1XODA

Crystal structure of x. tropicalis spred1 evh-1 domain
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
114
structure length
105
Chain Sequence
SYARVRAVVMTRDDSSGGWLQLGGGGLSSVTVSKTEFLVHGERLRDKTVVLECVLRRDLVYNKVTPTFHHWRIGDKKFGLTFQSPADARAFDRGIRRAIEDLSQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 1.15A Crystal structure of the X. tropicalis Spred1 EVH1 domain suggests a fourth distinct peptide-binding mechanism within the EVH1 family
pubmed doi rcsb
source organism Xenopus tropicalis
molecule tags Signaling protein
molecule keywords Spred1
total genus 23
structure length 105
sequence length 114
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00568 WH1 WH1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1xodA00
2J0KA 4WSFA 4K17A 3F0WA 2YS1A 4WJ7A 2M14A 4HHVA 2N0YA 1XODA 2R09A 1FHWA 3PVUA 5HE1A 1W1HA 1U5DA 1PLSA 4WVFB 2EMTA 1N3HA 1W1DA 1XR0B 4HAVB 2AL6A 2LG1A 4D0NB 1QC6A 3WA0A 3GYOA 2YS3A 3WYFB 1DYNA 1QQGA 3TW1A 4KVGB 4K81A 1TQZA 1M7EA 1U2BA 3SUZA 1FAOA 2CAYA 1MPHA 3DXCA 4P7IA 3FEHA 5D3YA 2I5FA 3CXBB 2LOXA 1Y5OA 5C5BA 1FHXA 2DX1A 5J3QA 1RRPB 2DYNA 3PEGA 4DBBA 1EGXA 1OQNA 2N23A 3KY9A 1NTYA 3GYPA 1WJMA 4A6FA 1UNRA 3ZDTA 1GC6A 3F5RA 1H10A 3AU4A 3HQCA 2Z0OA 1U27A 4YONA 4KHOA 1BTNA 3HW2B 2DN6A 3M1IB 4DX90 3DXDA 2AEHA 2J0JA 4A6FB 1MKEA 4XWXA 2GCLA 2YS5A 1ZSQA 1Z87A 2D9VA 3ML4A 1WG7A 1E5WA 3ULCA 4EKUA 2YF0A 3FM8C 4F7GA 3ODWA 2Y8GA 2CY4A 4EMOA 1ZM0A 1UNPA 5CLLB 4MT7A 1FOEA 2KGXB 1OY2A 3PZDA 2D4QA 2DKPA 2W2WA 2DX5A 4BBKA 4GPTB 3A98B 3VIAA 4A5KA 1XKEA 2P0DA 2ELAA 2LKOA 2K2JA 4A6KA 3PSCA 2XQNM 5C6RA 4MY6A 3VOQA 2I5CA 3ODXA 3KRWA 2UVMA 5J3TA 2M38A 1FHOA 5DH9B 2YT0A 1U5FA 1P6SA 1X05A 3CIKA 2ADZA 5D3VA 3U8ZA 1EVHA 1J0WA 1DBHA 1X1FA 1FGYA 2ROVA 1DDMA 2FJLA 1X86A 1M7RA 3NSUA 2I1JA 4KHAA 1XX0A 1H4RA 2ELBA 3U7DA 4GZUA 5D27A 3FSSA 2Y8FA 1V5PA 3DXEA 2YT1A 4PQ0A 1DDWA 1PMSA 5JHHA 1AWEA 1I7AA 1TXDA 1KZGA 1MIXA 2NMBA 2DTCA 2I1KA 2EJ8A 2D11A 1MIZB 5JHGA 2YSZA 5EFXA 1FB8A 3MDBC 1U29A 3TFMA 2L1CA 1NTVA 1WGQA 2HE7A 4CHMA 4MK0A 1X1GA 2Z0PA 1OMWA 2P8VA 4IFSA 1K5DB 2EMSA 4TKNA 4C0AA 1V88A 1U5GA 4IAPA 3OANA 3G9WA 2VSZA 1UEFA 2COAA 1WVHA 1DDVA 1KI1B 1EAZA 2KCJA 4NSWA 1V5UA 3SNHA 2W2XC 2E2XA 4HAZB 5JP4A 4Y94A 1W1GA 2DA0A 4HDQA 4KHBB 1PFJA 2DYQA 2GJYA 4NY0A 3MPXA 5HE0A 5D3XA 2D9YA 2RVBB 3A8QA 3TCAA 2MWNB 1BTKA 3SO6A 2Q13A 2D9XA 2IYBA 3P7ZA 3TVVA 2UZRA 4F7UP 2GS0A 1X11A 2COFA 2VRWB 4ZRKA 4HB4B 3SV1A 3RCPA 4CYEA 4K2OA 3BINA 1V5MA 4Z2NA 2P0HA 3ODOA 4HB0B 2NZ8B 2MFQA 2R0DA 2RGNB 3ULBA 4TYZA 2YRYA 1AQCA 2X18A 3KRXA 4DX8A 3AJ4A 5KCVA 4ZRIA 3V5WA 1KZ7A 4GXBA 5JLJB 5DIFB 5FI1A 2D10A 1ZC3B 5KQ4A 4B6HA 2D2QA 1RJ2A 5HE3A 2LOZA 4ZRJA 2HTHB 3BJIA 2UZSA 5C5BB 2W2XD 4A6HA 2QKLA 4IOYX 3QBVB 3KZ1A 1WJ1A 3X23A 2Z0QA 4PNKA 4K2PA 5D3WA 3D8DA 4HAWB 1ZVRA 1NU2A 3PG7A 3PVWA 4GN1A 5KQ1A 4H8SA 5J3YA 5GOWB 5C16A 3UZTA 3A8PA 3SYXA 2RSGA 2D9ZA 2MDXA 1SGHA 5DHAB 2COCA 5LOPB 2IFSA 2YVCA 2GCJA 1SHCA 