8F A;  1KI1 B;  3G9W A;  3SO6 A;  4NY0 A;  1WGU A;  5DH9 B;  5FI1 A;  1SGH A;  2RLO A;  4MT7 A;  5L81 A;  1B55 A;  4Z2N A;  1N3H A;  2H7E A;  1KZG A;  5GOW B;  1H4R A;  2YSZ A;  4ZRJ A;  5JLJ B;  2M14 A;  1MKE A;  3BIN A;  1FHX A;  1FGZ A;  1U5F A;  5JHG A;  4HAU B;  4HB0 B;  3SV1 A;  5KCV A;  1XD4 A;  4A6K A;  3VIA A;  2EMS A;  3N7C A;  1RJ2 A;  2DA0 A;  3SUZ A;  2J0J A;  1FGY A;  4EJN A;  1X1F A;  2OTX A;  2FJL A;  3TVV A;  1EF1 A;  3TFM A;  2W2X C;  4B6H A;  4CHJ A;  4A6F B;  1Z87 A;  2D9Z A;  1XR0 B;  2OQB A; 
#chains in the Genus database with same CATH topology
 3PVU A;  2CAY A;  3QBV B;  4DBB A;  2UZS A;  1RRP B;  1ZC3 B;  3QWM A;  4D6W A;  1DDV A;  4MK0 A;  4MY6 A;  2D9V A;  1WGQ A;  3QIJ A;  2K2J A;  2ELB A;  4Z2M B;  2MWN B;  3F0W A;  2GJY A;  2LOZ A;  4EMO A;  1NU2 A;  1XX0 A;  3TW1 A;  2Y8G A;  3GYO A;  2QKM A;  3KY9 A;  3AU5 A;  4HDO A;  2Y7B A;  2RNR B;  2COF A;  3U12 A;  1FAO A;  2DTC A;  2R2Y A;  3ODO A;  4A6H A;  2NZ8 B;  4A5K A;  3MPX A;  3DXD A;  2QKL A;  4K81 A;  4WSF A;  2DHJ A;  3U7D A;  3PP2 A;  2I1J A;  2X18 A;  2D11 A;  3KRW A;  2N23 A;  2LG1 A;  3NWF A;  4HB2 B;  5C16 A;  1PFJ A;  3D8D A;  4KHB B;  5J3Y A;  5KQ4 A;  5C79 A;  1FOE A;  2AEH A;  1J19 A;  1ZC4 B;  1DYN A;  2GCJ A;  3NWA A;  1U5E A;  1OMW A;  2Z14 A;  4HAW B;  2FJU B;  2E2X A;  2I5F A;  3A58 A;  2N0Y A;  2D9Y A;  3GYP A;  4L1R A;  2KUP A;  4GOU A;  3B77 A;  1EGX A;  1EAZ A;  5JHH A;  2ROV A;  1UPR A;  3NW8 A;  4GNK B;  2L1C A;  1UPQ A;  2DN6 A;  3HIE A;  3ULB A;  5LOP B;  2MDX A;  1M7R A;  5D3V A;  3AU4 A;  2J59 M;  1FHW A;  1X05 A;  1NTV A;  1P3R A;  5HE0 A;  5C5B A;  2J0M A;  1Y19 B;  3KSY A;  2YS5 A;  4YON A;  4WVF B;  4PNK A;  3LJU X;  1MIX A;  4WJ7 A;  2YS1 A;  4KHB A;  5LG4 B;  1J0W A;  3OAN A;  2DKP A;  5I2S A;  5LON B;  3OHM B;  4D0N B;  1DDM A;  2G35 A;  4HHV A;  5M4Y B;  2D9W A;  3PVW A;  4K17 A;  2HTH B;  2Z0P A;  2K2U A;  2DFK A;  4OT1 A;  4BBK A;  3CIK A;  1BAK A;  1GC6 A;  2YT1 A;  1V5U A;  1W1H A;  2P0H A;  3D8E A;  2DLW A;  2EC1 A;  2YT0 A;  1XKE A;  1U2B A;  2KIG A;  4DX9 0;  3ODW A;  1WJ1 A;  2LKO A;  2YRY A;  2ADZ A;  2VRW B;  1U5G A;  1MK7 B;  2D10 A;  3U8Z A;  3ZDT A;  1TXD A;  1V5M A;  1MAI A;  4H8S A;  4GXB A;  2Z4D A;  3A8Q A;  4HAV B;  2Z13 A;  4KHO A;  2Z59 A;  4ZRI A;  2I5C A;  2D4Q A;  4F7U P;  4TYZ A;  4F7H A;  1DRO A;  1ZVR A;  2YVC A;  3FSS A;  2RVB B;  3RCP A;  2DX1 A;  1V61 A;  2V76 A;  