1XODA

Crystal structure of x. tropicalis spred1 evh-1 domain
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
114
structure length
105
Chain Sequence
SYARVRAVVMTRDDSSGGWLQLGGGGLSSVTVSKTEFLVHGERLRDKTVVLECVLRRDLVYNKVTPTFHHWRIGDKKFGLTFQSPADARAFDRGIRRAIEDLSQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Spred1
publication title 1.15A Crystal structure of the X. tropicalis Spred1 EVH1 domain suggests a fourth distinct peptide-binding mechanism within the EVH1 family
pubmed doi rcsb
source organism Xenopus tropicalis
total genus 23
structure length 105
sequence length 114
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00568 WH1 WH1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1xodA00
1V88A 5D27A 2Z0OA 5HE3A 4DX90 2JP2A 1UPQA 3SNHA 2Z0PA 4F7GA 3FM8C 4CYEA 2QKLA 2E2XA 1FGZA 2KUPA 2PZ1A 4B6HA 2RNRB 4DXAB 5DIFB 1BWNA 4TKNA 4A6FA 3KRXA 3HQCA 1N3HA 4KVGB 3BINA 1WGUA 2CY4A 4EMOA 2COFA 2YSZA 2GJYA 4A6HA 1UPRA 2DKQA 1X11A 1Q67A 3HW2B 2COAA 2ZPYA 3D8EA 2MDXA 2K00A 2W2WA 1OQNA 1V61A 2J0MA 2LOZA 3PEGA 4HAVB 2M38A 4NSWA 3SO6A 1XODA 2MFQA 2DA0A 3SYXA 3PVWA 3N7CA 5HE1A 2D9YA 1I2HA 2EC1A 1OY2A 4HAUB 3PSCA 4PQ0A 2BCJA 1M7EA 3P6AA 2D11A 5JHHA 1MIXA 3ML4A 4GN1A 2YS1A 2J0JA 2V76A 1XKEA 5D3YA 3A8QA 2QKMA 2GS0A 3WA0A 1XR0B 2MKRA 3D8FA 3F0WA 4HB3B 4ZRIA 5KCVA 2D4QA 1J19A 1FOEA 1XX0A 2RLOA 3KY9A 3MDBC 3MPXA 4HB4B 5D3XA 2YT1A 1X1FA 1X05A 2OTXA 2KGXB 5GOWB 2IFSA 2DTCA 4F7UP 3OANA 1P3RA 4WVFB 3A8PA 3ZDTA 3FEHA 3GYOA 4IAPA 3KRWA 1DDVA 1IRSA 5D3VA 2DN6A 1B55A 2YT0A 4Z2NA 4K81A 3ZVRA 1W1HA 1FB8A 3FSSA 4HAWB 4ZRJA 4EJNA 3KSYA 1W1DA 2DX1A 3PVUA 1MAIA 4HB0B 4GPTB 4NY0A 1DBHA 2ELBA 5C16A 1FAOA 3QBVB 3T06A 1BAKA 1KZGA 1ZSQA 1AQCA 1QC6A 1WG7A 2ELAA 4HDOA 4MK0A 2UZSA 1DDWA 5JLJB 2N23A 3F5RA 1OMWA 5C79A 1U5GA 1NU2A 4IOYX 1TJ6A 2G35A 1RJ2A 3PG7A 5J3YA 2DHIA 3PZDA 2EMSA 4TYZA 5DH9B 4A6KA 1H4RA 3KZ1A 3RCPA 2OQBA 2KCJA 2VRWB 2DKPA 1V5MA 2ROVA 2L2IA 2R09A 2CRFA 1FHXA 4XWXA 3TW1A 3AU5A 1U2BA 3WYFB 1DDMA 2HTHB 3TCAA 5HE0A 2I1JA 2RSGA 2CAYA 2IYBA 2H7DA 2DYQA 5JP4A 3SV1A 2R0DA 2DFKA 4HAZB 2P0HA 5C5BB 2UVMA 2FJLA 3NSUA 2J59M 1V5UA 3TVVA 4K17A 1DROA 4KHAA 5FI1A 4HAYB 1UEFA 4HAXB 1NI2A 4YL8A 4Y94A 3U7DA 3TO1A 2N0YA 5HE2A 3TFMA 2NZ8B 1DYNA 4HHVA 3PP2A 2W2XC 3ULCA 1GG3A 5DHFB 4A6FB 2EJ8A 2DX5A 1X86A 1W1GA 5C6RA 5J3TA 1TXDA 4KAXB 1UNRA 2CODA 1KI1B 3P7ZA 3DXCA 5KQ4A 1I7AA 1EAZA 2D2QA 2LG1A 1MIZB 1WGQA 4KHOA 2Y7BA 3QWMA 2D9VA 1FGYA 4EKUA 1V89A 1ZC4B 4CHMA 5DI9B 5KQ1A 3GYPA 4MY6A 4A5KA 1E5WA 1NTYA 2ROZB 5LOPB 2VKIA 1UNPA 4BBKA 2I1KA 4WSFA 1NTVA 4F7HA 3VIAA 2AEHA 1V5PA 3IVFA 3DXEA 4K2OA 5D3WA 5C5BA 1ZVRA 2D9XA 1UNQA 1WJMA 1U5EA 1ZM0A 3D8DA 4YONA 3SUZA 2Y8GA 3O96A 3DXDA 1H10A 1QQGA 3M1IB 2MWNB 2EMTA 1ISNA 2P0FA 4HB2B 2P8VA 1MK7B 1U5FA 4GZUA 3U8ZA 2Y8FA 1Z87A 1FHWA 1MKEA 2I5FA 2L1CA 2YS5A 3V5WA 3QIJA 2D9WA 2I5CA 2RGNB 4ZRKA 1SHCA 1EGXA 1K5DB 1GC7A 1KZ7A 3UZTA 2YS3A 2M14A 2XQNM 2YVCA 1GC6A 2H7EA 