1WGUA 3TO1A 3IVFA 1ZC4B 1NI2A 4HATB 4HDOA 2PZ1A 4F7HA 4KAXB 5FI0A 3QWMA 1V89A 2OQBA 4HAYB 3PVLA 1LB1A 2MKRA 4EJNA 5DHFB 5C79A 3D8FA 2K2UA 1P3RA 2QKMA 2J59M 1ISNA 1UPRA 1K5GB 1V61A 2DHKA 5CLQB 2LYDA 2OTXA 4L6EA 2D9WA 1WI1A 3QIJA 3D8EA 3O96A 2EC1A 4GMVA 1UNQA 2Y7BA 1MK9B 1FGZA 5L81A 2BCJA 1EF1A 4Z2MB 5HE2A 3LJUX 4CHJA 5LONB 5DI9B 2DHJA 2K00A 1LW3A 2DLWA 2H7EA 2DHIA 1MAIA 3T06A 1I2HA 1XD4A 2L2IA 1IRSA 2ZPYA 2DFKA 3KSYA 1B55A 4HAXB 1J19A 2CY5A 1Q67A 2RUKB 1DROA 4DXAB 4HB2B 2LULA 4HB3B 1UPQA 2ROZB 2VKIA 2CRFA 1TJ6A 2P0FA 1BAKA 2H7DA 1Y19B 4YL8A 2RNRB 2G35A 2JP2A 4HAUB 1GC7A 2CODA 1XCGA 1MK7B 2V76A 1P5TA 3ZVRA 3P6AA 3AU5A 1U5EA 2RLOA 1GG3A 4GMXB 2KUPA 3PP2A 1BWNA 3HK0A 3N7CA 2J0MA 2DKQA
chains in the Genus database with same CATH superfamily
2J0KA 4WSFA 4K17A 3F0WA 2YS1A 4WJ7A 3B77A 2M14A 4HHVA 2N0YA 1XODA 2R09A 1FHWA 3PVUA 5HE1A 2KR0A 1W1HA 1U5DA 2KUQA 1PLSA 4WVFB 2EMTA 1N3HA 1W1DA 1XR0B 3FVCA 3OHMB 4HAVB 2R2YA 2AL6A 2LG1A 4D0NB 1QC6A 3WA0A 3GYOA 4KHBA 2YS3A 3WYFB 1DYNA 1QQGA 3TW1A 4KVGB 4K81A 1TQZA 1M7EA 1U2BA 3SUZA 1FAOA 2CAYA 1MPHA 3DXCA 4P7IA 3FEHA 4GNKB 5D3YA 2I5FA 3CXBB 2LOXA 1Y5OA 5C5BA 2KIEA 1FHXA 2DX1A 5J3QA 1RRPB 2DYNA 3PEGA 4DBBA 1EGXA 1OQNA 2N23A 3KY9A 1NTYA 3GYPA 1WJMA 4A6FA 1UNRA 3ZDTA 1GC6A 3F5RA 1H10A 3AU4A 3HQCA 2Z0OA 1U27A 4YONA 4KHOA 1BTNA 3HW2B 2DN6A 3M1IB 4DX90 3DXDA 2AEHA 2J0JA 4A6FB 1MKEA 4XWXA 2GCLA 2YS5A 1ZSQA 1Z87A 2D9VA 3ML4A 1WG7A 1E5WA 3ULCA 4EKUA 5LG4B 2YF0A 3FM8C 4F7GA 4GOUA 3ODWA 2Y8GA 2CY4A 4EMOA 1ZM0A 1UNPA 5CLLB 4MT7A 1FOEA 2KGXB 1OY2A 5I2SA 3PZDA 2D4QA 2DKPA 2W2WA 2DX5A 4BBKA 4GPTB 3A98B 3VIAA 4A5KA 1XKEA 2P0DA 2ELAA 2LKOA 2K2JA 4A6KA 3PSCA 2XQNM 5C6RA 4MY6A 3VOQA 2I5CA 3U12A 3ODXA 3KRWA 2RRFA 2UVMA 5J3TA 4HSIA 2M38A 1FHOA 5DH9B 2YT0A 1U5FA 1P6SA 1X05A 3CIKA 2ADZA 5D3VA 3U8ZA 1EVHA 1J0WA 1DBHA 1X1FA 1FGYA 2ROVA 3HIEA 2FJLA 1DDMA 1X86A 1M7RA 3HSAA 3NSUA 2I1JA 4KHAA 1XX0A 1H4RA 2ELBA 3U7DA 4GZUA 5D27A 3FSSA 2Y8FA 1V5PA 3DXEA 2YT1A 4PQ0A 1DDWA 1PMSA 5JHHA 1AWEA 1I7AA 1TXDA 1KZGA 1MIXA 2NMBA 4QJ5B 2DTCA 2I1KA 2EJ8A 2D11A 1MIZB 2Z13A 5JHGA 4OT1A 2YSZA 5EFXA 1FB8A 3MDBC 1U29A 3TFMA 2L1CA 5M4YB 1NTVA 1WGQA 2HE7A 4CHMA 2GUMA 4MK0A 1X1GA 2Z0PA 1OMWA 2P8VA 4IFSA 1K5DB 2KIGA 2EMSA 4TKNA 4C0AA 1V88A 1U5GA 4IAPA 3OANA 3G9WA 1T77A 2VSZA 1UEFA 2COAA 1WVHA 1DDVA 1KI1B 1EAZA 2KCJA 4NSWA 1V5UA 3SNHA 2W2XC 2E2XA 4HAZB 5JP4A 4Y94A 1W1GA 2DA0A 4HDQA 4KHBB 1PFJA 2DYQA 2GJYA 2Z59A 4NY0A 2Z14A 3MPXA 5HE0A 4D6WA 5D3XA 2D9YA 2RVBB 3A8QA 4CSQA 3TCAA 2MWNB 1BTKA 2YT2A 3SO6A 5IRSA 2Q13A 2D9XA 2IYBA 3P7ZA 3TVVA 2UZRA 4F7UP 2GS0A 1X11A 2COFA 2VRWB 4QJ4B 4ZRKA 4HB4B 3SV1A 3RCPA 4L1RA 1ZYIA 4CYEA 4K2OA 3BINA 4DIXA 1V5MA 4Z2NA 2P0HA 3ODOA 2ZKMX 4HB0B 3NW8A 2NZ8B 2MFQA 2R0DA 2RGNB 3ULBA 4TYZA 2YRYA 3NWFA 1AQCA 2X18A 3KRXA 5I2MA 4DX8A 3AJ4A 5KCVA 4ZRIA 3V5WA 1KZ7A 4GXBA 5JLJB 5DIFB 5FI1A 2D10A 1ZC3B 5KQ4A 4B6HA 2D2QA 2Z4DA 1RJ2A 5HE3A 2LOZA 4ZRJA 2HTHB 3BJIA 2UZSA 