2L2I A;  5C5B B;  3V5W A;  1H10 A;  4DX8 A;  4P7I A;  1WJM A;  1UNQ A;  4HSI A;  3TO1 A;  1M7E A;  5CLQ B;  1QC6 A;  2ELA A;  2LOX A;  1U27 A;  2DHI A;  2Z0Q A;  5I2M A;  2D9X A;  4KAX B;  3F5R A;  1FB8 A;  4EKU A;  1ZYI A;  1KZ7 A;  4HB4 B;  3SNH A;  1MI1 A;  4KVG B;  2K49 A;  2J0K A;  1T77 A;  2IYB A;  2DHK A;  4QXA B;  1MK9 B;  3HW2 B;  1U5D A;  2GS0 A;  3ZVR A;  2M38 A;  1TQZ A;  3FVC A;  5D3X A;  4HAX B;  3TCA A;  1ISN A;  2CY4 A;  1ZSQ A;  3FM8 C;  2LYD A;  4HAY B;  3AJ4 A;  4F7G A;  5D27 A;  2GUM A;  3ULC A;  4DXA B;  1BTK A;  2UZR A;  1X1G A;  2RUK B;  4HAT B;  2D2Q A;  2COD A;  3VOQ A;  5KQ1 A;  1DDW A;  1I2H A;  2H7D A;  2VSZ A;  1SHC A;  1XCG A;  3P7Z A;  4OSN A;  2ZPY A;  4IFS A;  2ROZ B;  4CSQ A;  2COC A;  2K00 A;  3PZD A;  3HSA A;  3UZT A;  3HQC A;  4XWX A;  2KR0 A;  4IOY X;  1X11 A;  5FI0 A;  3NSU A;  1PMS A;  2XQN M;  4GPT B;  1E5W A;  2YF0 A;  4HB3 B;  3PSC A;  3PVL A;  4K2P A;  4L6E A;  1P6S A;  3ML4 A;  1U29 A;  5HE3 A;  1X86 A;  1GG3 A;  2Q13 A;  2GCL A;  1K5D B;  1Y5O A;  5DHF B;  2EJ8 A;  4GMX B;  1PLS A;  1NTY A;  3DXE A;  2K8E A;  1DBH A;  3A98 B;  1I7A A;  4HAZ B;  5HE1 A;  2DX5 A;  1AQC A;  4HDQ A;  1AWE A;  1GC7 A;  4IAP A;  2I1K A;  3PEG A;  5J3T A;  2W2W A;  2MFQ A;  3O96 A;  3X23 A;  4GN1 A;  1IRS A;  2NMB A;  2P0F A;  3DCX A;  4Y94 A;  1XOD A;  2RSG A;  1ZM0 A;  1K5G B;  4K2O A;  5C6R A;  1OQN A;  4PQ0 A;  2MKR A;  2RGN B;  2AL6 A;  2KGX B;  3FEH A;  1UNP A;  2IFS A;  2ZKM X;  3WA0 A;  1Q67 A;  2R09 A;  3BJI A;  5HE2 A;  1FHO A;  2VKI A;  2R0D A;  1UEF A;  2LUL A;  5DIF B;  4NSW A;  2DYN A;  2Z0O A;  3WYF B;  5J3Q A;  1W1D A;  3T06 A;  1OY2 A;  3PG7 A;  1V89 A;  2P0D A;  2COA A;  2BCJ A;  1QQG A;  1MPH A;  4YL8 A;  3CXB B;  3KZ1 A;  3IVF A;  2PZ1 A;  5D3W A;  2JP2 A;  2KCJ A;  1V88 A;  3KRX A;  2P8V A;  1EVH A;  4A6F A;  5DI9 B;  4CYE A;  1WI1 A;  1MIZ B;  1W1G A;  5DHA B;  1TJ6 A;  4KHA A;  1UNR A;  4GMV A;  1V5P A;  4C0A A;  1NI2 A;  3MDB C;  1LB1 A;  1WVH A;  3NWD A;  4TKN A;  3SYX A;  2YS3 A;  2RRF A;  5JP4 A;  1LW3 A;  3D8F A;  3A8P A;  4ZRK A;  3DXC A;  3ODX A;  2W2X D;  2DYQ A;  5EFX A;  1P5T A;  1WG7 A;  2HE7 A;  3HK0 A;  4QJ5 B;  4GZU A;  2CY5 A;  5D3Y A;  2EMT A;  5CLL B;  3P6A A;  5IRS A;  1BWN A;  2DKQ A;  2YT2 A;  3M1I B;  2CRF A;  1BTN A;  2UVM A;  4CHM A;  2Y8F A;  1KI1 B;  4DIX A;  3G9W A;  3SO6 A;  4NY0 A;  1WGU A;  5DH9 B;  5FI1 A;  1SGH A;  2RLO A;  4MT7 A;  5L81 