2VSZA 2D9ZA 2LKOA 1LB1A 2DLWA 2YRYA 2K2JA 2ADZA 3ULBA 4CHJA 5J3QA 1EVHA 4GXBA 1M7RA 2AL6A 1WVHA 3X23A 5FI0A 2DYNA 3G9WA 1U27A 1Y5OA 4H8SA 5CLLB 4PNKA 2DHJA 4GMXB 3HK0A 2D10A 1FHOA 1WI1A 1PLSA 3AU4A 2K2UA 2COCA 4D0NB 2LULA 1AWEA 2HE7A 5L81A 1MK9B 1PFJA 1BTNA 2J0KA 2DHKA 2X18A 1LW3A 3CIKA 1EF1A 1SGHA 5EFXA 2RUKB 4GMVA 2NMBA 4IFSA 1RRPB 2P0DA 4Z2MB 3ODWA 1Y19B 1MPHA 1TQZA 2Z0QA 5CLQB 4DBBA 4HDQA 1WJ1A 5LONB 4L6EA 1XD4A 1U29A 4K2PA 1X1GA 3VOQA 3CXBB 4P7IA 2LYDA 3LJUX 2LOXA 4DX8A 4C0AA 1K5GB 4KHBB 2Q13A 4MT7A 2YF0A 3AJ4A 1P5TA 2GCJA 3ODOA 3A98B 3ODXA 3BJIA 2UZRA 1BTKA 1U5DA 2CY5A 1J0WA 4HATB 2W2XD 4WJ7A 3PVLA 5JHGA 1P6SA 5DHAB 1PMSA 2GCLA 1ZC3B 1XCGA 2RVBB
chains in the Genus database with same CATH superfamily
1V88A 5D27A 2Z0OA 5HE3A 4DX90 2JP2A 1UPQA 3SNHA 2Z0PA 4F7GA 3FM8C 4CYEA 2QKLA 2E2XA 1FGZA 2KUPA 2PZ1A 4B6HA 2RNRB 4DXAB 5DIFB 1BWNA 4TKNA 4A6FA 3KRXA 3HQCA 2YT2A 1N3HA 4KVGB 3BINA 1WGUA 2CY4A 5M4YB 4EMOA 2COFA 5I2MA 2NBVA 2YSZA 3NW8A 2GJYA 4A6HA 4KHBA 1UPRA 2DKQA 1X11A 1Q67A 3HW2B 2COAA 2ZPYA 3D8EA 2MDXA 2K00A 2W2WA 1OQNA 1V61A 2J0MA 2LOZA 3PEGA 4HAVB 2M38A 4NSWA 3SO6A 1XODA 2MFQA 2DA0A 3SYXA 3PVWA 3N7CA 5HE1A 2D9YA 1I2HA 2EC1A 1OY2A 2Z59A 2FJUB 3PSCA 4HAUB 4PQ0A 2BCJA 1M7EA 3P6AA 4L1RA 2D11A 2GUMA 5JHHA 1MIXA 2K49A 3DCXA 3NWAA 3ML4A 4GN1A 2YS1A 2J0JA 2V76A 1XKEA 5D3YA 3A8QA 2QKMA 2GS0A 3WA0A 1XR0B 4OT1A 2RRFA 2MKRA 3D8FA 3F0WA 4HB3B 4ZRIA 5KCVA 2D4QA 1J19A 1FOEA 1XX0A 2RLOA 3KY9A 3MDBC 3MPXA 4HB4B 5D3XA 2YT1A 1X1FA 1X05A 2OTXA 2KGXB 5GOWB 2IFSA 4QJ4B 2R2YA 4GNKB 1MI1A 2DTCA 4F7UP 3OANA 1P3RA 4WVFB 3A8PA 3ZDTA 3FEHA 3GYOA 4IAPA 3KRWA 1DDVA 1IRSA 5D3VA 2DN6A 1B55A 2YT0A 4Z2NA 4K81A 3ZVRA 1W1HA 1FB8A 3FSSA 4HAWB 4ZRJA 4EJNA 3KSYA 1W1DA 2DX1A 3PVUA 1MAIA 4HB0B 4GPTB 4NY0A 1DBHA 1ZYIA 2ZKMX 2ELBA 3A58A 5C16A 1FAOA 3QBVB 3T06A 1BAKA 1KZGA 1ZSQA 1AQCA 1QC6A 1WG7A 2ELAA 4HDOA 4MK0A 2UZSA 1DDWA 5JLJB 5IRSA 2N23A 3F5RA 1OMWA 5C79A 1U5GA 1NU2A 4IOYX 1TJ6A 2G35A 1RJ2A 3PG7A 5J3YA 2DHIA 3PZDA 2EMSA 4TYZA 5DH9B 4A6KA 1H4RA 3KZ1A 3RCPA 2OQBA 2KCJA 5I2SA 2VRWB 2DKPA 1V5MA 2ROVA 2L2IA 2R09A 2CRFA 1FHXA 4XWXA 3TW1A 3AU5A 1U2BA 3WYFB 1DDMA 2HTHB 3TCAA 5HE0A 2I1JA 2RSGA 2CAYA 2IYBA 2H7DA 2DYQA 5JP4A 3SV1A 2R0DA 2DFKA 4HAZB 2P0HA 5C5BB 2UVMA 4D6WA 2FJLA 3NSUA 2J59M 1V5UA 4QJ3B 3TVVA 4K17A 1DROA 4GOUA 4KHAA 5FI1A 4HAYB 2Z14A 1UEFA 4HAXB 1T77A 1NI2A 4YL8A 4Y94A 3U7DA 3TO1A 2N0YA 5HE2A 3TFMA 2NZ8B 1DYNA 4HHVA 3PP2A 2W2XC 3ULCA 1GG3A 5DHFB 4A6FB 2EJ8A 2DX5A 1X86A 1W1GA 5C6RA 5J3TA 1TXDA 4KAXB 3OHMB 1UNRA 2CODA 1KI1B 3P7ZA 3DXCA 5KQ4A 1I7AA 1EAZA 2D2QA 2LG1A 1MIZB 1WGQA 4KHOA 2Y7BA 3QWMA 2D9VA 1FGYA 3NWDA 4EKUA 1V89A 1ZC4B 4CHMA 5DI9B 5KQ1A 3GYPA 4MY6A 4A5KA 1E5WA 1NTYA 2ROZB 5LOPB 2VKIA 1UNPA 4BBKA 2I1KA 4WSFA 1NTVA 4F7HA 3VIAA 3FVCA 2AEHA 1V5PA 3IVFA 3DXEA 4K2OA 3HSAA 5D3WA 5C5BA 1ZVRA 2D9XA 1UNQA 1WJMA 2Z4DA 1U5EA 1ZM0A 3D8DA 4YONA 3SUZA 2Y8GA 3O96A 3DXDA 1H10A 1QQGA 3M1IB 2MWNB 