1XODA

Crystal structure of x. tropicalis spred1 evh-1 domain
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
114
structure length
105
Chain Sequence
SYARVRAVVMTRDDSSGGWLQLGGGGLSSVTVSKTEFLVHGERLRDKTVVLECVLRRDLVYNKVTPTFHHWRIGDKKFGLTFQSPADARAFDRGIRRAIEDLSQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 1.15A Crystal structure of the X. tropicalis Spred1 EVH1 domain suggests a fourth distinct peptide-binding mechanism within the EVH1 family
pubmed doi rcsb
source organism Xenopus tropicalis
molecule tags Signaling protein
molecule keywords Spred1
total genus 23
structure length 105
sequence length 114
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00568 WH1 WH1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1xodA00
4TKNA 4A6FB 2KCJA 2LOXA 2I5FA 1NTYA 2E2XA 2RLOA 1DBHA 4GMVA 2LG1A 3DXEA 1WG7A 4EJNA 1EVHA 1UNQA 4HATB 1X86A 4GMXB 5FI0A 2D9XA 4IAPA 2DTCA 3BJIA 4GN1A 1V5MA 2Y8FA 4CHJA 3ML4A 1AWEA 4CYEA 2YRYA 2MKRA 4F7UP 2DKQA 2K00A 3UZTA 3F0WA 2DN6A 3AJ4A 2NMBA 3GYPA 4ZRKA 1DROA 1X1FA 3QIJA 1V89A 1TJ6A 1XR0B 4YONA 5J3QA 5C5BA 2DHJA 2CY5A 1WGQA 3FM8C 5L81A 5D3YA 2UVMA 1M7EA 2ROZB 3P7ZA 1H10A 5HE0A 4ZRJA 3HK0A 2UZRA 2COFA 4K81A 1RRPB 2GCJA 2CRFA 5HE2A 2RSGA 3D8FA 2K2JA 4IOYX 2DX5A 2XQNM 2DX1A 3TFMA 2KUPA 1EAZA 2YT0A 1J19A 2K2UA 2MDXA 3DXCA 3CXBB 4KAXB 5D3VA 4Z2NA 5D3WA 4EMOA 3SUZA 2EMTA 4HAWB 2NZ8B 2Z0OA 2DHKA 2P0DA 2YF0A 5JHGA 1PFJA 2BCJA 4PNKA 2IYBA 3PSCA 2CAYA 1X1GA 2P0FA 3TVVA 2HTHB 2AL6A 3SO6A 4F7GA 3A8PA 4A6FA 1PMSA 2M38A 3SV1A 4CHMA 3MDBC 2R09A 5KQ4A 3N7CA 2Y7BA 1Y19B 3ODWA 5FI1A 3HW2B 1DYNA 4DX8A 4HB4B 2DHIA 4DXAB 1OQNA 4HHVA 3MPXA 2J0JA 4HB3B 1DDVA 4HAVB 3BINA 2L1CA 1AQCA 1H4RA 3FEHA 4HDQA 2RGNB 2D10A 4YL8A 3LJUX 2YS1A 2I1KA 1UNRA 2X18A 4P7IA 2DFKA 1FGYA 4HDOA 4ZRIA 2ADZA 2P8VA 4C0AA 2W2WA 1U5DA 2DLWA 3KZ1A 2VRWB 3ODXA 4Z2MB 3PZDA 2H7DA 4EKUA 2ROVA 1W1HA 2YS5A 3D8EA 4PQ0A 1Z87A 1UPQA 1MIXA 4GXBA 2FJLA 2YVCA 2W2XD 3OANA 3A98B 5CLLB 3PVWA 3KY9A 2IFSA 2GJYA 1WJMA 2JP2A 2Z0QA 5JHHA 2ELBA 2J59M 1QC6A 2LOZA 1V5PA 3ULBA 1MK9B 2RNRB 3VIAA 1PLSA 4XWXA 4MY6A 5CLQB 2D9VA 3V5WA 2VKIA 2Z0PA 2GS0A 2L2IA 5J3TA 1B55A 1NU2A 2AEHA 1KI1B 4HAZB 5HE3A 1LW3A 4NY0A 2EJ8A 1WJ1A 1MAIA 2RVBB 2RUKB 2MWNB 4HAXB 5DIFB 1XCGA 3PG7A 2Q13A 4MT7A 2V76A 1FHOA 1FOEA 1LB1A 1V61A 2DA0A 2W2XC 2YSZA 3D8DA 4KHBB 5J3YA 4B6HA 1RJ2A 4K2PA 3SNHA 2N23A 3X23A 5HE1A 2QKMA 2M14A 2LYDA 3VOQA 4WSFA 2ZPYA 5JP4A 2G35A 3GYOA 3WYFB 2EMSA 1SGHA 2D11A 2KGXB 2QKLA 1X11A 1OY2A 3A8QA 4DBBA 3PEGA 1Y5OA 5DH9B 5DI9B 3DXDA 4WVFB 2OQBA 2LKOA 3RCPA 3ULCA 3PP2A 1W1GA 2D9WA 2I1JA 4HAUB 2YS3A 2D9YA 1BWNA 2D9ZA 3FSSA 2EC1A 2N0YA 2DYQA 1GC6A 3QWMA 4DX90 1EGXA 2PZ1A 1KZ7A 5D27A 1DDMA 2YT1A 1U27A 1QQGA 3G9WA 2CODA 1TQZA 1OMWA 3HQCA 1E5WA 5DHAB 2GCLA 4MK0A 4BBKA 4IFSA 5KQ1A 1ZSQA 2LULA 4D0NB 1GC7A 1P6SA 4NSWA 4K2OA 3PVUA 1UEFA 5GOWB 4KVGB 2DYNA 2VSZA 3PVLA 5C79A 4HB0B 2COCA 1M7RA 1UPRA 1IRSA 1SHCA 3CIKA 3T06A 