5C5BB 2W2XD 4A6HA 2QKLA 4IOYX 3QBVB 4QXAB 3KZ1A 1WJ1A 3X23A 2Z0QA 3NWAA 4PNKA 4K2PA 2FJUB 5D3WA 3D8DA 4HAWB 1ZVRA 1NU2A 3PG7A 3PVWA 4GN1A 5KQ1A 4H8SA 5J3YA 5GOWB 5C16A 3UZTA 3A8PA 3SYXA 2RSGA 2D9ZA 2MDXA 1SGHA 5DHAB 2COCA 5LOPB 2IFSA 2YVCA 2GCJA 1SHCA 1WGUA 3TO1A 3IVFA 1ZC4B 1NI2A 4HATB 4HDOA 2PZ1A 4F7HA 4KAXB 3DCXA 5FI0A 3QWMA 1V89A 2OQBA 4HAYB 3PVLA 1LB1A 2MKRA 4EJNA 5DHFB 5C79A 3D8FA 4QJ3B 2K2UA 1P3RA 2QKMA 2J59M 1ISNA 1UPRA 1K5GB 1V61A 2DHKA 5CLQB 2LYDA 2OTXA 4L6EA 2D9WA 1WI1A 3QIJA 3D8EA 3O96A 2EC1A 4GMVA 1UNQA 2Y7BA 1MK9B 1FGZA 5L81A 2BCJA 1EF1A 4Z2MB 4OSNA 5HE2A 3LJUX 4CHJA 5LONB 5DI9B 2DHJA 2K00A 1LW3A 2DLWA 2H7EA 2DHIA 1MAIA 3T06A 1I2HA 1XD4A 2L2IA 1MI1A 1IRSA 2ZPYA 2DFKA 3KSYA 1B55A 4HAXB 1J19A 2CY5A 1Q67A 2RUKB 1DROA 4DXAB 4HB2B 2LULA 4HB3B 1UPQA 2ROZB 2VKIA 2CRFA 1TJ6A 2P0FA 1BAKA 2H7DA 1Y19B 4YL8A 2RNRB 2G35A 2NBVA 2JP2A 4HAUB 1GC7A 2CODA 1XCGA 2K49A 1MK7B 2V76A 3A58A 2K8EA 1P5TA 3ZVRA 3P6AA 3AU5A 3NWDA 1U5EA 2RLOA 1GG3A 4GMXB 2KUPA 3PP2A 1BWNA 3HK0A 3N7CA 2J0MA 2DKQA
chains in the Genus database with same CATH topology
2J0KA 4WSFA 4K17A 3F0WA 2YS1A 4WJ7A 2M14A 4HHVA 2N0YA 1XODA 2R09A 1FHWA 3PVUA 5HE1A 1W1HA 1U5DA 1PLSA 4WVFB 2EMTA 1N3HA 1W1DA 1XR0B 4HAVB 2AL6A 2LG1A 4D0NB 1QC6A 3WA0A 3GYOA 2YS3A 3WYFB 1DYNA 1QQGA 3TW1A 4KVGB 4K81A 1TQZA 1M7EA 1U2BA 3SUZA 1FAOA 2CAYA 1MPHA 3DXCA 4P7IA 3FEHA 5D3YA 2I5FA 3CXBB 2LOXA 1Y5OA 5C5BA 1FHXA 2DX1A 5J3QA 1RRPB 2DYNA 3PEGA 4DBBA 1EGXA 1OQNA 2N23A 3KY9A 1NTYA 3GYPA 1WJMA 4A6FA 1UNRA 3ZDTA 1GC6A 3F5RA 1H10A 3AU4A 3HQCA 2Z0OA 1U27A 4YONA 4KHOA 1BTNA 3HW2B 2DN6A 3M1IB 4DX90 3DXDA 2AEHA 2J0JA 4A6FB 1MKEA 4XWXA 2GCLA 2YS5A 1ZSQA 1Z87A 2D9VA 3ML4A 1WG7A 1E5WA 3ULCA 4EKUA 2YF0A 3FM8C 4F7GA 3ODWA 2Y8GA 2CY4A 4EMOA 1ZM0A 1UNPA 5CLLB 4MT7A 1FOEA 2KGXB 1OY2A 3PZDA 2D4QA 2DKPA 2W2WA 2DX5A 4BBKA 4GPTB 3A98B 3VIAA 4A5KA 1XKEA 2P0DA 2ELAA 2LKOA 2K2JA 4A6KA 3PSCA 2XQNM 5C6RA 4MY6A 3VOQA 2I5CA 3ODXA 3KRWA 2UVMA 5J3TA 2M38A 1FHOA 5DH9B 2YT0A 1U5FA 1P6SA 1X05A 3CIKA 2ADZA 5D3VA 3U8ZA 1EVHA 1J0WA 1DBHA 1X1FA 1FGYA 2ROVA 1DDMA 2FJLA 1X86A 1M7RA 3NSUA 2I1JA 4KHAA 1XX0A 1H4RA 2ELBA 3U7DA 4GZUA 5D27A 3FSSA 2Y8FA 1V5PA 3DXEA 2YT1A 4PQ0A 1DDWA 1PMSA 5JHHA 1AWEA 1I7AA 1TXDA 1KZGA 1MIXA 2NMBA 2DTCA 2I1KA 2EJ8A 2D11A 1MIZB 5JHGA 2YSZA 5EFXA 1FB8A 3MDBC 1U29A 3TFMA 2L1CA 1NTVA 1WGQA 2HE7A 4CHMA 4MK0A 1X1GA 2Z0PA 1OMWA 2P8VA 4IFSA 1K5DB 2EMSA 4TKNA 4C0AA 1V88A 1U5GA 4IAPA 3OANA 3G9WA 2VSZA 1UEFA 2COAA 1WVHA 1DDVA 1KI1B 1EAZA 2KCJA 4NSWA 1V5UA 3SNHA 2W2XC 2E2XA 4HAZB 5JP4A 4Y94A 1W1GA 2DA0A 4HDQA 4KHBB 1PFJA 2DYQA 2GJYA 4NY0A 3MPXA 5HE0A 5D3XA 2D9YA 2RVBB 3A8QA 3TCAA 2MWNB 1BTKA 3SO6A 2Q13A 2D9XA 2IYBA 3P7ZA 3TVVA 2UZRA 4F7UP 2GS0A 1X11A 2COFA 2VRWB 4ZRKA 4HB4B 3SV1A 3RCPA 4CYEA 4K2OA 3BINA 1V5MA 4Z2NA 2P0HA 3ODOA 4HB0B 2NZ8B 2MFQA 2R0DA 2RGNB 3ULBA 4TYZA 2YRYA 1AQCA 2X18A 3KRXA 4DX8A 3AJ4A 5KCVA 4ZRIA 3V5WA 1KZ7A 4GXBA 5JLJB 5DIFB 5FI1A 2D10A 