2EMTA 1ISNA 2P0FA 5LG4B 4HB2B 2P8VA 1MK7B 1U5FA 4GZUA 3U8ZA 2Y8FA 1Z87A 1FHWA 1MKEA 2I5FA 2L1CA 2YS5A 3V5WA 3QIJA 2KR0A 2D9WA 2I5CA 2RGNB 4ZRKA 1SHCA 1EGXA 3B77A 1K5DB 1GC7A 1KZ7A 3UZTA 2YS3A 3NWFA 2M14A 4CSQA 2XQNM 2YVCA 1GC6A 2H7EA 2VSZA 2D9ZA 2LKOA 1LB1A 2DLWA 2YRYA 2K2JA 2ADZA 4OSNA 3ULBA 4CHJA 1EVHA 5J3QA 4GXBA 1M7RA 2AL6A 1WVHA 2KIEA 3X23A 5FI0A 2DYNA 3G9WA 4DIXA 1U27A 1Y5OA 4H8SA 5CLLB 4PNKA 2DHJA 4GMXB 3HK0A 2D10A 1FHOA 1WI1A 4HSIA 1PLSA 3AU4A 2K2UA 2COCA 4D0NB 2LULA 1AWEA 2HE7A 5L81A 1MK9B 1PFJA 1BTNA 2J0KA 2DHKA 2X18A 1LW3A 3HIEA 3CIKA 1EF1A 1SGHA 5EFXA 2RUKB 4GMVA 2KUQA 2NMBA 4IFSA 1RRPB 2KIGA 2P0DA 4Z2MB 3ODWA 1Y19B 1MPHA 4QXAB 1TQZA 2Z0QA 5CLQB 4DBBA 4HDQA 1WJ1A 5LONB 4L6EA 1XD4A 1U29A 4K2PA 1X1GA 3VOQA 3CXBB 4P7IA 2LYDA 3LJUX 2LOXA 4QJ5B 4DX8A 4C0AA 1K5GB 4KHBB 2Q13A 4MT7A 2YF0A 3AJ4A 1P5TA 2GCJA 3ODOA 3A98B 3ODXA 3BJIA 2UZRA 1BTKA 1U5DA 2CY5A 1J0WA 4HATB 2W2XD 4WJ7A 3PVLA 2K8EA 5JHGA 1P6SA 2Z13A 5DHAB 3U12A 1PMSA 2GCLA 1ZC3B 1XCGA 2RVBB
chains in the Genus database with same CATH topology
1V88A 5D27A 2Z0OA 5HE3A 4DX90 2JP2A 1UPQA 3SNHA 2Z0PA 4F7GA 3FM8C 4CYEA 2QKLA 2E2XA 1FGZA 2KUPA 2PZ1A 4B6HA 2RNRB 4DXAB 5DIFB 1BWNA 4TKNA 4A6FA 3KRXA 3HQCA 1N3HA 4KVGB 3BINA 1WGUA 2CY4A 4EMOA 2COFA 2YSZA 2GJYA 4A6HA 1UPRA 2DKQA 1X11A 1Q67A 3HW2B 2COAA 2ZPYA 3D8EA 2MDXA 2K00A 2W2WA 1OQNA 1V61A 2J0MA 2LOZA 3PEGA 4HAVB 2M38A 4NSWA 3SO6A 1XODA 2MFQA 2DA0A 3SYXA 3PVWA 3N7CA 5HE1A 2D9YA 1I2HA 2EC1A 1OY2A 4HAUB 3PSCA 4PQ0A 2BCJA 1M7EA 3P6AA 2D11A 5JHHA 1MIXA 3ML4A 4GN1A 2YS1A 2J0JA 2V76A 1XKEA 5D3YA 3A8QA 2QKMA 2GS0A 3WA0A 1XR0B 2MKRA 3D8FA 3F0WA 4HB3B 4ZRIA 5KCVA 2D4QA 1J19A 1FOEA 1XX0A 2RLOA 3KY9A 3MDBC 3MPXA 4HB4B 5D3XA 2YT1A 1X1FA 1X05A 2OTXA 2KGXB 5GOWB 2IFSA 2DTCA 4F7UP 3OANA 1P3RA 4WVFB 3A8PA 3ZDTA 3FEHA 3GYOA 4IAPA 3KRWA 1DDVA 1IRSA 5D3VA 2DN6A 1B55A 2YT0A 4Z2NA 4K81A 3ZVRA 1W1HA 1FB8A 3FSSA 4HAWB 4ZRJA 4EJNA 3KSYA 1W1DA 2DX1A 3PVUA 1MAIA 4HB0B 4GPTB 4NY0A 1DBHA 2ELBA 5C16A 1FAOA 3QBVB 3T06A 1BAKA 1KZGA 1ZSQA 1AQCA 1QC6A 1WG7A 2ELAA 4HDOA 4MK0A 2UZSA 1DDWA 5JLJB 2N23A 3F5RA 1OMWA 5C79A 1U5GA 1NU2A 4IOYX 1TJ6A 2G35A 1RJ2A 3PG7A 5J3YA 2DHIA 3PZDA 2EMSA 4TYZA 5DH9B 4A6KA 1H4RA 3KZ1A 3RCPA 2OQBA 2KCJA 2VRWB 2DKPA 1V5MA 2ROVA 2L2IA 2R09A 2CRFA 1FHXA 4XWXA 3TW1A 3AU5A 1U2BA 3WYFB 1DDMA 2HTHB 3TCAA 5HE0A 2I1JA 2RSGA 2CAYA 2IYBA 2H7DA 2DYQA 5JP4A 3SV1A 2R0DA 2DFKA 4HAZB 2P0HA 5C5BB 2UVMA 2FJLA 3NSUA 2J59M 1V5UA 3TVVA 4K17A 1DROA 4KHAA 5FI1A 4HAYB 1UEFA 4HAXB 1NI2A 4YL8A 4Y94A 3U7DA 3TO1A 2N0YA 5HE2A 3TFMA 2NZ8B 1DYNA 4HHVA 3PP2A 2W2XC 3ULCA 1GG3A 5DHFB 4A6FB 2EJ8A 2DX5A 1X86A 1W1GA 5C6RA 5J3TA 1TXDA 4KAXB 1UNRA 2CODA 1KI1B 3P7ZA 3DXCA 5KQ4A 1I7AA 1EAZA 2D2QA 2LG1A 1MIZB 1WGQA 4KHOA 2Y7BA 3QWMA 2D9VA 1FGYA 4EKUA 1V89A 1ZC4B 4CHMA 5DI9B 5KQ1A 3GYPA 4MY6A 4A5KA 1E5WA 1NTYA 2ROZB 5LOPB 2VKIA 1UNPA 4BBKA 2I1KA 4WSFA 1NTVA 4F7HA 3VIAA 2AEHA 1V5PA 3IVFA 3DXEA 4K2OA 5D3WA 