A;  1B55 A;  4Z2N A;  1N3H A;  2H7E A;  1KZG A;  5GOW B;  4QJ4 B;  1H4R A;  2YSZ A;  2KIE A;  4ZRJ A;  5JLJ B;  2M14 A;  1MKE A;  3BIN A;  1FHX A;  2NBV A;  1FGZ A;  1U5F A;  5JHG A;  4HAU B;  4HB0 B;  3SV1 A;  5KCV A;  1XD4 A;  4A6K A;  3VIA A;  2EMS A;  3N7C A;  1RJ2 A;  2DA0 A;  3SUZ A;  2J0J A;  1FGY A;  2KUQ A;  4EJN A;  1X1F A;  2OTX A;  2FJL A;  3TVV A;  1EF1 A;  3TFM A;  2W2X C;  4QJ3 B;  4B6H A;  4CHJ A;  4A6F B;  1Z87 A;  2D9Z A;  1XR0 B;  2OQB A; 
#chains in the Genus database with same CATH homology
 3PVU A;  2CAY A;  3QBV B;  4DBB A;  2UZS A;  1RRP B;  1ZC3 B;  3QWM A;  1DDV A;  4MK0 A;  4MY6 A;  2D9V A;  1WGQ A;  3QIJ A;  2K2J A;  2ELB A;  4Z2M B;  2MWN B;  3F0W A;  2GJY A;  2LOZ A;  4EMO A;  1NU2 A;  1XX0 A;  3TW1 A;  2Y8G A;  3GYO A;  2QKM A;  3KY9 A;  3AU5 A;  4HDO A;  2Y7B A;  2RNR B;  2COF A;  1FAO A;  2DTC A;  3ODO A;  4A6H A;  2NZ8 B;  4A5K A;  3MPX A;  3DXD A;  2QKL A;  4K81 A;  4WSF A;  2DHJ A;  3U7D A;  3PP2 A;  2I1J A;  2X18 A;  3KRW A;  2D11 A;  2N23 A;  2LG1 A;  4HB2 B;  5C16 A;  1PFJ A;  3D8D A;  4KHB B;  5J3Y A;  5KQ4 A;  5C79 A;  1FOE A;  2AEH A;  1J19 A;  1ZC4 B;  1DYN A;  2GCJ A;  1U5E A;  1OMW A;  4HAW B;  2I5F A;  2E2X A;  2N0Y A;  2D9Y A;  3GYP A;  2KUP A;  1EGX A;  1EAZ A;  5JHH A;  2ROV A;  1UPR A;  2L1C A;  1UPQ A;  2DN6 A;  3ULB A;  5LOP B;  2MDX A;  1M7R A;  5D3V A;  3AU4 A;  2J59 M;  1FHW A;  1X05 A;  1NTV A;  1P3R A;  5HE0 A;  5C5B A;  2J0M A;  1Y19 B;  3KSY A;  2YS5 A;  4YON A;  4WVF B;  4PNK A;  3LJU X;  1MIX A;  4WJ7 A;  2YS1 A;  1J0W A;  3OAN A;  2DKP A;  5LON B;  4D0N B;  1DDM A;  2G35 A;  4HHV A;  2D9W A;  3PVW A;  4K17 A;  2HTH B;  2Z0P A;  2K2U A;  2DFK A;  4BBK A;  3CIK A;  1BAK A;  1GC6 A;  2YT1 A;  1V5U A;  1W1H A;  2P0H A;  3D8E A;  2DLW A;  2EC1 A;  2YT0 A;  1XKE A;  1U2B A;  4DX9 0;  3ODW A;  1WJ1 A;  2LKO A;  2YRY A;  2ADZ A;  2VRW B;  1U5G A;  1MK7 B;  2D10 A;  3U8Z A;  3ZDT A;  1TXD A;  1V5M A;  1MAI A;  4H8S A;  4GXB A;  3A8Q A;  4HAV B;  4KHO A;  4ZRI A;  2I5C A;  2D4Q A;  4F7U P;  4TYZ A;  4F7H A;  1DRO A;  1ZVR A;  2YVC A;  3FSS A;  2RVB B;  3RCP A;  2DX1 A;  1V61 A;  2V76 A;  2L2I A;  5C5B B;  3V5W A;  1H10 A;  4DX8 A;  4P7I A;  1WJM A;  1UNQ A;  3TO1 A;  1M7E A;  5CLQ B;  1QC6 A;  2ELA A;  2LOX A;  1U27 A;  2DHI A;  2Z0Q A;  2D9X A;  4KAX B;  3F5R A;  1FB8 A;  4EKU A;  1KZ7 A;  4HB4 B;  3SNH A;  4KVG B;  2J0K A;  2IYB A;  2DHK A;  1MK9 B;  3HW2 