1ZC3B 5KQ4A 4B6HA 2D2QA 1RJ2A 5HE3A 2LOZA 4ZRJA 2HTHB 3BJIA 2UZSA 5C5BB 2W2XD 4A6HA 2QKLA 4IOYX 3QBVB 3KZ1A 1WJ1A 3X23A 2Z0QA 4PNKA 4K2PA 5D3WA 3D8DA 4HAWB 1ZVRA 1NU2A 3PG7A 3PVWA 4GN1A 5KQ1A 4H8SA 5J3YA 5GOWB 5C16A 3UZTA 3A8PA 3SYXA 2RSGA 2D9ZA 2MDXA 1SGHA 5DHAB 2COCA 5LOPB 2IFSA 2YVCA 2GCJA 1SHCA 1WGUA 3TO1A 3IVFA 1ZC4B 1NI2A 4HATB 4HDOA 2PZ1A 4F7HA 4KAXB 5FI0A 3QWMA 1V89A 2OQBA 4HAYB 3PVLA 1LB1A 2MKRA 4EJNA 5DHFB 5C79A 3D8FA 2K2UA 1P3RA 2QKMA 2J59M 1ISNA 1UPRA 1K5GB 1V61A 2DHKA 5CLQB 2LYDA 2OTXA 4L6EA 2D9WA 1WI1A 3QIJA 3D8EA 3O96A 2EC1A 4GMVA 1UNQA 2Y7BA 1MK9B 1FGZA 5L81A 2BCJA 1EF1A 4Z2MB 5HE2A 3LJUX 4CHJA 5LONB 5DI9B 2DHJA 2K00A 1LW3A 2DLWA 2H7EA 2DHIA 1MAIA 3T06A 1I2HA 1XD4A 2L2IA 1IRSA 2ZPYA 2DFKA 3KSYA 1B55A 4HAXB 1J19A 2CY5A 1Q67A 2RUKB 1DROA 4DXAB 4HB2B 2LULA 4HB3B 1UPQA 2ROZB 2VKIA 2CRFA 1TJ6A 2P0FA 1BAKA 2H7DA 1Y19B 4YL8A 2RNRB 2G35A 2JP2A 4HAUB 1GC7A 2CODA 1XCGA 1MK7B 2V76A 1P5TA 3ZVRA 3P6AA 3AU5A 1U5EA 2RLOA 1GG3A 4GMXB 2KUPA 3PP2A 1BWNA 3HK0A 3N7CA 2J0MA 2DKQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J0K A;  4WSF A;  4K17 A;  3F0W A;  2YS1 A;  4WJ7 A;  2M14 A;  4HHV A;  2N0Y A;  1XOD A;  2R09 A;  1FHW A;  3PVU A;  5HE1 A;  1W1H A;  1U5D A;  1PLS A;  4WVF B;  2EMT A;  1N3H A;  1W1D A;  1XR0 B;  4HAV B;  2AL6 A;  2LG1 A;  4D0N B;  1QC6 A;  3WA0 A;  3GYO A;  2YS3 A;  3WYF B;  1DYN A;  1QQG A;  3TW1 A;  4KVG B;  4K81 A;  1TQZ A;  1M7E A;  1U2B A;  3SUZ A;  1FAO A;  2CAY A;  1MPH A;  3DXC A;  4P7I A;  3FEH A;  5D3Y A;  2I5F A;  3CXB B;  2LOX A;  1Y5O A;  5C5B A;  1FHX A;  2DX1 A;  5J3Q A;  1RRP B;  2DYN A;  3PEG A;  4DBB A;  1EGX A;  1OQN A;  2N23 A;  3KY9 A;  1NTY A;  3GYP A;  1WJM A;  4A6F A;  1UNR A;  3ZDT A;  1GC6 A;  3F5R A;  1H10 A;  3AU4 A;  3HQC A;  2Z0O A;  1U27 A;  4YON A;  4KHO A;  1BTN A;  3HW2 B;  2DN6 A;  3M1I B;  4DX9 0;  3DXD A;  2AEH A;  2J0J A;  4A6F B;  1MKE A;  4XWX A;  2GCL A;  2YS5 A;  1ZSQ A;  1Z87 A;  2D9V A;  3ML4 A;  1WG7 A;  1E5W A;  3ULC A;  4EKU A;  2YF0 A;  3FM8 C;  4F7G A;  3ODW A;  2Y8G A;  2CY4 A;  4EMO A;  1ZM0 A;  1UNP A;  5CLL B;  4MT7 A;  1FOE A;  2KGX B;  1OY2 A;  3PZD A;  2D4Q A;  2DKP A;  2W2W A;  2DX5 A;  4BBK A;  4GPT B;  3A98 B;  3VIA A;  4A5K A;  1XKE A;  2P0D A;  2ELA A;  2LKO A;  2K2J A;  4A6K A;  3PSC A;  2XQN M;  5C6R A;  4MY6 A;  3VOQ A;  2I5C A;  3ODX A;  3KRW A;  2UVM A;  5J3T A;  2M38 A;  1FHO A;  5DH9 B;  2YT0 A;  1U5F A;  1P6S A;  1X05 A;  3CIK A;  2ADZ A;  5D3V A;  3U8Z A;  1EVH A;  1J0W A;  1DBH A;  1X1F A;  1FGY A;  2ROV A;  1DDM A;  2FJL A;  1X86 A;  1M7R A;  3NSU A;  2I1J A;  4KHA A;  1XX0 A;  1H4R A;  2ELB A;  3U7D A;  4GZU A;  5D27 A;  3FSS A;  2Y8F A;  1V5P A;  3DXE A;  2YT1 A;  4PQ0 A;  1DDW A;  1PMS A;  5JHH A;  1AWE A;  1I7A A;  1TXD A;  1KZG A;  1MIX A;  2NMB A;  2DTC A;  2I1K A;  2EJ8 A;  2D11 A;  1MIZ B;  5JHG A;  2YSZ A;  5EFX A;  1FB8 A;  3MDB C;  1U29 A;  3TFM A;  2L1C