1XODA

Crystal structure of x. tropicalis spred1 evh-1 domain
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
114
structure length
105
Chain Sequence
SYARVRAVVMTRDDSSGGWLQLGGGGLSSVTVSKTEFLVHGERLRDKTVVLECVLRRDLVYNKVTPTFHHWRIGDKKFGLTFQSPADARAFDRGIRRAIEDLSQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Spred1
publication title 1.15A Crystal structure of the X. tropicalis Spred1 EVH1 domain suggests a fourth distinct peptide-binding mechanism within the EVH1 family
pubmed doi rcsb
source organism Xenopus tropicalis
molecule tags Signaling protein
total genus 23
structure length 105
sequence length 114
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00568 WH1 WH1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1xodA00
2D4QA 2YF0A 1I2HA 3GYOA 1NU2A 4A6FA 1U5GA 2Z0QA 1OY2A 5DI9B 5EFXA 2N0YA 3MPXA 2YT0A 4ZRIA 5L81A 2LYDA 3MDBC 2Y8GA 4YL8A 2YS3A 2CODA 2Z0PA 3X23A 3QWMA 1MIXA 1FOEA 2D9XA 1EGXA 2RVBB 4GXBA 3AU5A 2P0HA 2M38A 4WJ7A 2YT1A 2QKLA 4XWXA 5J3TA 2COFA 2LOZA 2X18A 5D3YA 1W1GA 2D10A 5CLQB 2ELBA 2AL6A 2YS1A 4IOYX 3PP2A 4A6KA 4L6EA 1FHXA 3G9WA 3TW1A 2MDXA 2CY5A 3D8EA 4ZRJA 3FSSA 5D27A 2ROVA 1DBHA 4HAWB 3RCPA 4F7GA 1GG3A 2N23A 3HW2B 3DXCA 5JHHA 4GN1A 1XCGA 1NTYA 4YONA 1WJMA 2AEHA 4H8SA 2D2QA 3ULBA 2I1KA 1MPHA 4CYEA 4EKUA 5FI0A 1Z87A 2IFSA 3ODXA 2DTCA 4ZRKA 2E2XA 3U7DA 3LJUX 2NZ8B 5HE2A 2OTXA 3CXBB 5FI1A 1FAOA 4B6HA 2COAA 2D9YA 2J0KA 3PVUA 2J0MA 4HB2B 1MK7B 2I5FA 2CY4A 4Z2NA 4K81A 4KAXB 2GJYA 3D8DA 2KUPA 4IFSA 1KZ7A 2M14A 4HB3B 2YVCA 5DH9B 3ULCA 2EJ8A 4GZUA 4DX8A 5LONB 2Y7BA 1WI1A 1OMWA 1X1FA 4KHOA 3O96A 3PZDA 1U5FA 4K2PA 3PVWA 3FM8C 1E5WA 1TXDA 2RNRB 1WGQA 3PG7A 4GMVA 2EMTA 2ZPYA 1XODA 1WGUA 4K17A 2H7EA 1ZC3B 1LW3A 1MKEA 3TVVA 1U2BA 1V61A 2COCA 3UZTA 1P3RA 3BINA 