1N3HA 1U29A 1FGZA 1MKEA 1V88A 1ISNA 1TXDA 5LOPB 3P6AA 3U8ZA 1K5DB 1NTVA 1ZC4B 2ELAA 2OTXA 3SYXA 3AU4A 2R0DA 1BTNA 4Y94A 1GG3A 1UNPA 1FB8A 5C16A 4HAYB 1ZM0A 1MIZB 5C6RA 5KCVA 5DHFB 3NSUA 3ZVRA 1U5GA 4WJ7A 1DDWA 1FHWA 3WA0A 3AU5A 4KHOA 1NI2A 3KRWA 1FHXA 4A5KA 3KSYA 5LONB 3TO1A 2MFQA 2HE7A 4TYZA 2UZSA 1K5GB 3KRXA 1XD4A 4K17A 3F5RA 1EF1A 1KZGA 1BAKA 4F7HA 1V5UA 1MPHA 4L6EA 1ZVRA 4GPTB 3U7DA 2H7EA 1WVHA 1ZC3B 3TCAA 1U5FA 3ODOA 1WGUA 1U5EA 2J0MA 1WI1A 2J0KA 2Y8GA 1XX0A 3M1IB 1P3RA 1XODA 4HB2B 1U2BA 3O96A 3TW1A 1MK7B 3QBVB 2DKPA 1XKEA 4KHAA 2CY4A 5JLJB 1W1DA 3IVFA 4GZUA 1I7AA 1FAOA 5C5BB 1P5TA 2D2QA 2D4QA 4A6HA 2I5CA 1X05A 5D3XA 1Q67A 3ZDTA 2P0HA 5EFXA 4A6KA 1J0WA 1BTKA 1I2HA 2COAA 4H8SA
chains in the Genus database with same CATH superfamily
4TKNA 4A6FB 2KCJA 2LOXA 2I5FA 1NTYA 2E2XA 2RLOA 1DBHA 4GMVA 2LG1A 3DXEA 1WG7A 4EJNA 1EVHA 1UNQA 3B77A 4HATB 1X86A 2KR0A 4GMXB 5FI0A 2D9XA 4IAPA 2DTCA 3BJIA 4GN1A 1V5MA 2Y8FA 4CHJA 3ML4A 1AWEA 4CYEA 2YRYA 2MKRA 4F7UP 2DKQA 2K00A 3UZTA 3F0WA 2DN6A 3AJ4A 2NMBA 3GYPA 4ZRKA 1DROA 1X1FA 3QIJA 1V89A 1TJ6A 1XR0B 4YONA 5J3QA 3NW8A 5C5BA 2DHJA 4QJ3B 2CY5A 1WGQA 3FM8C 5L81A 5D3YA 2UVMA 1M7EA 2ROZB 3P7ZA 1H10A 5HE0A 4ZRJA 3HK0A 2UZRA 2COFA 4K81A 1RRPB 2GCJA 2CRFA 5HE2A 2RSGA 3D8FA 2K2JA 4IOYX 2DX5A 2FJUB 2XQNM 2DX1A 3TFMA 2KUPA 1EAZA 2YT0A 5I2MA 1J19A 2K2UA 2MDXA 3DXCA 3CXBB 4KAXB 5D3VA 3U12A 4Z2NA 5D3WA 4EMOA 3SUZA 2EMTA 4HAWB 2NZ8B 2Z0OA 2DHKA 2P0DA 2YF0A 5JHGA 1PFJA 2BCJA 4PNKA 2IYBA 2K49A 3PSCA 3FVCA 2CAYA 1X1GA 2P0FA 3TVVA 2KIEA 2HTHB 2AL6A 3SO6A 4F7GA 3A8PA 4A6FA 1PMSA 2M38A 3SV1A 2KUQA 4CHMA 3MDBC 2R09A 5KQ4A 3N7CA 2Y7BA 1Y19B 3ODWA 5FI1A 3HW2B 1DYNA 4L1RA 4DX8A 4HB4B 2DHIA 4DXAB 1OQNA 4HHVA 3MPXA 2J0JA 4HB3B 1DDVA 4HAVB 4QXAB 3BINA 2L1CA 1AQCA 1H4RA 3FEHA 4HDQA 2RGNB 2D10A 2YT2A 4YL8A 3LJUX 4DIXA 2YS1A 2I1KA 1UNRA 2X18A 4P7IA 2DFKA 5LG4B 2Z13A 1FGYA 4HDOA 4ZRIA 1ZYIA 2ADZA 2P8VA 4C0AA 2W2WA 1U5DA 2DLWA 3KZ1A 2VRWB 3ODXA 4Z2MB 3PZDA 2H7DA 4EKUA 2ROVA 1W1HA 2YS5A 3D8EA 4PQ0A 1Z87A 1UPQA 1MIXA 4GXBA 2FJLA 2YVCA 2W2XD 3OANA 3A98B 5CLLB 3PVWA 3KY9A 2IFSA 2GJYA 1WJMA 2JP2A 2Z0QA 5JHHA 2ELBA 2J59M 1QC6A 2LOZA 1V5PA 3ULBA 1MK9B 2RNRB 3VIAA 1PLSA 4XWXA 4MY6A 5CLQB 2D9VA 3NWAA 3V5WA 2VKIA 2Z0PA 2GS0A 2L2IA 5J3TA 1B55A 1NU2A 2AEHA 1KI1B 4HAZB 5HE3A 1LW3A 4NY0A 5I2SA 2EJ8A 1WJ1A 1MAIA 2RVBB 2RUKB 2MWNB 4HAXB 5DIFB 4HSIA 1XCGA 3PG7A 2Q13A 4MT7A 2V76A 1FHOA 1FOEA 1LB1A 1V61A 2ZKMX 2DA0A 2W2XC 4CSQA 2YSZA 3D8DA 4KHBB 5J3YA 4B6HA 1RJ2A 4K2PA 3SNHA 2KIGA 2N23A 4OT1A 3X23A 5HE1A 2QKMA 2M14A 2LYDA 3VOQA 4WSFA 2ZPYA 5JP4A 2G35A 3GYOA 3WYFB 2EMSA 1SGHA 2D11A 2KGXB 2QKLA 1X11A 1OY2A 3A8QA 4DBBA 2R2YA 3PEGA 1Y5OA 5DH9B 5DI9B 3DXDA 4WVFB 1T77A 2OQBA 2LKOA 3RCPA 3ULCA 3PP2A 1W1GA 2D9WA 2I1JA 4HAUB 2YS3A 2D9YA 1BWNA 2D9ZA 3FSSA 2EC1A 2N0YA 2RRFA 2DYQA 1GC6A 3QWMA 4DX90 1EGXA 1MI1A 2PZ1A 1KZ7A 3NWDA 5D27A 1DDMA 2YT1A 1U27A 1QQGA 3G9WA 2CODA 3A58A 1TQZA 1OMWA 