5C5BA 1ZVRA 2D9XA 1UNQA 1WJMA 1U5EA 1ZM0A 3D8DA 4YONA 3SUZA 2Y8GA 3O96A 3DXDA 1H10A 1QQGA 3M1IB 2MWNB 2EMTA 1ISNA 2P0FA 4HB2B 2P8VA 1MK7B 1U5FA 4GZUA 3U8ZA 2Y8FA 1Z87A 1FHWA 1MKEA 2I5FA 2L1CA 2YS5A 3V5WA 3QIJA 2D9WA 2I5CA 2RGNB 4ZRKA 1SHCA 1EGXA 1K5DB 1GC7A 1KZ7A 3UZTA 2YS3A 2M14A 2XQNM 2YVCA 1GC6A 2H7EA 2VSZA 2D9ZA 2LKOA 1LB1A 2DLWA 2YRYA 2K2JA 2ADZA 3ULBA 4CHJA 5J3QA 1EVHA 4GXBA 1M7RA 2AL6A 1WVHA 3X23A 5FI0A 2DYNA 3G9WA 1U27A 1Y5OA 4H8SA 5CLLB 4PNKA 2DHJA 4GMXB 3HK0A 2D10A 1FHOA 1WI1A 1PLSA 3AU4A 2K2UA 2COCA 4D0NB 2LULA 1AWEA 2HE7A 5L81A 1MK9B 1PFJA 1BTNA 2J0KA 2DHKA 2X18A 1LW3A 3CIKA 1EF1A 1SGHA 5EFXA 2RUKB 4GMVA 2NMBA 4IFSA 1RRPB 2P0DA 4Z2MB 3ODWA 1Y19B 1MPHA 1TQZA 2Z0QA 5CLQB 4DBBA 4HDQA 1WJ1A 5LONB 4L6EA 1XD4A 1U29A 4K2PA 1X1GA 3VOQA 3CXBB 4P7IA 2LYDA 3LJUX 2LOXA 4DX8A 4C0AA 1K5GB 4KHBB 2Q13A 4MT7A 2YF0A 3AJ4A 1P5TA 2GCJA 3ODOA 3A98B 3ODXA 3BJIA 2UZRA 1BTKA 1U5DA 2CY5A 1J0WA 4HATB 2W2XD 4WJ7A 3PVLA 5JHGA 1P6SA 5DHAB 1PMSA 2GCLA 1ZC3B 1XCGA 2RVBB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1V88 A;  5D27 A;  2Z0O A;  5HE3 A;  4DX9 0;  2JP2 A;  1UPQ A;  3SNH A;  2Z0P A;  4F7G A;  3FM8 C;  4CYE A;  2QKL A;  2E2X A;  1FGZ A;  2KUP A;  2PZ1 A;  4B6H A;  2RNR B;  4DXA B;  5DIF B;  1BWN A;  4TKN A;  4A6F A;  3KRX A;  3HQC A;  1N3H A;  4KVG B;  3BIN A;  1WGU A;  2CY4 A;  4EMO A;  2COF A;  2YSZ A;  2GJY A;  4A6H A;  1UPR A;  2DKQ A;  1X11 A;  1Q67 A;  3HW2 B;  2COA A;  2ZPY A;  3D8E A;  2MDX A;  2K00 A;  2W2W A;  1OQN A;  1V61 A;  2J0M A;  2LOZ A;  3PEG A;  4HAV B;  2M38 A;  4NSW A;  3SO6 A;  1XOD A;  2MFQ A;  2DA0 A;  3SYX A;  3PVW A;  3N7C A;  5HE1 A;  2D9Y A;  1I2H A;  2EC1 A;  1OY2 A;  4HAU B;  3PSC A;  4PQ0 A;  2BCJ A;  1M7E A;  3P6A A;  2D11 A;  5JHH A;  1MIX A;  3ML4 A;  4GN1 A;  2YS1 A;  2J0J A;  2V76 A;  1XKE A;  5D3Y A;  3A8Q A;  2QKM A;  2GS0 A;  3WA0 A;  1XR0 B;  2MKR A;  3D8F A;  3F0W A;  4HB3 B;  4ZRI A;  5KCV A;  2D4Q A;  1J19 A;  1FOE A;  1XX0 A;  2RLO A;  3KY9 A;  3MDB C;  3MPX A;  4HB4 B;  5D3X A;  2YT1 A;  1X1F A;  1X05 A;  2OTX A;  2KGX B;  5GOW B;  2IFS A;  2DTC A;  4F7U P;  3OAN A;  1P3R A;  4WVF B;  3A8P A;  3ZDT A;  3FEH A;  3GYO A;  4IAP A;  3KRW A;  1DDV A;  1IRS A;  5D3V A;  2DN6 A;  1B55 A;  2YT0 A;  4Z2N A;  4K81 A;  3ZVR A;  1W1H A;  1FB8 A;  3FSS A;  4HAW B;  4ZRJ A;  4EJN A;  3KSY A;  1W1D A;  2DX1 A;  3PVU A;  1MAI A;  4HB0 B;  4GPT B;  4NY0 A;  1DBH A;  2ELB A;  5C16 A;  1FAO A;  3QBV B;  3T06 A;  1BAK A;  1KZG A;  1ZSQ A;  1AQC A;  1QC6 A;  1WG7 A;  2ELA A;  4HDO A;  4MK0 A;  2UZS A;  1DDW A;  5JLJ B;  2N23 A;  3F5R A;  1OMW A;  5C79 A;  1U5G A;  1NU2 A;  4IOY X;  1TJ6 A;  2G35 A;  1RJ2 A;  3PG7 A;  5J3Y A;  2DHI A;  3PZD A;  2EMS A;  4TYZ A;  5DH9 B;  4A6K A;  1H4R A;  3KZ1 A;  3RCP A;  2OQB A;  2KCJ A;  2VRW B;  2DKP A;  1V5M A;  2ROV A;  2L2I A;  2R09 A;  2CRF A;  1FHX A;  4XWX A;  3TW1 A;  3AU5 A;  1U2B A;  3WYF