A;  1NTV A;  1WGQ A;  2HE7 A;  4CHM A;  4MK0 A;  1X1G A;  2Z0P A;  1OMW A;  2P8V A;  4IFS A;  1K5D B;  2EMS A;  4TKN A;  4C0A A;  1V88 A;  1U5G A;  4IAP A;  3OAN A;  3G9W A;  2VSZ A;  1UEF A;  2COA A;  1WVH A;  1DDV A;  1KI1 B;  1EAZ A;  2KCJ A;  4NSW A;  1V5U A;  3SNH A;  2W2X C;  2E2X A;  4HAZ B;  5JP4 A;  4Y94 A;  1W1G A;  2DA0 A;  4HDQ A;  4KHB B;  1PFJ A;  2DYQ A;  2GJY A;  4NY0 A;  3MPX A;  5HE0 A;  5D3X A;  2D9Y A;  2RVB B;  3A8Q A;  3TCA A;  2MWN B;  1BTK A;  3SO6 A;  2Q13 A;  2D9X A;  2IYB A;  3P7Z A;  3TVV A;  2UZR A;  4F7U P;  2GS0 A;  1X11 A;  2COF A;  2VRW B;  4ZRK A;  4HB4 B;  3SV1 A;  3RCP A;  4CYE A;  4K2O A;  3BIN A;  1V5M A;  4Z2N A;  2P0H A;  3ODO A;  4HB0 B;  2NZ8 B;  2MFQ A;  2R0D A;  2RGN B;  3ULB A;  4TYZ A;  2YRY A;  1AQC A;  2X18 A;  3KRX A;  4DX8 A;  3AJ4 A;  5KCV A;  4ZRI A;  3V5W A;  1KZ7 A;  4GXB A;  5JLJ B;  5DIF B;  5FI1 A;  2D10 A;  1ZC3 B;  5KQ4 A;  4B6H A;  2D2Q A;  1RJ2 A;  5HE3 A;  2LOZ A;  4ZRJ A;  2HTH B;  3BJI A;  2UZS A;  5C5B B;  2W2X D;  4A6H A;  2QKL A;  4IOY X;  3QBV B;  3KZ1 A;  1WJ1 A;  3X23 A;  2Z0Q A;  4PNK A;  4K2P A;  5D3W A;  3D8D A;  4HAW B;  1ZVR A;  1NU2 A;  3PG7 A;  3PVW A;  4GN1 A;  5KQ1 A;  4H8S A;  5J3Y A;  5GOW B;  5C16 A;  3UZT A;  3A8P A;  3SYX A;  2RSG A;  2D9Z A;  2MDX A;  1SGH A;  5DHA B;  2COC A;  5LOP B;  2IFS A;  2YVC A;  2GCJ A;  1SHC A;  1WGU A;  3TO1 A;  3IVF A;  1ZC4 B;  1NI2 A;  4HAT B;  4HDO A;  2PZ1 A;  4F7H A;  4KAX B;  5FI0 A;  3QWM A;  1V89 A;  2OQB A;  4HAY B;  3PVL A;  1LB1 A;  2MKR A;  4EJN A;  5DHF B;  5C79 A;  3D8F A;  2K2U A;  1P3R A;  2QKM A;  2J59 M;  1ISN A;  1UPR A;  1K5G B;  1V61 A;  2DHK A;  5CLQ B;  2LYD A;  2OTX A;  4L6E A;  2D9W A;  1WI1 A;  3QIJ A;  3D8E A;  3O96 A;  2EC1 A;  4GMV A;  1UNQ A;  2Y7B A;  1MK9 B;  1FGZ A;  5L81 A;  2BCJ A;  1EF1 A;  4Z2M B;  5HE2 A;  3LJU X;  4CHJ A;  5LON B;  5DI9 B;  2DHJ A;  2K00 A;  1LW3 A;  2DLW A;  2H7E A;  2DHI A;  1MAI A;  3T06 A;  1I2H A;  1XD4 A;  2L2I A;  1IRS A;  2ZPY A;  2DFK A;  3KSY A;  1B55 A;  4HAX B;  1J19 A;  2CY5 A;  1Q67 A;  2RUK B;  1DRO A;  4DXA B;  4HB2 B;  2LUL A;  4HB3 B;  1UPQ A;  2ROZ B;  2VKI A;  2CRF A;  1TJ6 A;  2P0F A;  1BAK A;  2H7D A;  1Y19 B;  4YL8 A;  2RNR B;  2G35 A;  2JP2 A;  4HAU B;  1GC7 A;  2COD A;  1XCG A;  1MK7 B;  2V76 A;  1P5T A;  3ZVR A;  3P6A A;  3AU5 A;  1U5E A;  2RLO A;  1GG3 A;  4GMX B;  2KUP A;  3PP2 A;  1BWN A;  3HK0 A;  3N7C A;  2J0M A;  2DKQ A; 
#chains in the Genus database with same CATH topology