3HQCA 1E5WA 5DHAB 2GCLA 3OHMB 4MK0A 4BBKA 4IFSA 5KQ1A 1ZSQA 5IRSA 2LULA 4D0NB 2K8EA 1GC7A 1P6SA 4NSWA 2GUMA 4K2OA 3PVUA 1UEFA 4KHBA 5GOWB 4KVGB 2DYNA 2VSZA 3PVLA 5C79A 4HB0B 2COCA 1M7RA 1UPRA 1IRSA 1SHCA 3CIKA 3T06A 1N3HA 2Z59A 1U29A 1FGZA 4GOUA 1MKEA 1V88A 4QJ5B 1ISNA 1TXDA 5LOPB 3P6AA 3U8ZA 1K5DB 1NTVA 1ZC4B 2ELAA 2OTXA 3SYXA 3AU4A 2R0DA 1BTNA 4Y94A 1GG3A 1UNPA 1FB8A 2Z14A 3HIEA 5C16A 4HAYB 1ZM0A 1MIZB 5C6RA 5KCVA 5DHFB 3NSUA 3ZVRA 1U5GA 4WJ7A 4QJ4B 1DDWA 1FHWA 3WA0A 3AU5A 4KHOA 1NI2A 3KRWA 1FHXA 4A5KA 3KSYA 5LONB 3TO1A 2Z4DA 3NWFA 2MFQA 2HE7A 4TYZA 2UZSA 1K5GB 3KRXA 1XD4A 4K17A 3F5RA 1EF1A 1KZGA 5M4YB 1BAKA 4F7HA 1V5UA 1MPHA 4L6EA 1ZVRA 4GPTB 3U7DA 2H7EA 1WVHA 1ZC3B 3TCAA 1U5FA 3ODOA 1WGUA 1U5EA 2J0MA 3DCXA 1WI1A 2J0KA 2Y8GA 1XX0A 3M1IB 1P3RA 1XODA 4HB2B 1U2BA 3O96A 3TW1A 1MK7B 3QBVB 2DKPA 1XKEA 4KHAA 2CY4A 5JLJB 1W1DA 4OSNA 3IVFA 4GZUA 1I7AA 1FAOA 2NBVA 5C5BB 1P5TA 2D2QA 4D6WA 2D4QA 3HSAA 4A6HA 2I5CA 4GNKB 1X05A 5D3XA 1Q67A 3ZDTA 2P0HA 5EFXA 4A6KA 1J0WA 1BTKA 1I2HA 2COAA 4H8SA
chains in the Genus database with same CATH topology
4TKNA 4A6FB 2KCJA 2LOXA 2I5FA 1NTYA 2E2XA 2RLOA 1DBHA 4GMVA 2LG1A 3DXEA 1WG7A 4EJNA 1EVHA 1UNQA 4HATB 1X86A 4GMXB 5FI0A 2D9XA 4IAPA 2DTCA 3BJIA 4GN1A 1V5MA 2Y8FA 4CHJA 3ML4A 1AWEA 4CYEA 2YRYA 2MKRA 4F7UP 2DKQA 2K00A 3UZTA 3F0WA 2DN6A 3AJ4A 2NMBA 3GYPA 4ZRKA 1DROA 1X1FA 3QIJA 1V89A 1TJ6A 1XR0B 4YONA 5J3QA 5C5BA 2DHJA 2CY5A 1WGQA 3FM8C 5L81A 5D3YA 2UVMA 1M7EA 2ROZB 3P7ZA 1H10A 5HE0A 4ZRJA 3HK0A 2UZRA 2COFA 4K81A 1RRPB 2GCJA 2CRFA 5HE2A 2RSGA 3D8FA 2K2JA 4IOYX 2DX5A 2XQNM 2DX1A 3TFMA 2KUPA 1EAZA 2YT0A 1J19A 2K2UA 2MDXA 3DXCA 3CXBB 4KAXB 5D3VA 4Z2NA 5D3WA 4EMOA 3SUZA 2EMTA 4HAWB 2NZ8B 2Z0OA 2DHKA 2P0DA 2YF0A 5JHGA 1PFJA 2BCJA 4PNKA 2IYBA 3PSCA 2CAYA 1X1GA 2P0FA 3TVVA 2HTHB 2AL6A 3SO6A 4F7GA 3A8PA 4A6FA 1PMSA 2M38A 3SV1A 4CHMA 3MDBC 2R09A 5KQ4A 3N7CA 2Y7BA 1Y19B 3ODWA 5FI1A 3HW2B 1DYNA 4DX8A 4HB4B 2DHIA 4DXAB 1OQNA 4HHVA 3MPXA 2J0JA 4HB3B 1DDVA 4HAVB 3BINA 2L1CA 1AQCA 1H4RA 3FEHA 4HDQA 2RGNB 2D10A 4YL8A 3LJUX 2YS1A 2I1KA 1UNRA 2X18A 4P7IA 2DFKA 1FGYA 4HDOA 4ZRIA 2ADZA 2P8VA 4C0AA 2W2WA 1U5DA 2DLWA 3KZ1A 2VRWB 3ODXA 4Z2MB 3PZDA 2H7DA 4EKUA 2ROVA 1W1HA 2YS5A 3D8EA 4PQ0A 1Z87A 1UPQA 1MIXA 4GXBA 2FJLA 2YVCA 2W2XD 3OANA 3A98B 5CLLB 3PVWA 3KY9A 2IFSA 2GJYA 1WJMA 2JP2A 2Z0QA 5JHHA 2ELBA 2J59M 1QC6A 2LOZA 1V5PA 3ULBA 1MK9B 2RNRB 3VIAA 1PLSA 4XWXA 4MY6A 5CLQB 2D9VA 3V5WA 2VKIA 2Z0PA 2GS0A 2L2IA 5J3TA 1B55A 1NU2A 2AEHA 1KI1B 4HAZB 5HE3A 1LW3A 4NY0A 2EJ8A 1WJ1A 1MAIA 2RVBB 2RUKB 2MWNB 4HAXB 5DIFB 1XCGA 3PG7A 2Q13A 4MT7A 2V76A 1FHOA 1FOEA 1LB1A 1V61A 2DA0A 2W2XC 2YSZA 3D8DA 4KHBB 5J3YA 4B6HA 1RJ2A 4K2PA 3SNHA 2N23A 3X23A 5HE1A 2QKMA 2M14A 2LYDA 3VOQA 4WSFA 2ZPYA 5JP4A 2G35A 3GYOA 3WYFB 2EMSA 1SGHA 2D11A 2KGXB 2QKLA 1X11A 1OY2A 3A8QA 4DBBA 3PEGA 1Y5OA 5DH9B 5DI9B 3DXDA 4WVFB 2OQBA 2LKOA 3RCPA 3ULCA 3PP2A 1W1GA 2D9WA 2I1JA 4HAUB 2YS3A 2D9YA 1BWNA 2D9ZA 