4HDOA 2RUKB 1IRSA 2DLWA 2QKMA 3DXEA 1Y19B 1PFJA 2DHIA 4MT7A 4DBBA 2I1JA 3NSUA 3TO1A 3KZ1A 1QC6A 1M7EA 1SGHA 2DA0A 2G35A 2YS5A 1DROA 3OANA 2MKRA 4HB0B 1Y5OA 2LOXA 5JHGA 2CRFA 1H10A 3A8PA 1TQZA 4HAZB 4HAVB 2EMSA 3PEGA 5HE1A 2UVMA 1KZGA 1V88A 4TYZA 2D11A 4Z2MB 3F5RA 3AJ4A 1NTVA 1ZSQA 2DN6A 4CHJA 3F0WA 3VOQA 1BWNA 2DYNA 2BCJA 2D9ZA 1MK9B 3SYXA 2I5CA 1V5UA 2CAYA 3SNHA 3WA0A 1B55A 1XD4A 3PSCA 4HDQA 3GYPA 4NSWA 3N7CA 3KSYA 4IAPA 1M7RA 3TFMA 4HAXB 5J3QA 2J0JA 5DHFB 3HK0A 4D0NB 3QIJA 1EVHA 1K5GB 4F7HA 1NI2A 3PVLA 4Y94A 2MFQA 3V5WA 2KGXB 5LOPB 2EC1A 3WYFB 1ZM0A 3P6AA 2VKIA 4EJNA 2JP2A 1J0WA 4TKNA 3KY9A 2IYBA 2YRYA 1XR0B 3AU4A 2LKOA 2YSZA 4GPTB 2DFKA 2P0FA 2Q13A 3A98B 5J3YA 2H7DA 1WJ1A 5KCVA 2DYQA 1FHWA 5CLLB 2ROZB 1SHCA 2P0DA 4KHAA 4MY6A 2R09A 1P5TA 1UNQA 1FB8A 1ISNA 4K2OA 3T06A 4HATB 5KQ1A 3QBVB 2RGNB 5KQ4A 2FJLA 2UZRA 4WVFB 1AWEA 2W2XD 1PLSA 2W2XC 4WSFA 5D3WA 2PZ1A 2GCLA 4HAYB 1MIZB 1BAKA 1V5PA 2DHKA 3ML4A 1X86A 2MWNB 1K5DB 5C16A 1I7AA 2D9VA 2HTHB 2K2JA 4DXAB 3SO6A 2VRWB 2Z0OA 2J59M 5D3XA 2HE7A 4F7UP 3KRXA 2DX1A 1U5EA 2UZSA 2ADZA 2DX5A 2GCJA 4HB4B 4PQ0A 1GC6A 2XQNM 1EF1A 5C79A 2P8VA 4CHMA 4KHBB 1XKEA 1UEFA 1V5MA 4HAUB 2W2WA 2OQBA 5DHAB 4EMOA 4KVGB 3IVFA 2LULA 2V76A 1QQGA 2K00A 3VIAA 4DX90 5JLJB 3CIKA 1V89A 1DDVA 3BJIA 2L1CA 1U29A 1EAZA 3ODOA 5D3VA 2K2UA 1H4RA 3SUZA 1TJ6A 5HE0A 4P7IA 4C0AA 1MAIA 1BTKA 1FGZA 5C5BB 1AQCA 2RSGA 3ODWA 3ZVRA 1OQNA 1PMSA 4PNKA 2NMBA 4A6FB 2VSZA 1ZVRA 5GOWB 1XX0A 2R0DA 1KI1B 3TCAA 4HHVA 1W1DA 3U8ZA 1GC7A 1LB1A 2ELAA 2LG1A 2DKQA 1ZC4B 5DIFB 5JP4A 3HQCA 4NY0A 3P7ZA 3KRWA 1X11A 1N3HA 1WG7A 1DYNA 1FHOA 1UPRA 2KCJA 4A6HA 1U27A 1RJ2A 1X1GA 3D8FA 2DHJA 3DXDA 1J19A 1DDWA 1FGYA 3A8QA 4MK0A 1BTNA 1X05A 1WVHA 2D9WA 1RRPB 3M1IB 1UPQA 1UNPA 3SV1A 2DKPA 4GMXB 1UNRA 1Q67A 1W1HA 2RLOA 3ZDTA 5C6RA 4BBKA 1P6SA 3FEHA 2L2IA 5C5BA 4A5KA 1U5DA 1DDMA 2Y8FA 2GS0A 5HE3A