B;  1DDM A;  2HTH B;  3TCA A;  5HE0 A;  2I1J A;  2RSG A;  2CAY A;  2IYB A;  2H7D A;  2DYQ A;  5JP4 A;  3SV1 A;  2R0D A;  2DFK A;  4HAZ B;  2P0H A;  5C5B B;  2UVM A;  2FJL A;  3NSU A;  2J59 M;  1V5U A;  3TVV A;  4K17 A;  1DRO A;  4KHA A;  5FI1 A;  4HAY B;  1UEF A;  4HAX B;  1NI2 A;  4YL8 A;  4Y94 A;  3U7D A;  3TO1 A;  2N0Y A;  5HE2 A;  3TFM A;  2NZ8 B;  1DYN A;  4HHV A;  3PP2 A;  2W2X C;  3ULC A;  1GG3 A;  5DHF B;  4A6F B;  2EJ8 A;  2DX5 A;  1X86 A;  1W1G A;  5C6R A;  5J3T A;  1TXD A;  4KAX B;  1UNR A;  2COD A;  1KI1 B;  3P7Z A;  3DXC A;  5KQ4 A;  1I7A A;  1EAZ A;  2D2Q A;  2LG1 A;  1MIZ B;  1WGQ A;  4KHO A;  2Y7B A;  3QWM A;  2D9V A;  1FGY A;  4EKU A;  1V89 A;  1ZC4 B;  4CHM A;  5DI9 B;  5KQ1 A;  3GYP A;  4MY6 A;  4A5K A;  1E5W A;  1NTY A;  2ROZ B;  5LOP B;  2VKI A;  1UNP A;  4BBK A;  2I1K A;  4WSF A;  1NTV A;  4F7H A;  3VIA A;  2AEH A;  1V5P A;  3IVF A;  3DXE A;  4K2O A;  5D3W A;  5C5B A;  1ZVR A;  2D9X A;  1UNQ A;  1WJM A;  1U5E A;  1ZM0 A;  3D8D A;  4YON A;  3SUZ A;  2Y8G A;  3O96 A;  3DXD A;  1H10 A;  1QQG A;  3M1I B;  2MWN B;  2EMT A;  1ISN A;  2P0F A;  4HB2 B;  2P8V A;  1MK7 B;  1U5F A;  4GZU A;  3U8Z A;  2Y8F A;  1Z87 A;  1FHW A;  1MKE A;  2I5F A;  2L1C A;  2YS5 A;  3V5W A;  3QIJ A;  2D9W A;  2I5C A;  2RGN B;  4ZRK A;  1SHC A;  1EGX A;  1K5D B;  1GC7 A;  1KZ7 A;  3UZT A;  2YS3 A;  2M14 A;  2XQN M;  2YVC A;  1GC6 A;  2H7E A;  2VSZ A;  2D9Z A;  2LKO A;  1LB1 A;  2DLW A;  2YRY A;  2K2J A;  2ADZ A;  3ULB A;  4CHJ A;  5J3Q A;  1EVH A;  4GXB A;  1M7R A;  2AL6 A;  1WVH A;  3X23 A;  5FI0 A;  2DYN A;  3G9W A;  1U27 A;  1Y5O A;  4H8S A;  5CLL B;  4PNK A;  2DHJ A;  4GMX B;  3HK0 A;  2D10 A;  1FHO A;  1WI1 A;  1PLS A;  3AU4 A;  2K2U A;  2COC A;  4D0N B;  2LUL A;  1AWE A;  2HE7 A;  5L81 A;  1MK9 B;  1PFJ A;  1BTN A;  2J0K A;  2DHK A;  2X18 A;  1LW3 A;  3CIK A;  1EF1 A;  1SGH A;  5EFX A;  2RUK B;  4GMV A;  2NMB A;  4IFS A;  1RRP B;  2P0D A;  4Z2M B;  3ODW A;  1Y19 B;  1MPH A;  1TQZ A;  2Z0Q A;  5CLQ B;  4DBB A;  4HDQ A;  1WJ1 A;  5LON B;  4L6E A;  1XD4 A;  1U29 A;  4K2P A;  1X1G A;  3VOQ A;  3CXB B;  4P7I A;  2LYD A;  3LJU X;  2LOX A;  4DX8 A;  4C0A A;  1K5G B;  4KHB B;  2Q13 A;  4MT7 A;  2YF0 A;  3AJ4 A;  1P5T A;  2GCJ A;  3ODO A;  3A98 B;  3ODX A;  3BJI A;  2UZR A;  1BTK A;  1U5D A;  2CY5 A;  1J0W A;  4HAT B;  2W2X D;  4WJ7 A;  3PVL A;  5JHG A;  1P6S A;  5DHA B;  1PMS A;  2GCL A;  1ZC3 B;  1XCG A;  2RVB B; 
#chains in the Genus database with same CATH topology