3FSSA 2EC1A 2N0YA 2DYQA 1GC6A 3QWMA 4DX90 1EGXA 2PZ1A 1KZ7A 5D27A 1DDMA 2YT1A 1U27A 1QQGA 3G9WA 2CODA 1TQZA 1OMWA 3HQCA 1E5WA 5DHAB 2GCLA 4MK0A 4BBKA 4IFSA 5KQ1A 1ZSQA 2LULA 4D0NB 1GC7A 1P6SA 4NSWA 4K2OA 3PVUA 1UEFA 5GOWB 4KVGB 2DYNA 2VSZA 3PVLA 5C79A 4HB0B 2COCA 1M7RA 1UPRA 1IRSA 1SHCA 3CIKA 3T06A 1N3HA 1U29A 1FGZA 1MKEA 1V88A 1ISNA 1TXDA 5LOPB 3P6AA 3U8ZA 1K5DB 1NTVA 1ZC4B 2ELAA 2OTXA 3SYXA 3AU4A 2R0DA 1BTNA 4Y94A 1GG3A 1UNPA 1FB8A 5C16A 4HAYB 1ZM0A 1MIZB 5C6RA 5KCVA 5DHFB 3NSUA 3ZVRA 1U5GA 4WJ7A 1DDWA 1FHWA 3WA0A 3AU5A 4KHOA 1NI2A 3KRWA 1FHXA 4A5KA 3KSYA 5LONB 3TO1A 2MFQA 2HE7A 4TYZA 2UZSA 1K5GB 3KRXA 1XD4A 4K17A 3F5RA 1EF1A 1KZGA 1BAKA 4F7HA 1V5UA 1MPHA 4L6EA 1ZVRA 4GPTB 3U7DA 2H7EA 1WVHA 1ZC3B 3TCAA 1U5FA 3ODOA 1WGUA 1U5EA 2J0MA 1WI1A 2J0KA 2Y8GA 1XX0A 3M1IB 1P3RA 1XODA 4HB2B 1U2BA 3O96A 3TW1A 1MK7B 3QBVB 2DKPA 1XKEA 4KHAA 2CY4A 5JLJB 1W1DA 3IVFA 4GZUA 1I7AA 1FAOA 5C5BB 1P5TA 2D2QA 2D4QA 4A6HA 2I5CA 1X05A 5D3XA 1Q67A 3ZDTA 2P0HA 5EFXA 4A6KA 1J0WA 1BTKA 1I2HA 2COAA 4H8SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4TKN A;  4A6F B;  2KCJ A;  2LOX A;  2I5F A;  1NTY A;  2E2X A;  2RLO A;  1DBH A;  4GMV A;  2LG1 A;  3DXE A;  1WG7 A;  4EJN A;  1EVH A;  1UNQ A;  4HAT B;  1X86 A;  4GMX B;  5FI0 A;  2D9X A;  4IAP A;  2DTC A;  3BJI A;  4GN1 A;  1V5M A;  2Y8F A;  4CHJ A;  3ML4 A;  1AWE A;  4CYE A;  2YRY A;  2MKR A;  4F7U P;  2DKQ A;  2K00 A;  3UZT A;  3F0W A;  2DN6 A;  3AJ4 A;  2NMB A;  3GYP A;  4ZRK A;  1DRO A;  1X1F A;  3QIJ A;  1V89 A;  1TJ6 A;  1XR0 B;  4YON A;  5J3Q A;  5C5B A;  2DHJ A;  2CY5 A;  1WGQ A;  3FM8 C;  5L81 A;  5D3Y A;  2UVM A;  1M7E A;  2ROZ B;  3P7Z A;  1H10 A;  5HE0 A;  4ZRJ A;  3HK0 A;  2UZR A;  2COF A;  4K81 A;  1RRP B;  2GCJ A;  2CRF A;  5HE2 A;  2RSG A;  3D8F A;  2K2J A;  4IOY X;  2DX5 A;  2XQN M;  2DX1 A;  3TFM A;  2KUP A;  1EAZ A;  2YT0 A;  1J19 A;  2K2U A;  2MDX A;  3DXC A;  3CXB B;  4KAX B;  5D3V A;  4Z2N A;  5D3W A;  4EMO A;  3SUZ A;  2EMT A;  4HAW B;  2NZ8 B;  2Z0O A;  2DHK A;  2P0D A;  2YF0 A;  5JHG A;  1PFJ A;  2BCJ A;  4PNK A;  2IYB A;  3PSC A;  2CAY A;  1X1G A;  2P0F A;  3TVV A;  2HTH B;  2AL6 A;  3SO6 A;  4F7G A;  3A8P A;  4A6F A;  1PMS A;  2M38 A;  3SV1 A;  4CHM A;  3MDB C;  2R09 A;  5KQ4 A;  3N7C A;  2Y7B A;  1Y19 B;  3ODW A;  5FI1 A;  3HW2 B;  1DYN A;  4DX8 A;  4HB4 B;  2DHI A;  4DXA B;  1OQN A;  4HHV A;  3MPX A;  2J0J A;  4HB3 B;  1DDV A;  4HAV B;  3BIN A;  2L1C A;  1AQC A;  1H4R A;  3FEH A;  4HDQ A;  2RGN B;  2D10 A;  4YL8 A;  3LJU X;  2YS1 A;  2I1K A;  1UNR A;  2X18 A;  4P7I A;  2DFK A;  1FGY A;  4HDO A;  4ZRI A;  2ADZ A;  2P8V A;  4C0A A;  2W2W A;  1U5D A;  2DLW A;  3KZ1 A;  2VRW B;  3ODX A;  4Z2M B;  3PZD A;  2H7D A;  4EKU A;  2ROV A;  1W1H A;  2YS5 A;  3D8E A;  4PQ0 A;  1Z87 A;  1UPQ A;  1MIX A;  4GXB A;  2FJL A;  2YVC A;  2W2X D;  3OAN A;  3A98 B;  5CLL B;  3PVW A;  3KY9 A;  2IFS A;  2GJY A;  1WJM A;  2JP2 A;  2Z0Q