chains in the Genus database with same CATH superfamily
2D4QA 2YF0A 4GOUA 1I2HA 3GYOA 1NU2A 4A6FA 2K49A 1U5GA 2Z0QA 1OY2A 5DI9B 5EFXA 2N0YA 3MPXA 2YT0A 4ZRIA 5L81A 2LYDA 3MDBC 2Y8GA 4YL8A 2YS3A 2CODA 3FVCA 2Z0PA 3X23A 3QWMA 1MIXA 1FOEA 2D9XA 1EGXA 2RVBB 4GXBA 3AU5A 2P0HA 2Z14A 2M38A 4WJ7A 2YT1A 2QKLA 4XWXA 5J3TA 2COFA 2LOZA 2X18A 5D3YA 1W1GA 2D10A 5CLQB 5LG4B 2ELBA 2AL6A 2YS1A 4IOYX 3PP2A 4A6KA 4L6EA 1FHXA 3G9WA 3TW1A 5IRSA 2MDXA 2CY5A 3D8EA 4ZRJA 3FSSA 5D27A 2ROVA 1DBHA 4HAWB 3RCPA 4F7GA 1GG3A 2N23A 3HW2B 4QJ4B 3DXCA 5JHHA 4GN1A 1XCGA 1NTYA 4YONA 1WJMA 2RRFA 2KUQA 2AEHA 1ZYIA 4H8SA 2D2QA 3ULBA 2I1KA 1MPHA 4CYEA 3DCXA 4EKUA 5FI0A 1Z87A 2IFSA 3ODXA 2DTCA 4ZRKA 2E2XA 3U7DA 2ZKMX 3LJUX 2NZ8B 5HE2A 2OTXA 3CXBB 5FI1A 1FAOA 4B6HA 2COAA 2D9YA 2J0KA 3PVUA 2J0MA 2Z4DA 4HB2B 1MK7B 2I5FA 5I2MA 2CY4A 4Z2NA 4K81A 4L1RA 4KAXB 2GJYA 3D8DA 2KUPA 4IFSA 1KZ7A 2M14A 4HB3B 2YVCA 5DH9B 3ULCA 2EJ8A 4GZUA 4DX8A 5LONB 2Y7BA 1WI1A 1OMWA 1X1FA 4KHOA 3O96A 3PZDA 1U5FA 4K2PA 3PVWA 3FM8C 1E5WA 1TXDA 2RNRB 1WGQA 3PG7A 4GMVA 4DIXA 2EMTA 2ZPYA 1XODA 1WGUA 4K17A 2H7EA 1ZC3B 1LW3A 1MKEA 3TVVA 1U2BA 1V61A 2COCA 3UZTA 1P3RA 3BINA 4HDOA 2RUKB 1IRSA 2DLWA 2QKMA 3DXEA 1Y19B 1PFJA 2DHIA 4MT7A 4DBBA 2I1JA 3NSUA 3TO1A 3KZ1A 1QC6A 2Z13A 1M7EA 1SGHA 2DA0A 2G35A 2YS5A 1DROA 3OANA 2MKRA 4HB0B 1Y5OA 2LOXA 5JHGA 2CRFA 1H10A 3A8PA 1TQZA 4HAZB 4HAVB 2EMSA 3HIEA 3PEGA 5HE1A 3NWFA 2UVMA 1KZGA 1V88A 3NWAA 4TYZA 2D11A 4Z2MB 3F5RA 3AJ4A 1NTVA 1ZSQA 2DN6A 4CSQA 4CHJA 3F0WA 3VOQA 1BWNA 2DYNA 2BCJA 2D9ZA 2KIEA 1MK9B 3SYXA 2I5CA 1V5UA 2CAYA 3SNHA 3WA0A 1B55A 1XD4A 3PSCA 4HDQA 3GYPA 4NSWA 3N7CA 2Z59A 3KSYA 4IAPA 1M7RA 3TFMA 4HAXB 5J3QA 2J0JA 5DHFB 