 2J0K A;  4WSF A;  4K17 A;  3F0W A;  2YS1 A;  4WJ7 A;  3B77 A;  2M14 A;  4HHV A;  2N0Y A;  1XOD A;  2R09 A;  1FHW A;  3PVU A;  5HE1 A;  2KR0 A;  1W1H A;  1U5D A;  2KUQ A;  1PLS A;  4WVF B;  2EMT A;  1N3H A;  1W1D A;  1XR0 B;  3FVC A;  3OHM B;  4HAV B;  2R2Y A;  2AL6 A;  2LG1 A;  4D0N B;  1QC6 A;  3WA0 A;  3GYO A;  4KHB A;  2YS3 A;  3WYF B;  1DYN A;  1QQG A;  3TW1 A;  4KVG B;  4K81 A;  1TQZ A;  1M7E A;  1U2B A;  3SUZ A;  1FAO A;  2CAY A;  1MPH A;  3DXC A;  4P7I A;  3FEH A;  4GNK B;  5D3Y A;  2I5F A;  3CXB B;  2LOX A;  1Y5O A;  5C5B A;  2KIE A;  1FHX A;  2DX1 A;  5J3Q A;  1RRP B;  2DYN A;  3PEG A;  4DBB A;  1EGX A;  1OQN A;  2N23 A;  3KY9 A;  1NTY A;  3GYP A;  1WJM A;  4A6F A;  1UNR A;  3ZDT A;  1GC6 A;  3F5R A;  1H10 A;  3AU4 A;  3HQC A;  2Z0O A;  1U27 A;  4YON A;  4KHO A;  1BTN A;  3HW2 B;  2DN6 A;  3M1I B;  4DX9 0;  3DXD A;  2AEH A;  2J0J A;  4A6F B;  1MKE A;  4XWX A;  2GCL A;  2YS5 A;  1ZSQ A;  1Z87 A;  2D9V A;  3ML4 A;  1WG7 A;  1E5W A;  3ULC A;  4EKU A;  5LG4 B;  2YF0 A;  3FM8 C;  4F7G A;  4GOU A;  3ODW A;  2Y8G A;  2CY4 A;  4EMO A;  1ZM0 A;  1UNP A;  5CLL B;  4MT7 A;  1FOE A;  2KGX B;  1OY2 A;  5I2S A;  3PZD A;  2D4Q A;  2DKP A;  2W2W A;  2DX5 A;  4BBK A;  4GPT B;  3A98 B;  3VIA A;  4A5K A;  1XKE A;  2P0D A;  2ELA A;  2LKO A;  2K2J A;  4A6K A;  3PSC A;  2XQN M;  5C6R A;  4MY6 A;  3VOQ A;  2I5C A;  3U12 A;  3ODX A;  3KRW A;  2RRF A;  2UVM A;  5J3T A;  4HSI A;  2M38 A;  1FHO A;  5DH9 B;  2YT0 A;  1U5F A;  1P6S A;  1X05 A;  3CIK A;  2ADZ A;  5D3V A;  3U8Z A;  1EVH A;  1J0W A;  1DBH A;  1X1F A;  1FGY A;  2ROV A;  3HIE A;  2FJL A;  1DDM A;  1X86 A;  1M7R A;  3HSA A;  3NSU A;  2I1J A;  4KHA A;  1XX0 A;  1H4R A;  2ELB A;  3U7D A;  4GZU A;  5D27 A;  3FSS A;  2Y8F A;  1V5P A;  3DXE A;  2YT1 A;  4PQ0 A;  1DDW A;  1PMS A;  5JHH A;  1AWE A;  1I7A A;  1TXD A;  1KZG A;  1MIX A;  2NMB A;  4QJ5 B;  2DTC A;  2I1K A;  2EJ8 A;  2D11 A;  1MIZ B;  2Z13 A;  5JHG A;  4OT1 A;  2YSZ A;  5EFX A;  1FB8 A;  3MDB C;  1U29 A;  3TFM A;  2L1C A;  5M4Y B;  1NTV A;  1WGQ A;  2HE7 A;  4CHM A;  2GUM A;  4MK0 A;  1X1G A;  2Z0P A;  1OMW A;  2P8V A;  4IFS A;  1K5D B;  2KIG A;  2EMS A;  4TKN A;  4C0A A;  1V88 A;  1U5G A;  4IAP A;  3OAN A;  3G9W A;  1T77 A;  2VSZ A;  1UEF A;  2COA A;  1WVH A;  1DDV A;  1KI1 B;  1EAZ A;  2KCJ A;  4NSW A;  1V5U A;  3SNH A;  2W2X C;  2E2X A;  4HAZ B;  5JP4 A;  4Y94 A;  1W1G A;  2DA0 A;  4HDQ A;  4KHB B;  1PFJ A;  2DYQ A;  2GJY A;  2Z59 A;  4NY0 A;  2Z14 A;  3MPX A;  5HE0 A;  4D6W A;  5D3X A;  2D9Y A;  2RVB B;  3A8Q A;  4CSQ A;  3TCA A;  2MWN B;  1BTK A;  2YT2 A;  3SO6 A;  5IRS A;  2Q13 A;  2D9X A;  2IYB A;  3P7Z A;  3TVV A;  2UZR A;  4F7U P;  2GS0 A;  1X11 A;  2COF A;  2VRW B;  4QJ4 B;  4ZRK A;  4HB4 B;  3SV1 A;  3RCP A;  4L1R A;  1ZYI A;  4CYE A;  4K2O A;  3BIN A;  4DIX A;  1V5M A;  4Z2N A;  2P0H A;  3ODO A;  2ZKM X;  4HB0 B;  3NW8 A;  2NZ8 B;  2MFQ A;  2R0D A;  2RGN B;  3ULB A;  4TYZ A;  2YRY A;  3NWF A;  1AQC A;  2X18 A;  3KRX A;  5I2M A;  4DX8 A;  3AJ4 A;  5KCV A;  4ZRI A;  3V5W A;  1KZ7 A;  4GXB A;  5JLJ B;  5DIF B;  5FI1 A;  2D10 A;  1ZC3 B;  5KQ4 A;  4B6H A;  2D2Q A;  2Z4D A;  1RJ2 A;  5HE3 A;  2LOZ A;  4ZRJ A;  2HTH B;  3BJI A;  2UZS A;  5C5B B;  2W2X D;  4A6H A;  2QKL A;  4IOY X;  3QBV B;  4QXA B;  3KZ1 A;  1WJ1 A;  3X23 A;  2Z0Q A;  3NWA A;  