A;  5JHH A;  2ELB A;  2J59 M;  1QC6 A;  2LOZ A;  1V5P A;  3ULB A;  1MK9 B;  2RNR B;  3VIA A;  1PLS A;  4XWX A;  4MY6 A;  5CLQ B;  2D9V A;  3V5W A;  2VKI A;  2Z0P A;  2GS0 A;  2L2I A;  5J3T A;  1B55 A;  1NU2 A;  2AEH A;  1KI1 B;  4HAZ B;  5HE3 A;  1LW3 A;  4NY0 A;  2EJ8 A;  1WJ1 A;  1MAI A;  2RVB B;  2RUK B;  2MWN B;  4HAX B;  5DIF B;  1XCG A;  3PG7 A;  2Q13 A;  4MT7 A;  2V76 A;  1FHO A;  1FOE A;  1LB1 A;  1V61 A;  2DA0 A;  2W2X C;  2YSZ A;  3D8D A;  4KHB B;  5J3Y A;  4B6H A;  1RJ2 A;  4K2P A;  3SNH A;  2N23 A;  3X23 A;  5HE1 A;  2QKM A;  2M14 A;  2LYD A;  3VOQ A;  4WSF A;  2ZPY A;  5JP4 A;  2G35 A;  3GYO A;  3WYF B;  2EMS A;  1SGH A;  2D11 A;  2KGX B;  2QKL A;  1X11 A;  1OY2 A;  3A8Q A;  4DBB A;  3PEG A;  1Y5O A;  5DH9 B;  5DI9 B;  3DXD A;  4WVF B;  2OQB A;  2LKO A;  3RCP A;  3ULC A;  3PP2 A;  1W1G A;  2D9W A;  2I1J A;  4HAU B;  2YS3 A;  2D9Y A;  1BWN A;  2D9Z A;  3FSS A;  2EC1 A;  2N0Y A;  2DYQ A;  1GC6 A;  3QWM A;  4DX9 0;  1EGX A;  2PZ1 A;  1KZ7 A;  5D27 A;  1DDM A;  2YT1 A;  1U27 A;  1QQG A;  3G9W A;  2COD A;  1TQZ A;  1OMW A;  3HQC A;  1E5W A;  5DHA B;  2GCL A;  4MK0 A;  4BBK A;  4IFS A;  5KQ1 A;  1ZSQ A;  2LUL A;  4D0N B;  1GC7 A;  1P6S A;  4NSW A;  4K2O A;  3PVU A;  1UEF A;  5GOW B;  4KVG B;  2DYN A;  2VSZ A;  3PVL A;  5C79 A;  4HB0 B;  2COC A;  1M7R A;  1UPR A;  1IRS A;  1SHC A;  3CIK A;  3T06 A;  1N3H A;  1U29 A;  1FGZ A;  1MKE A;  1V88 A;  1ISN A;  1TXD A;  5LOP B;  3P6A A;  3U8Z A;  1K5D B;  1NTV A;  1ZC4 B;  2ELA A;  2OTX A;  3SYX A;  3AU4 A;  2R0D A;  1BTN A;  4Y94 A;  1GG3 A;  1UNP A;  1FB8 A;  5C16 A;  4HAY B;  1ZM0 A;  1MIZ B;  5C6R A;  5KCV A;  5DHF B;  3NSU A;  3ZVR A;  1U5G A;  4WJ7 A;  1DDW A;  1FHW A;  3WA0 A;  3AU5 A;  4KHO A;  1NI2 A;  3KRW A;  1FHX A;  4A5K A;  3KSY A;  5LON B;  3TO1 A;  2MFQ A;  2HE7 A;  4TYZ A;  2UZS A;  1K5G B;  3KRX A;  1XD4 A;  4K17 A;  3F5R A;  1EF1 A;  1KZG A;  1BAK A;  4F7H A;  1V5U A;  1MPH A;  4L6E A;  1ZVR A;  4GPT B;  3U7D A;  2H7E A;  1WVH A;  1ZC3 B;  3TCA A;  1U5F A;  3ODO A;  1WGU A;  1U5E A;  2J0M A;  1WI1 A;  2J0K A;  2Y8G A;  1XX0 A;  3M1I B;  1P3R A;  1XOD A;  4HB2 B;  1U2B A;  3O96 A;  3TW1 A;  1MK7 B;  3QBV B;  2DKP A;  1XKE A;  4KHA A;  2CY4 A;  5JLJ B;  1W1D A;  3IVF A;  4GZU A;  1I7A A;  1FAO A;  5C5B B;  1P5T A;  2D2Q A;  2D4Q A;  4A6H A;  2I5C A;  1X05 A;  5D3X A;  1Q67 A;  3ZDT A;  2P0H A;  5EFX A;  4A6K A;  1J0W A;  1BTK A;  1I2H A;  2COA A;  4H8S A; 
#chains in the Genus database with same CATH topology