 1V88 A;  5D27 A;  2Z0O A;  5HE3 A;  4DX9 0;  2JP2 A;  1UPQ A;  3SNH A;  2Z0P A;  4F7G A;  3FM8 C;  4CYE A;  2QKL A;  2E2X A;  1FGZ A;  2KUP A;  2PZ1 A;  4B6H A;  2RNR B;  4DXA B;  5DIF B;  1BWN A;  4TKN A;  4A6F A;  3KRX A;  3HQC A;  2YT2 A;  1N3H A;  4KVG B;  3BIN A;  1WGU A;  2CY4 A;  5M4Y B;  4EMO A;  2COF A;  5I2M A;  2NBV A;  2YSZ A;  3NW8 A;  2GJY A;  4A6H A;  4KHB A;  1UPR A;  2DKQ A;  1X11 A;  1Q67 A;  3HW2 B;  2COA A;  2ZPY A;  3D8E A;  2MDX A;  2K00 A;  2W2W A;  1OQN A;  1V61 A;  2J0M A;  2LOZ A;  3PEG A;  4HAV B;  2M38 A;  4NSW A;  3SO6 A;  1XOD A;  2MFQ A;  2DA0 A;  3SYX A;  3PVW A;  3N7C A;  5HE1 A;  2D9Y A;  1I2H A;  2EC1 A;  1OY2 A;  2Z59 A;  2FJU B;  3PSC A;  4HAU B;  4PQ0 A;  2BCJ A;  1M7E A;  3P6A A;  4L1R A;  2D11 A;  2GUM A;  5JHH A;  1MIX A;  2K49 A;  3DCX A;  3NWA A;  3ML4 A;  4GN1 A;  2YS1 A;  2J0J A;  2V76 A;  1XKE A;  5D3Y A;  3A8Q A;  2QKM A;  2GS0 A;  3WA0 A;  1XR0 B;  4OT1 A;  2RRF A;  2MKR A;  3D8F A;  3F0W A;  4HB3 B;  4ZRI A;  5KCV A;  2D4Q A;  1J19 A;  1FOE A;  1XX0 A;  2RLO A;  3KY9 A;  3MDB C;  3MPX A;  4HB4 B;  5D3X A;  2YT1 A;  1X1F A;  1X05 A;  2OTX A;  2KGX B;  5GOW B;  2IFS A;  4QJ4 B;  2R2Y A;  4GNK B;  1MI1 A;  2DTC A;  4F7U P;  3OAN A;  1P3R A;  4WVF B;  3A8P A;  3ZDT A;  3FEH A;  3GYO A;  4IAP A;  3KRW A;  1DDV A;  1IRS A;  5D3V A;  2DN6 A;  1B55 A;  2YT0 A;  4Z2N A;  4K81 A;  3ZVR A;  1W1H A;  1FB8 A;  3FSS A;  4HAW B;  4ZRJ A;  4EJN A;  3KSY A;  1W1D A;  2DX1 A;  3PVU A;  1MAI A;  4HB0 B;  4GPT B;  4NY0 A;  1DBH A;  1ZYI A;  2ZKM X;  2ELB A;  3A58 A;  5C16 A;  1FAO A;  3QBV B;  3T06 A;  1BAK A;  1KZG A;  1ZSQ A;  1AQC A;  1QC6 A;  1WG7 A;  2ELA A;  4HDO A;  4MK0 A;  2UZS A;  1DDW A;  5JLJ B;  5IRS A;  2N23 A;  3F5R A;  1OMW A;  5C79 A;  1U5G A;  1NU2 A;  4IOY X;  1TJ6 A;  2G35 A;  1RJ2 A;  3PG7 A;  5J3Y A;  2DHI A;  3PZD A;  2EMS A;  4TYZ A;  5DH9 B;  4A6K A;  1H4R A;  3KZ1 A;  3RCP A;  2OQB A;  2KCJ A;  5I2S A;  2VRW B;  2DKP A;  1V5M A;  2ROV A;  2L2I A;  2R09 A;  2CRF A;  1FHX A;  4XWX A;  3TW1 A;  3AU5 A;  1U2B A;  3WYF B;  1DDM A;  2HTH B;  3TCA A;  5HE0 A;  2I1J A;  2RSG A;  2CAY A;  2IYB A;  2H7D A;  2DYQ A;  5JP4 A;  3SV1 A;  2R0D A;  2DFK A;  4HAZ B;  2P0H A;  5C5B B;  2UVM A;  4D6W A;  2FJL A;  3NSU A;  2J59 M;  1V5U A;  4QJ3 B;  3TVV A;  4K17 A;  1DRO A;  4GOU A;  4KHA A;  5FI1 A;  4HAY B;  2Z14 A;  1UEF A;  4HAX B;  1T77 A;  1NI2 A;  4YL8 A;  4Y94 A;  3U7D A;  3TO1 A;  2N0Y A;  5HE2 A;  3TFM A;  2NZ8 B;  1DYN A;  4HHV A;  3PP2 A;  2W2X C;  3ULC A;  1GG3 A;  5DHF B;  4A6F B;  2EJ8 A;  2DX5 A;  1X86 A;  1W1G A;  5C6R A;  5J3T A;  1TXD A;  4KAX B;  3OHM B;  1UNR A;  2COD A;  1KI1 B;  3P7Z A;  3DXC A;  5KQ4 A;  1I7A A;  1EAZ A;  2D2Q A;  2LG1 A;  1MIZ B;  1WGQ A;  4KHO A;  2Y7B A;  3QWM A;  2D9V A;  1FGY A;  3NWD A;  4EKU A;  1V89 A;  1ZC4 B;  4CHM A;  5DI9 B;  5KQ1 A;  3GYP A;  4MY6 A;  4A5K A;  1E5W A;  1NTY A;  2ROZ B;  5LOP B;  2VKI A;  1UNP A;  4BBK A;  2I1K A;  4WSF A;  1NTV A;  4F7H A;  3VIA A;  3FVC A;  2AEH A;  1V5P A;  3IVF A;  3DXE A;  4K2O A;  3HSA A;  5D3W A;  5C5B A;  1ZVR A;  2D9X A;  1UNQ A;  1WJM A;  2Z4D A;  1U5E A;  1ZM0 A;  3D8D A;  4YON A;  3SUZ A;  2Y8G A;  3O96 A;  3DXD A;  1H10 A;  1QQG A;  3M1I B;  2MWN B;  2EMT A;  1ISN A;  2P0F A;  5LG4 B;  4HB2 B;  2P8V A;  1MK7 B;  1U5F A;  