4PNK A;  4K2P A;  2FJU B;  5D3W A;  3D8D A;  4HAW B;  1ZVR A;  1NU2 A;  3PG7 A;  3PVW A;  4GN1 A;  5KQ1 A;  4H8S A;  5J3Y A;  5GOW B;  5C16 A;  3UZT A;  3A8P A;  3SYX A;  2RSG A;  2D9Z A;  2MDX A;  1SGH A;  5DHA B;  2COC A;  5LOP B;  2IFS A;  2YVC A;  2GCJ A;  1SHC A;  1WGU A;  3TO1 A;  3IVF A;  1ZC4 B;  1NI2 A;  4HAT B;  4HDO A;  2PZ1 A;  4F7H A;  4KAX B;  3DCX A;  5FI0 A;  3QWM A;  1V89 A;  2OQB A;  4HAY B;  3PVL A;  1LB1 A;  2MKR A;  4EJN A;  5DHF B;  5C79 A;  3D8F A;  4QJ3 B;  2K2U A;  1P3R A;  2QKM A;  2J59 M;  1ISN A;  1UPR A;  1K5G B;  1V61 A;  2DHK A;  5CLQ B;  2LYD A;  2OTX A;  4L6E A;  2D9W A;  1WI1 A;  3QIJ A;  3D8E A;  3O96 A;  2EC1 A;  4GMV A;  1UNQ A;  2Y7B A;  1MK9 B;  1FGZ A;  5L81 A;  2BCJ A;  1EF1 A;  4Z2M B;  4OSN A;  5HE2 A;  3LJU X;  4CHJ A;  5LON B;  5DI9 B;  2DHJ A;  2K00 A;  1LW3 A;  2DLW A;  2H7E A;  2DHI A;  1MAI A;  3T06 A;  1I2H A;  1XD4 A;  2L2I A;  1MI1 A;  1IRS A;  2ZPY A;  2DFK A;  3KSY A;  1B55 A;  4HAX B;  1J19 A;  2CY5 A;  1Q67 A;  2RUK B;  1DRO A;  4DXA B;  4HB2 B;  2LUL A;  4HB3 B;  1UPQ A;  2ROZ B;  2VKI A;  2CRF A;  1TJ6 A;  2P0F A;  1BAK A;  2H7D A;  1Y19 B;  4YL8 A;  2RNR B;  2G35 A;  2NBV A;  2JP2 A;  4HAU B;  1GC7 A;  2COD A;  1XCG A;  2K49 A;  1MK7 B;  2V76 A;  3A58 A;  2K8E A;  1P5T A;  3ZVR A;  3P6A A;  3AU5 A;  3NWD A;  1U5E A;  2RLO A;  1GG3 A;  4GMX B;  2KUP A;  3PP2 A;  1BWN A;  3HK0 A;  3N7C A;  2J0M A;  2DKQ A; 
#chains in the Genus database with same CATH homology
 2J0K A;  4WSF A;  4K17 A;  3F0W A;  2YS1 A;  4WJ7 A;  2M14 A;  4HHV A;  2N0Y A;  1XOD A;  2R09 A;  1FHW A;  3PVU A;  5HE1 A;  1W1H A;  1U5D A;  1PLS A;  4WVF B;  2EMT A;  1N3H A;  1W1D A;  1XR0 B;  4HAV B;  2AL6 A;  2LG1 A;  4D0N B;  1QC6 A;  3WA0 A;  3GYO A;  2YS3 A;  3WYF B;  1DYN A;  1QQG A;  3TW1 A;  4KVG B;  4K81 A;  1TQZ A;  1M7E A;  1U2B A;  3SUZ A;  1FAO A;  2CAY A;  1MPH A;  3DXC A;  4P7I A;  3FEH A;  5D3Y A;  2I5F A;  3CXB B;  2LOX A;  1Y5O A;  5C5B A;  1FHX A;  2DX1 A;  5J3Q A;  1RRP B;  2DYN A;  3PEG A;  4DBB A;  1EGX A;  1OQN A;  2N23 A;  3KY9 A;  1NTY A;  3GYP A;  1WJM A;  4A6F A;  1UNR A;  3ZDT A;  1GC6 A;  3F5R A;  1H10 A;  3AU4 A;  3HQC A;  2Z0O A;  1U27 A;  4YON A;  4KHO A;  1BTN A;  3HW2 B;  2DN6 A;  3M1I B;  4DX9 0;  3DXD A;  2AEH A;  2J0J A;  4A6F B;  1MKE A;  4XWX A;  2GCL A;  2YS5 A;  1ZSQ A;  1Z87 A;  2D9V A;  3ML4 A;  1WG7 A;  1E5W A;  3ULC A;  4EKU A;  2YF0 A;  3FM8 C;  4F7G A;  3ODW A;  2Y8G A;  2CY4 A;  4EMO A;  1ZM0 A;  1UNP A;  5CLL B;  4MT7 A;  1FOE A;  2KGX B;  1OY2 A;  3PZD A;  2D4Q A;  2DKP A;  2W2W A;  2DX5 A;  4BBK A;  4GPT B;  3A98 B;  3VIA A;  4A5K A;  1XKE A;  2P0D A;  2ELA A;  2LKO A;  2K2J A;  4A6K A;  3PSC A;  2XQN M;  5C6R A;  4MY6 A;  3VOQ A;  2I5C A;  3ODX A;  3KRW A;  2UVM A;  5J3T A;  2M38 A;  1FHO A;  5DH9 B;  2YT0 A;  1U5F A;  1P6S A;  1X05 A;  3CIK A;  2ADZ A;  5D3V A;  3U8Z A;  1EVH A;  1J0W A;  1DBH