3HK0A 4D0NB 3QIJA 1EVHA 1K5GB 4F7HA 1NI2A 3OHMB 3PVLA 4Y94A 2MFQA 3V5WA 2KGXB 5LOPB 2EC1A 3WYFB 1ZM0A 3P6AA 2VKIA 4EJNA 2YT2A 2JP2A 1J0WA 4TKNA 3KY9A 2IYBA 2YRYA 1XR0B 3AU4A 2LKOA 2YSZA 4GPTB 2DFKA 2P0FA 2K8EA 2KR0A 3B77A 2Q13A 3A98B 5J3YA 2H7DA 1WJ1A 5KCVA 2DYQA 1FHWA 5CLLB 2ROZB 1SHCA 5M4YB 2P0DA 4KHAA 4MY6A 2R09A 1P5TA 1UNQA 1FB8A 1ISNA 4OSNA 4K2OA 3T06A 4HATB 5KQ1A 3QBVB 2RGNB 5KQ4A 2FJLA 3NW8A 4D6WA 2UZRA 4WVFB 1AWEA 2W2XD 1PLSA 2W2XC 4OT1A 4WSFA 5D3WA 2PZ1A 2GCLA 4HAYB 1MIZB 2FJUB 1BAKA 1V5PA 2DHKA 3ML4A 1X86A 5I2SA 2MWNB 4HSIA 1K5DB 5C16A 1I7AA 2D9VA 2HTHB 2K2JA 4DXAB 3SO6A 2VRWB 2Z0OA 2J59M 5D3XA 2HE7A 4F7UP 3KRXA 2DX1A 4QXAB 1U5EA 2UZSA 2ADZA 2DX5A 2GCJA 4HB4B 4PQ0A 1GC6A 2XQNM 1EF1A 5C79A 2P8VA 4CHMA 4KHBB 1XKEA 1UEFA 1V5MA 4HAUB 2W2WA 2OQBA 5DHAB 4EMOA 4KVGB 3IVFA 2R2YA 2LULA 2V76A 1QQGA 2K00A 3NWDA 3VIAA 4DX90 5JLJB 3CIKA 1V89A 4QJ5B 1DDVA 3BJIA 2L1CA 1U29A 1EAZA 3ODOA 5D3VA 2K2UA 1H4RA 3SUZA 1TJ6A 5HE0A 4P7IA 1MI1A 4C0AA 1MAIA 1T77A 1BTKA 1FGZA 5C5BB 1AQCA 4GNKB 2GUMA 2RSGA 3ODWA 3ZVRA 1OQNA 1PMSA 3HSAA 4PNKA 2NMBA 4QJ3B 4A6FB 2VSZA 1ZVRA 5GOWB 1XX0A 2R0DA 1KI1B 3TCAA 4HHVA 1W1DA 3U8ZA 1GC7A 1LB1A 2ELAA 2LG1A 2NBVA 2DKQA 1ZC4B 5DIFB 5JP4A 3HQCA 4NY0A 3P7ZA 3KRWA 1X11A 1N3HA 1WG7A 1DYNA 1FHOA 4KHBA 1UPRA 2KCJA 3A58A 4A6HA 1U27A 1RJ2A 1X1GA 3D8FA 2DHJA 3DXDA 1J19A 1DDWA 1FGYA 3A8QA 4MK0A 1BTNA 1X05A 1WVHA 2D9WA 1RRPB 3M1IB 1UPQA 1UNPA 3SV1A 2DKPA 4GMXB 1UNRA 1Q67A 1W1HA 2RLOA 3ZDTA 2KIGA 5C6RA 4BBKA 1P6SA 3FEHA 3U12A 2L2IA 5C5BA 4A5KA 1U5DA 1DDMA 2Y8FA 2GS0A 5HE3A
chains in the Genus database with same CATH topology