4GZU A;  3U8Z A;  2Y8F A;  1Z87 A;  1FHW A;  1MKE A;  2I5F A;  2L1C A;  2YS5 A;  3V5W A;  3QIJ A;  2KR0 A;  2D9W A;  2I5C A;  2RGN B;  4ZRK A;  1SHC A;  1EGX A;  3B77 A;  1K5D B;  1GC7 A;  1KZ7 A;  3UZT A;  2YS3 A;  3NWF A;  2M14 A;  4CSQ A;  2XQN M;  2YVC A;  1GC6 A;  2H7E A;  2VSZ A;  2D9Z A;  2LKO A;  1LB1 A;  2DLW A;  2YRY A;  2K2J A;  2ADZ A;  4OSN A;  3ULB A;  4CHJ A;  1EVH A;  5J3Q A;  4GXB A;  1M7R A;  2AL6 A;  1WVH A;  2KIE A;  3X23 A;  5FI0 A;  2DYN A;  3G9W A;  4DIX A;  1U27 A;  1Y5O A;  4H8S A;  5CLL B;  4PNK A;  2DHJ A;  4GMX B;  3HK0 A;  2D10 A;  1FHO A;  1WI1 A;  4HSI A;  1PLS A;  3AU4 A;  2K2U A;  2COC A;  4D0N B;  2LUL A;  1AWE A;  2HE7 A;  5L81 A;  1MK9 B;  1PFJ A;  1BTN A;  2J0K A;  2DHK A;  2X18 A;  1LW3 A;  3HIE A;  3CIK A;  1EF1 A;  1SGH A;  5EFX A;  2RUK B;  4GMV A;  2KUQ A;  2NMB A;  4IFS A;  1RRP B;  2KIG A;  2P0D A;  4Z2M B;  3ODW A;  1Y19 B;  1MPH A;  4QXA B;  1TQZ A;  2Z0Q A;  5CLQ B;  4DBB A;  4HDQ A;  1WJ1 A;  5LON B;  4L6E A;  1XD4 A;  1U29 A;  4K2P A;  1X1G A;  3VOQ A;  3CXB B;  4P7I A;  2LYD A;  3LJU X;  2LOX A;  4QJ5 B;  4DX8 A;  4C0A A;  1K5G B;  4KHB B;  2Q13 A;  4MT7 A;  2YF0 A;  3AJ4 A;  1P5T A;  2GCJ A;  3ODO A;  3A98 B;  3ODX A;  3BJI A;  2UZR A;  1BTK A;  1U5D A;  2CY5 A;  1J0W A;  4HAT B;  2W2X D;  4WJ7 A;  3PVL A;  2K8E A;  5JHG A;  1P6S A;  2Z13 A;  5DHA B;  3U12 A;  1PMS A;  2GCL A;  1ZC3 B;  1XCG A;  2RVB B; 
#chains in the Genus database with same CATH homology
 1V88 A;  5D27 A;  2Z0O A;  5HE3 A;  4DX9 0;  2JP2 A;  1UPQ A;  3SNH A;  2Z0P A;  4F7G A;  3FM8 C;  4CYE A;  2QKL A;  2E2X A;  1FGZ A;  2KUP A;  2PZ1 A;  4B6H A;  2RNR B;  4DXA B;  5DIF B;  1BWN A;  4TKN A;  4A6F A;  3KRX A;  3HQC A;  1N3H A;  4KVG B;  3BIN A;  1WGU A;  2CY4 A;  4EMO A;  2COF A;  2YSZ A;  2GJY A;  4A6H A;  1UPR A;  2DKQ A;  1X11 A;  1Q67 A;  3HW2 B;  2COA A;  2ZPY A;  3D8E A;  2MDX A;  2K00 A;  2W2W A;  1OQN A;  1V61 A;  2J0M A;  2LOZ A;  3PEG A;  4HAV B;  2M38 A;  4NSW A;  3SO6 A;  1XOD A;  2MFQ A;  2DA0 A;  3SYX A;  3PVW A;  3N7C A;  5HE1 A;  2D9Y A;  1I2H A;  2EC1 A;  1OY2 A;  4HAU B;  3PSC A;  4PQ0 A;  2BCJ A;  1M7E A;  3P6A A;  2D11 A;  5JHH A;  1MIX A;  3ML4 A;  4GN1 A;  2YS1 A;  2J0J A;  2V76 A;  1XKE A;  5D3Y A;  3A8Q A;  2QKM A;  2GS0 A;  3WA0 A;  1XR0 B;  2MKR A;  3D8F A;  3F0W A;  4HB3 B;  4ZRI A;  5KCV A;  2D4Q A;  1J19 A;  1FOE A;  1XX0 A;  2RLO A;  3KY9 A;  3MDB C;  3MPX A;  4HB4 B;  5D3X A;  2YT1 A;  1X1F A;  1X05 A;  2OTX A;  2KGX B;  5GOW B;  2IFS A;  2DTC A;  4F7U P;  3OAN A;  1P3R A;  4WVF B;  3A8P A;  3ZDT A;  3FEH A;  3GYO A;  4IAP A;  3KRW A;  1DDV A;  1IRS A;  5D3V A;  2DN6 A;  1B55 A;  2YT0 A;  4Z2N A;  4K81 A;  3ZVR A;  1W1H A;  1FB8 A;  3FSS A;  4HAW B;  4ZRJ A;  4EJN A;  3KSY A;  1W1D A;  2DX1 A;  3PVU A;  1MAI A;  4HB0 B;  4GPT B;  4NY0 A;  1DBH A;  2ELB A;  5C16 A;  1FAO A;  3QBV B;  3T06 A;  1BAK A;  1KZG A;  