B;  1U5D A;  2GS0 A;  3ZVR A;  2M38 A;  1TQZ A;  5D3X A;  4HAX B;  3TCA A;  1ISN A;  2CY4 A;  1ZSQ A;  3FM8 C;  2LYD A;  4HAY B;  3AJ4 A;  4F7G A;  5D27 A;  3ULC A;  4DXA B;  1BTK A;  2UZR A;  1X1G A;  2RUK B;  4HAT B;  2D2Q A;  2COD A;  3VOQ A;  5KQ1 A;  1DDW A;  1I2H A;  2H7D A;  2VSZ A;  1SHC A;  1XCG A;  3P7Z A;  2ZPY A;  4IFS A;  2ROZ B;  2COC A;  2K00 A;  3PZD A;  3UZT A;  3HQC A;  4XWX A;  4IOY X;  1X11 A;  5FI0 A;  3NSU A;  1PMS A;  2XQN M;  4GPT B;  1E5W A;  2YF0 A;  4HB3 B;  3PSC A;  3PVL A;  4K2P A;  4L6E A;  1P6S A;  3ML4 A;  1U29 A;  5HE3 A;  1X86 A;  1GG3 A;  2Q13 A;  2GCL A;  1K5D B;  1Y5O A;  5DHF B;  2EJ8 A;  4GMX B;  1PLS A;  1NTY A;  3DXE A;  1DBH A;  3A98 B;  1I7A A;  4HAZ B;  5HE1 A;  2DX5 A;  1AQC A;  4HDQ A;  1AWE A;  1GC7 A;  4IAP A;  2I1K A;  3PEG A;  5J3T A;  2W2W A;  2MFQ A;  3O96 A;  3X23 A;  4GN1 A;  1IRS A;  2NMB A;  2P0F A;  4Y94 A;  1XOD A;  2RSG A;  1ZM0 A;  1K5G B;  4K2O A;  5C6R A;  1OQN A;  4PQ0 A;  2MKR A;  2RGN B;  2AL6 A;  2KGX B;  3FEH A;  1UNP A;  2IFS A;  3WA0 A;  1Q67 A;  2R09 A;  3BJI A;  5HE2 A;  1FHO A;  2VKI A;  2R0D A;  1UEF A;  2LUL A;  5DIF B;  4NSW A;  2DYN A;  2Z0O A;  3WYF B;  5J3Q A;  1W1D A;  3T06 A;  1OY2 A;  3PG7 A;  1V89 A;  2P0D A;  2COA A;  2BCJ A;  1QQG A;  1MPH A;  4YL8 A;  3CXB B;  3KZ1 A;  3IVF A;  2PZ1 A;  5D3W A;  2JP2 A;  2KCJ A;  1V88 A;  3KRX A;  2P8V A;  1EVH A;  4A6F A;  5DI9 B;  4CYE A;  1WI1 A;  1MIZ B;  1W1G A;  5DHA B;  1TJ6 A;  4KHA A;  1UNR A;  4GMV A;  1V5P A;  4C0A A;  1NI2 A;  3MDB C;  1LB1 A;  1WVH A;  4TKN A;  3SYX A;  2YS3 A;  5JP4 A;  1LW3 A;  3D8F A;  3A8P A;  4ZRK A;  3DXC A;  3ODX A;  2W2X D;  2DYQ A;  5EFX A;  1P5T A;  1WG7 A;  2HE7 A;  3HK0 A;  4GZU A;  2CY5 A;  5D3Y A;  2EMT A;  5CLL B;  3P6A A;  1BWN A;  2DKQ A;  3M1I B;  2CRF A;  1BTN A;  2UVM A;  4CHM A;  2Y8F A;  1KI1 B;  3G9W A;  3SO6 A;  4NY0 A;  1WGU A;  5DH9 B;  5FI1 A;  1SGH A;  2RLO A;  4MT7 A;  5L81 A;  1B55 A;  4Z2N A;  1N3H A;  2H7E A;  1KZG A;  5GOW B;  1H4R A;  2YSZ A;  4ZRJ A;  5JLJ B;  2M14 A;  1MKE A;  3BIN A;  1FHX A;  1FGZ A;  1U5F A;  5JHG A;  4HAU B;  4HB0 B;  3SV1 A;  5KCV A;  1XD4 A;  4A6K A;  3VIA A;  2EMS A;  3N7C A;  1RJ2 A;  2DA0 A;  3SUZ A;  2J0J A;  1FGY A;  4EJN A;  1X1F A;  2OTX A;  2FJL A;  3TVV A;  1EF1 A;  3TFM A;  2W2X C;  4B6H A;  4CHJ A;  4A6F B;  1Z87 A;  2D9Z A;  1XR0 B;  2OQB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...