A;  1X1F A;  1FGY A;  2ROV A;  1DDM A;  2FJL A;  1X86 A;  1M7R A;  3NSU A;  2I1J A;  4KHA A;  1XX0 A;  1H4R A;  2ELB A;  3U7D A;  4GZU A;  5D27 A;  3FSS A;  2Y8F A;  1V5P A;  3DXE A;  2YT1 A;  4PQ0 A;  1DDW A;  1PMS A;  5JHH A;  1AWE A;  1I7A A;  1TXD A;  1KZG A;  1MIX A;  2NMB A;  2DTC A;  2I1K A;  2EJ8 A;  2D11 A;  1MIZ B;  5JHG A;  2YSZ A;  5EFX A;  1FB8 A;  3MDB C;  1U29 A;  3TFM A;  2L1C A;  1NTV A;  1WGQ A;  2HE7 A;  4CHM A;  4MK0 A;  1X1G A;  2Z0P A;  1OMW A;  2P8V A;  4IFS A;  1K5D B;  2EMS A;  4TKN A;  4C0A A;  1V88 A;  1U5G A;  4IAP A;  3OAN A;  3G9W A;  2VSZ A;  1UEF A;  2COA A;  1WVH A;  1DDV A;  1KI1 B;  1EAZ A;  2KCJ A;  4NSW A;  1V5U A;  3SNH A;  2W2X C;  2E2X A;  4HAZ B;  5JP4 A;  4Y94 A;  1W1G A;  2DA0 A;  4HDQ A;  4KHB B;  1PFJ A;  2DYQ A;  2GJY A;  4NY0 A;  3MPX A;  5HE0 A;  5D3X A;  2D9Y A;  2RVB B;  3A8Q A;  3TCA A;  2MWN B;  1BTK A;  3SO6 A;  2Q13 A;  2D9X A;  2IYB A;  3P7Z A;  3TVV A;  2UZR A;  4F7U P;  2GS0 A;  1X11 A;  2COF A;  2VRW B;  4ZRK A;  4HB4 B;  3SV1 A;  3RCP A;  4CYE A;  4K2O A;  3BIN A;  1V5M A;  4Z2N A;  2P0H A;  3ODO A;  4HB0 B;  2NZ8 B;  2MFQ A;  2R0D A;  2RGN B;  3ULB A;  4TYZ A;  2YRY A;  1AQC A;  2X18 A;  3KRX A;  4DX8 A;  3AJ4 A;  5KCV A;  4ZRI A;  3V5W A;  1KZ7 A;  4GXB A;  5JLJ B;  5DIF B;  5FI1 A;  2D10 A;  1ZC3 B;  5KQ4 A;  4B6H A;  2D2Q A;  1RJ2 A;  5HE3 A;  2LOZ A;  4ZRJ A;  2HTH B;  3BJI A;  2UZS A;  5C5B B;  2W2X D;  4A6H A;  2QKL A;  4IOY X;  3QBV B;  3KZ1 A;  1WJ1 A;  3X23 A;  2Z0Q A;  4PNK A;  4K2P A;  5D3W A;  3D8D A;  4HAW B;  1ZVR A;  1NU2 A;  3PG7 A;  3PVW A;  4GN1 A;  5KQ1 A;  4H8S A;  5J3Y A;  5GOW B;  5C16 A;  3UZT A;  3A8P A;  3SYX A;  2RSG A;  2D9Z A;  2MDX A;  1SGH A;  5DHA B;  2COC A;  5LOP B;  2IFS A;  2YVC A;  2GCJ A;  1SHC A;  1WGU A;  3TO1 A;  3IVF A;  1ZC4 B;  1NI2 A;  4HAT B;  4HDO A;  2PZ1 A;  4F7H A;  4KAX B;  5FI0 A;  3QWM A;  1V89 A;  2OQB A;  4HAY B;  3PVL A;  1LB1 A;  2MKR A;  4EJN A;  5DHF B;  5C79 A;  3D8F A;  2K2U A;  1P3R A;  2QKM A;  2J59 M;  1ISN A;  1UPR A;  1K5G B;  1V61 A;  2DHK A;  5CLQ B;  2LYD A;  2OTX A;  4L6E A;  2D9W A;  1WI1 A;  3QIJ A;  3D8E A;  3O96 A;  2EC1 A;  4GMV A;  1UNQ A;  2Y7B A;  1MK9 B;  1FGZ A;  5L81 A;  2BCJ A;  1EF1 A;  4Z2M B;  5HE2 A;  3LJU X;  4CHJ A;  5LON B;  5DI9 B;  2DHJ A;  2K00 A;  1LW3 A;  2DLW A;  2H7E A;  2DHI A;  1MAI A;  3T06 A;  1I2H A;  1XD4 A;  2L2I A;  1IRS A;  2ZPY A;  2DFK A;  3KSY A;  1B55 A;  4HAX B;  1J19 A;  2CY5 A;  1Q67 A;  2RUK B;  1DRO A;  4DXA B;  4HB2 B;  2LUL A;  4HB3 B;  1UPQ A;  2ROZ B;  2VKI A;  2CRF A;  1TJ6 A;  2P0F A;  1BAK A;  2H7D A;  1Y19 B;  4YL8 A;  2RNR B;  2G35 A;  2JP2 A;  4HAU B;  1GC7 A;  2COD A;  1XCG A;  1MK7 B;  2V76 A;  1P5T A;  3ZVR A;  3P6A A;  3AU5 A;  1U5E A;  2RLO A;  1GG3 A;  4GMX B;  2KUP A;  3PP2 A;  1BWN A;  3HK0 A;  3N7C A;  2J0M A;  2DKQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...