 4TKN A;  4A6F B;  2KCJ A;  2LOX A;  2I5F A;  1NTY A;  2E2X A;  2RLO A;  1DBH A;  4GMV A;  2LG1 A;  3DXE A;  1WG7 A;  4EJN A;  1EVH A;  1UNQ A;  3B77 A;  4HAT B;  1X86 A;  2KR0 A;  4GMX B;  5FI0 A;  2D9X A;  4IAP A;  2DTC A;  3BJI A;  4GN1 A;  1V5M A;  2Y8F A;  4CHJ A;  3ML4 A;  1AWE A;  4CYE A;  2YRY A;  2MKR A;  4F7U P;  2DKQ A;  2K00 A;  3UZT A;  3F0W A;  2DN6 A;  3AJ4 A;  2NMB A;  3GYP A;  4ZRK A;  1DRO A;  1X1F A;  3QIJ A;  1V89 A;  1TJ6 A;  1XR0 B;  4YON A;  5J3Q A;  3NW8 A;  5C5B A;  2DHJ A;  4QJ3 B;  2CY5 A;  1WGQ A;  3FM8 C;  5L81 A;  5D3Y A;  2UVM A;  1M7E A;  2ROZ B;  3P7Z A;  1H10 A;  5HE0 A;  4ZRJ A;  3HK0 A;  2UZR A;  2COF A;  4K81 A;  1RRP B;  2GCJ A;  2CRF A;  5HE2 A;  2RSG A;  3D8F A;  2K2J A;  4IOY X;  2DX5 A;  2FJU B;  2XQN M;  2DX1 A;  3TFM A;  2KUP A;  1EAZ A;  2YT0 A;  5I2M A;  1J19 A;  2K2U A;  2MDX A;  3DXC A;  3CXB B;  4KAX B;  5D3V A;  3U12 A;  4Z2N A;  5D3W A;  4EMO A;  3SUZ A;  2EMT A;  4HAW B;  2NZ8 B;  2Z0O A;  2DHK A;  2P0D A;  2YF0 A;  5JHG A;  1PFJ A;  2BCJ A;  4PNK A;  2IYB A;  2K49 A;  3PSC A;  3FVC A;  2CAY A;  1X1G A;  2P0F A;  3TVV A;  2KIE A;  2HTH B;  2AL6 A;  3SO6 A;  4F7G A;  3A8P A;  4A6F A;  1PMS A;  2M38 A;  3SV1 A;  2KUQ A;  4CHM A;  3MDB C;  2R09 A;  5KQ4 A;  3N7C A;  2Y7B A;  1Y19 B;  3ODW A;  5FI1 A;  3HW2 B;  1DYN A;  4L1R A;  4DX8 A;  4HB4 B;  2DHI A;  4DXA B;  1OQN A;  4HHV A;  3MPX A;  2J0J A;  4HB3 B;  1DDV A;  4HAV B;  4QXA B;  3BIN A;  2L1C A;  1AQC A;  1H4R A;  3FEH A;  4HDQ A;  2RGN B;  2D10 A;  2YT2 A;  4YL8 A;  3LJU X;  4DIX A;  2YS1 A;  2I1K A;  1UNR A;  2X18 A;  4P7I A;  2DFK A;  5LG4 B;  2Z13 A;  1FGY A;  4HDO A;  4ZRI A;  1ZYI A;  2ADZ A;  2P8V A;  4C0A A;  2W2W A;  1U5D A;  2DLW A;  3KZ1 A;  2VRW B;  3ODX A;  4Z2M B;  3PZD A;  2H7D A;  4EKU A;  2ROV A;  1W1H A;  2YS5 A;  3D8E A;  4PQ0 A;  1Z87 A;  1UPQ A;  1MIX A;  4GXB A;  2FJL A;  2YVC A;  2W2X D;  3OAN A;  3A98 B;  5CLL B;  3PVW A;  3KY9 A;  2IFS A;  2GJY A;  1WJM A;  2JP2 A;  2Z0Q A;  5JHH A;  2ELB A;  2J59 M;  1QC6 A;  2LOZ A;  1V5P A;  3ULB A;  1MK9 B;  2RNR B;  3VIA A;  1PLS A;  4XWX A;  4MY6 A;  5CLQ B;  2D9V A;  3NWA A;  3V5W A;  2VKI A;  2Z0P A;  2GS0 A;  2L2I A;  5J3T A;  1B55 A;  1NU2 A;  2AEH A;  1KI1 B;  4HAZ B;  5HE3 A;  1LW3 A;  4NY0 A;  5I2S A;  2EJ8 A;  1WJ1 A;  1MAI A;  2RVB B;  2RUK B;  2MWN B;  4HAX B;  5DIF B;  4HSI A;  1XCG A;  3PG7 A;  2Q13 A;  4MT7 A;  2V76 A;  1FHO A;  1FOE A;  1LB1 A;  1V61 A;  2ZKM X;  2DA0 A;  2W2X C;  4CSQ A;  2YSZ A;  3D8D A;  4KHB B;  5J3Y A;  4B6H A;  1RJ2 A;  4K2P A;  3SNH A;  2KIG A;  2N23 A;  4OT1 A;  3X23 A;  5HE1 A;  2QKM A;  2M14 A;  2LYD A;  3VOQ A;  4WSF A;  2ZPY A;  5JP4 A;  2G35 A;  3GYO A;  3WYF B;  2EMS A;  1SGH A;  2D11 A;  2KGX B;  2QKL A;  1X11 A;  1OY2 A;  3A8Q A;  4DBB A;  2R2Y A;  3PEG A;  1Y5O A;  5DH9 B;  5DI9 B;  3DXD A;  4WVF B;  1T77 A;  2OQB A;  2LKO A;  3RCP A;  3ULC A;  3PP2 A;  1W1G A;  2D9W A;  2I1J A;  4HAU B;  2YS3 A;  2D9Y A;  1BWN A;  2D9Z A;  3FSS A;  2EC1 A;  2N0Y A;  2RRF A;  2DYQ A;  1GC6 A;  3QWM A;  4DX9 0;  1EGX A;  1MI1 A;  2PZ1 A;  1KZ7 A;  3NWD A;  5D27 A;  1DDM A;  2YT1 A;  1U27 A;  1QQG A;  3G9W A;  2COD A;  3A58 A;  1TQZ A;  1OMW A;  3HQC A;  1E5W A;  5DHA B;  2GCL A;  3OHM B;  4MK0 A;  4BBK A;  4IFS A;  5KQ1 A;  1ZSQ A;  5IRS A;  2LUL A;  