1ZSQ A;  1AQC A;  1QC6 A;  1WG7 A;  2ELA A;  4HDO A;  4MK0 A;  2UZS A;  1DDW A;  5JLJ B;  2N23 A;  3F5R A;  1OMW A;  5C79 A;  1U5G A;  1NU2 A;  4IOY X;  1TJ6 A;  2G35 A;  1RJ2 A;  3PG7 A;  5J3Y A;  2DHI A;  3PZD A;  2EMS A;  4TYZ A;  5DH9 B;  4A6K A;  1H4R A;  3KZ1 A;  3RCP A;  2OQB A;  2KCJ A;  2VRW B;  2DKP A;  1V5M A;  2ROV A;  2L2I A;  2R09 A;  2CRF A;  1FHX A;  4XWX A;  3TW1 A;  3AU5 A;  1U2B A;  3WYF B;  1DDM A;  2HTH B;  3TCA A;  5HE0 A;  2I1J A;  2RSG A;  2CAY A;  2IYB A;  2H7D A;  2DYQ A;  5JP4 A;  3SV1 A;  2R0D A;  2DFK A;  4HAZ B;  2P0H A;  5C5B B;  2UVM A;  2FJL A;  3NSU A;  2J59 M;  1V5U A;  3TVV A;  4K17 A;  1DRO A;  4KHA A;  5FI1 A;  4HAY B;  1UEF A;  4HAX B;  1NI2 A;  4YL8 A;  4Y94 A;  3U7D A;  3TO1 A;  2N0Y A;  5HE2 A;  3TFM A;  2NZ8 B;  1DYN A;  4HHV A;  3PP2 A;  2W2X C;  3ULC A;  1GG3 A;  5DHF B;  4A6F B;  2EJ8 A;  2DX5 A;  1X86 A;  1W1G A;  5C6R A;  5J3T A;  1TXD A;  4KAX B;  1UNR A;  2COD A;  1KI1 B;  3P7Z A;  3DXC A;  5KQ4 A;  1I7A A;  1EAZ A;  2D2Q A;  2LG1 A;  1MIZ B;  1WGQ A;  4KHO A;  2Y7B A;  3QWM A;  2D9V A;  1FGY A;  4EKU A;  1V89 A;  1ZC4 B;  4CHM A;  5DI9 B;  5KQ1 A;  3GYP A;  4MY6 A;  4A5K A;  1E5W A;  1NTY A;  2ROZ B;  5LOP B;  2VKI A;  1UNP A;  4BBK A;  2I1K A;  4WSF A;  1NTV A;  4F7H A;  3VIA A;  2AEH A;  1V5P A;  3IVF A;  3DXE A;  4K2O A;  5D3W A;  5C5B A;  1ZVR A;  2D9X A;  1UNQ A;  1WJM A;  1U5E A;  1ZM0 A;  3D8D A;  4YON A;  3SUZ A;  2Y8G A;  3O96 A;  3DXD A;  1H10 A;  1QQG A;  3M1I B;  2MWN B;  2EMT A;  1ISN A;  2P0F A;  4HB2 B;  2P8V A;  1MK7 B;  1U5F A;  4GZU A;  3U8Z A;  2Y8F A;  1Z87 A;  1FHW A;  1MKE A;  2I5F A;  2L1C A;  2YS5 A;  3V5W A;  3QIJ A;  2D9W A;  2I5C A;  2RGN B;  4ZRK A;  1SHC A;  1EGX A;  1K5D B;  1GC7 A;  1KZ7 A;  3UZT A;  2YS3 A;  2M14 A;  2XQN M;  2YVC A;  1GC6 A;  2H7E A;  2VSZ A;  2D9Z A;  2LKO A;  1LB1 A;  2DLW A;  2YRY A;  2K2J A;  2ADZ A;  3ULB A;  4CHJ A;  5J3Q A;  1EVH A;  4GXB A;  1M7R A;  2AL6 A;  1WVH A;  3X23 A;  5FI0 A;  2DYN A;  3G9W A;  1U27 A;  1Y5O A;  4H8S A;  5CLL B;  4PNK A;  2DHJ A;  4GMX B;  3HK0 A;  2D10 A;  1FHO A;  1WI1 A;  1PLS A;  3AU4 A;  2K2U A;  2COC A;  4D0N B;  2LUL A;  1AWE A;  2HE7 A;  5L81 A;  1MK9 B;  1PFJ A;  1BTN A;  2J0K A;  2DHK A;  2X18 A;  1LW3 A;  3CIK A;  1EF1 A;  1SGH A;  5EFX A;  2RUK B;  4GMV A;  2NMB A;  4IFS A;  1RRP B;  2P0D A;  4Z2M B;  3ODW A;  1Y19 B;  1MPH A;  1TQZ A;  2Z0Q A;  5CLQ B;  4DBB A;  4HDQ A;  1WJ1 A;  5LON B;  4L6E A;  1XD4 A;  1U29 A;  4K2P A;  1X1G A;  3VOQ A;  3CXB B;  4P7I A;  2LYD A;  3LJU X;  2LOX A;  4DX8 A;  4C0A A;  1K5G B;  4KHB B;  2Q13 A;  4MT7 A;  2YF0 A;  3AJ4 A;  1P5T A;  2GCJ A;  3ODO A;  3A98 B;  3ODX A;  3BJI A;  2UZR A;  1BTK A;  1U5D A;  2CY5 A;  1J0W A;  4HAT B;  2W2X D;  4WJ7 A;  3PVL A;  5JHG A;  1P6S A;  5DHA B;  1PMS A;  2GCL A;  1ZC3 B;  1XCG A;  2RVB B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...