4D0N B;  2K8E A;  1GC7 A;  1P6S A;  4NSW A;  2GUM A;  4K2O A;  3PVU A;  1UEF A;  4KHB A;  5GOW B;  4KVG B;  2DYN A;  2VSZ A;  3PVL A;  5C79 A;  4HB0 B;  2COC A;  1M7R A;  1UPR A;  1IRS A;  1SHC A;  3CIK A;  3T06 A;  1N3H A;  2Z59 A;  1U29 A;  1FGZ A;  4GOU A;  1MKE A;  1V88 A;  4QJ5 B;  1ISN A;  1TXD A;  5LOP B;  3P6A A;  3U8Z A;  1K5D B;  1NTV A;  1ZC4 B;  2ELA A;  2OTX A;  3SYX A;  3AU4 A;  2R0D A;  1BTN A;  4Y94 A;  1GG3 A;  1UNP A;  1FB8 A;  2Z14 A;  3HIE A;  5C16 A;  4HAY B;  1ZM0 A;  1MIZ B;  5C6R A;  5KCV A;  5DHF B;  3NSU A;  3ZVR A;  1U5G A;  4WJ7 A;  4QJ4 B;  1DDW A;  1FHW A;  3WA0 A;  3AU5 A;  4KHO A;  1NI2 A;  3KRW A;  1FHX A;  4A5K A;  3KSY A;  5LON B;  3TO1 A;  2Z4D A;  3NWF A;  2MFQ A;  2HE7 A;  4TYZ A;  2UZS A;  1K5G B;  3KRX A;  1XD4 A;  4K17 A;  3F5R A;  1EF1 A;  1KZG A;  5M4Y B;  1BAK A;  4F7H A;  1V5U A;  1MPH A;  4L6E A;  1ZVR A;  4GPT B;  3U7D A;  2H7E A;  1WVH A;  1ZC3 B;  3TCA A;  1U5F A;  3ODO A;  1WGU A;  1U5E A;  2J0M A;  3DCX A;  1WI1 A;  2J0K A;  2Y8G A;  1XX0 A;  3M1I B;  1P3R A;  1XOD A;  4HB2 B;  1U2B A;  3O96 A;  3TW1 A;  1MK7 B;  3QBV B;  2DKP A;  1XKE A;  4KHA A;  2CY4 A;  5JLJ B;  1W1D A;  4OSN A;  3IVF A;  4GZU A;  1I7A A;  1FAO A;  2NBV A;  5C5B B;  1P5T A;  2D2Q A;  4D6W A;  2D4Q A;  3HSA A;  4A6H A;  2I5C A;  4GNK B;  1X05 A;  5D3X A;  1Q67 A;  3ZDT A;  2P0H A;  5EFX A;  4A6K A;  1J0W A;  1BTK A;  1I2H A;  2COA A;  4H8S A; 
#chains in the Genus database with same CATH homology
 4TKN A;  4A6F B;  2KCJ A;  2LOX A;  2I5F A;  1NTY A;  2E2X A;  2RLO A;  1DBH A;  4GMV A;  2LG1 A;  3DXE A;  1WG7 A;  4EJN A;  1EVH A;  1UNQ A;  4HAT B;  1X86 A;  4GMX B;  5FI0 A;  2D9X A;  4IAP A;  2DTC A;  3BJI A;  4GN1 A;  1V5M A;  2Y8F A;  4CHJ A;  3ML4 A;  1AWE A;  4CYE A;  2YRY A;  2MKR A;  4F7U P;  2DKQ A;  2K00 A;  3UZT A;  3F0W A;  2DN6 A;  3AJ4 A;  2NMB A;  3GYP A;  4ZRK A;  1DRO A;  1X1F A;  3QIJ A;  1V89 A;  1TJ6 A;  1XR0 B;  4YON A;  5J3Q A;  5C5B A;  2DHJ A;  2CY5 A;  1WGQ A;  3FM8 C;  5L81 A;  5D3Y A;  2UVM A;  1M7E A;  2ROZ B;  3P7Z A;  1H10 A;  5HE0 A;  4ZRJ A;  3HK0 A;  2UZR A;  2COF A;  4K81 A;  1RRP B;  2GCJ A;  2CRF A;  5HE2 A;  2RSG A;  3D8F A;  2K2J A;  4IOY X;  2DX5 A;  2XQN M;  2DX1 A;  3TFM A;  2KUP A;  1EAZ A;  2YT0 A;  1J19 A;  2K2U A;  2MDX A;  3DXC A;  3CXB B;  4KAX B;  5D3V A;  4Z2N A;  5D3W A;  4EMO A;  3SUZ A;  2EMT A;  4HAW B;  2NZ8 B;  2Z0O A;  2DHK A;  2P0D A;  2YF0 A;  5JHG A;  1PFJ A;  2BCJ A;  4PNK A;  2IYB A;  3PSC A;  2CAY A;  1X1G A;  2P0F A;  3TVV A;  2HTH B;  2AL6 A;  3SO6 A;  4F7G A;  3A8P A;  4A6F A;  1PMS A;  2M38 A;  3SV1 A;  4CHM A;  3MDB C;  2R09 A;  5KQ4 A;  3N7C A;  2Y7B A;  1Y19 B;  3ODW A;  5FI1 A;  3HW2 B;  1DYN A;  4DX8 A;  4HB4 B;  2DHI A;  4DXA B;  1OQN A;  4HHV A;  3MPX A;  2J0J A;  4HB3 B;  1DDV A;  4HAV B;  3BIN A;  2L1C A;  1AQC A;  1H4R A;  3FEH A;  4HDQ A;  2RGN B;  2D10 A;  4YL8 A;  3LJU X;  2YS1 A;  2I1K A;  1UNR A;  2X18 A;  4P7I A;  2DFK A;  1FGY A;  4HDO A;  4ZRI A;  2ADZ A;  2P8V A;  4C0A A;  2W2W A;  1U5D A;  2DLW A;  3KZ1 A;  2VRW B;  3ODX A;  4Z2M B;  3PZD A;  2H7D A;  4EKU A;  2ROV A;  1W1H A;  2YS5 A;  3D8E A;  4PQ0 A;  1Z87 A;  1UPQ A;  1MIX A;  4GXB A;  2FJL A;  2YVC A;  2W2X D;  3OAN A;  3A98 B;  5CLL B;  3PVW A;  3KY9 A;  2IFS A;  2GJY A;  1WJM A;  2JP2 A;  2Z0Q A;  5JHH A;  2ELB A;  2J59 M;  1QC6 A;  2LOZ A;  1V5P A;  3ULB A;  1MK9 B;  2RNR B;  3VIA A;  1PLS A;  4XWX A;  4MY6 A;  5CLQ B;  2D9V A;  3V5W A;  2VKI A;  2Z0P A;  2GS0 A;  2L2I A;  5J3T A;  1B55 A;  1NU2 A;  2AEH A;  1KI1 B;  4HAZ B;  5HE3 A;  1LW3 A;  4NY0 A;  2EJ8 A;  1WJ1 A;  1MAI A;  2RVB B;  2RUK B;  2MWN B;  4HAX B;  5DIF B;  1XCG A;  3PG7 A;  2Q13 A;  4MT7 A;  2V76 A;  1FHO A;  1FOE A;  1LB1 A;  1V61 A;  2DA0 A;  2W2X C;  2YSZ A;  3D8D A;  4KHB B;  5J3Y A;  4B6H A;  1RJ2 A;  4K2P A;  3SNH A;  2N23 A;  3X23 A;  5HE1 A;  2QKM A;  2M14 A;  2LYD A;  3VOQ A;  4WSF A;  2ZPY A;  5JP4 A;  2G35 A;  3GYO A;  3WYF B;  2EMS A;  1SGH A;  2D11 A;  2KGX B;  2QKL A;  1X11 A;  1OY2 A;  3A8Q A;  4DBB A;  3PEG A;  1Y5O A;  5DH9 B;  5DI9 B;  3DXD A;  4WVF B;  2OQB A;  2LKO A;  3RCP A;  3ULC A;  3PP2 A;  1W1G A;  2D9W A;  2I1J A;  4HAU B;  2YS3 A;  2D9Y A;  1BWN A;  2D9Z A;  3FSS A;  2EC1 A;  2N0Y A;  2DYQ A;  1GC6 A;  3QWM A;  4DX9 0;  1EGX A;  2PZ1 A;  1KZ7 A;  5D27 A;  1DDM A;  2YT1 A;  1U27 A;  1QQG A;  3G9W A;  2COD A;  1TQZ A;  1OMW A;  3HQC A;  1E5W A;  5DHA B;  2GCL A;  4MK0 A;  4BBK A;  4IFS A;  5KQ1 A;  1ZSQ A;  2LUL A;  4D0N B;  1GC7 A;  1P6S A;  4NSW A;  4K2O A;  3PVU A;  1UEF A;  5GOW B;  4KVG B;  2DYN A;  2VSZ A;  3PVL A;  5C79 A;  4HB0 B;  2COC A;  1M7R A;  1UPR A;  1IRS A;  1SHC A;  3CIK A;  3T06 A;  1N3H A;  1U29 A;  1FGZ A;  1MKE A;  1V88 A;  1ISN A;  1TXD A;  5LOP B;  3P6A A;  3U8Z A;  1K5D B;  1NTV A;  1ZC4 B;  2ELA A;  2OTX A;  3SYX A;  3AU4 A;  2R0D A;  1BTN A;  4Y94 A;  1GG3 A;  1UNP A;  1FB8 A;  5C16 A;  4HAY B;  1ZM0 A;  1MIZ B;  5C6R A;  5KCV A;  5DHF B;  3NSU A;  3ZVR A;  1U5G A;  4WJ7 A;  1DDW A;  1FHW A;  3WA0 A;  3AU5 A;  4KHO A;  1NI2 A;  3KRW A;  1FHX A;  4A5K A;  3KSY A;  5LON B;  3TO1 A;  2MFQ A;  2HE7 A;  4TYZ A;  2UZS A;  1K5G B;  3KRX A;  1XD4 A;  4K17 A;  3F5R A;  1EF1 A;  1KZG A;  1BAK A;  4F7H A;  1V5U A;  1MPH A;  4L6E A;  1ZVR A;  4GPT B;  3U7D A;  2H7E A;  1WVH A;  1ZC3 B;  3TCA A;  1U5F A;  3ODO A;  1WGU A;  1U5E A;  2J0M A;  1WI1 A;  2J0K A;  2Y8G A;  1XX0 A;  3M1I B;  1P3R A;  1XOD A;  4HB2 B;  1U2B A;  3O96 A;  3TW1 A;  1MK7 B;  3QBV B;  2DKP A;  1XKE A;  4KHA A;  2CY4 A;  5JLJ B;  1W1D A;  3IVF A;  4GZU A;  1I7A A;  1FAO A;  5C5B B;  1P5T A;  2D2Q A;  2D4Q A;  4A6H A;  2I5C A;  1X05 A;  5D3X A;  1Q67 A;  3ZDT A;  2P0H A;  5EFX A;  4A6K A;  1J0W A;  1BTK A;  1I2H A;  2COA A;  4H8S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...