2D4QA 2YF0A 1I2HA 3GYOA 1NU2A 4A6FA 1U5GA 2Z0QA 1OY2A 5DI9B 5EFXA 2N0YA 3MPXA 2YT0A 4ZRIA 5L81A 2LYDA 3MDBC 2Y8GA 4YL8A 2YS3A 2CODA 2Z0PA 3X23A 3QWMA 1MIXA 1FOEA 2D9XA 1EGXA 2RVBB 4GXBA 3AU5A 2P0HA 2M38A 4WJ7A 2YT1A 2QKLA 4XWXA 5J3TA 2COFA 2LOZA 2X18A 5D3YA 1W1GA 2D10A 5CLQB 2ELBA 2AL6A 2YS1A 4IOYX 3PP2A 4A6KA 4L6EA 1FHXA 3G9WA 3TW1A 2MDXA 2CY5A 3D8EA 4ZRJA 3FSSA 5D27A 2ROVA 1DBHA 4HAWB 3RCPA 4F7GA 1GG3A 2N23A 3HW2B 3DXCA 5JHHA 4GN1A 1XCGA 1NTYA 4YONA 1WJMA 2AEHA 4H8SA 2D2QA 3ULBA 2I1KA 1MPHA 4CYEA 4EKUA 5FI0A 1Z87A 2IFSA 3ODXA 2DTCA 4ZRKA 2E2XA 3U7DA 3LJUX 2NZ8B 5HE2A 2OTXA 3CXBB 5FI1A 1FAOA 4B6HA 2COAA 2D9YA 2J0KA 3PVUA 2J0MA 4HB2B 1MK7B 2I5FA 2CY4A 4Z2NA 4K81A 4KAXB 2GJYA 3D8DA 2KUPA 4IFSA 1KZ7A 2M14A 4HB3B 2YVCA 5DH9B 3ULCA 2EJ8A 4GZUA 4DX8A 5LONB 2Y7BA 1WI1A 1OMWA 1X1FA 4KHOA 3O96A 3PZDA 1U5FA 4K2PA 3PVWA 3FM8C 1E5WA 1TXDA 2RNRB 1WGQA 3PG7A 4GMVA 2EMTA 2ZPYA 1XODA 1WGUA 4K17A 2H7EA 1ZC3B 1LW3A 1MKEA 3TVVA 1U2BA 1V61A 2COCA 3UZTA 1P3RA 3BINA 4HDOA 2RUKB 1IRSA 2DLWA 2QKMA 3DXEA 1Y19B 1PFJA 2DHIA 4MT7A 4DBBA 2I1JA 3NSUA 3TO1A 3KZ1A 1QC6A 1M7EA 1SGHA 2DA0A 2G35A 2YS5A 1DROA 3OANA 2MKRA 4HB0B 1Y5OA 2LOXA 5JHGA 2CRFA 1H10A 3A8PA 1TQZA 4HAZB 4HAVB 2EMSA 3PEGA 5HE1A 2UVMA 1KZGA 1V88A 4TYZA 2D11A 4Z2MB 3F5RA 3AJ4A 1NTVA 1ZSQA 2DN6A 4CHJA 3F0WA 3VOQA 1BWNA 2DYNA 2BCJA 2D9ZA 1MK9B 3SYXA 2I5CA 1V5UA 2CAYA 3SNHA 3WA0A 1B55A 1XD4A 3PSCA 4HDQA 3GYPA 4NSWA 3N7CA 3KSYA 4IAPA 1M7RA 3TFMA 4HAXB 5J3QA 2J0JA 5DHFB 3HK0A 4D0NB 3QIJA 1EVHA 1K5GB 4F7HA 1NI2A 3PVLA 4Y94A 2MFQA 3V5WA 2KGXB 5LOPB 2EC1A 3WYFB 1ZM0A 3P6AA 2VKIA 4EJNA 2JP2A 1J0WA 4TKNA 3KY9A 2IYBA 2YRYA 1XR0B 3AU4A 2LKOA 2YSZA 4GPTB 2DFKA 2P0FA 2Q13A 3A98B 5J3YA 2H7DA 1WJ1A 5KCVA 2DYQA 1FHWA 5CLLB 2ROZB 1SHCA 2P0DA 4KHAA 4MY6A 2R09A 1P5TA 1UNQA 1FB8A 1ISNA 4K2OA 3T06A 4HATB 5KQ1A 3QBVB 2RGNB 5KQ4A 2FJLA 2UZRA 4WVFB 1AWEA 2W2XD 1PLSA 2W2XC 4WSFA 5D3WA 2PZ1A 2GCLA 4HAYB 1MIZB 1BAKA 1V5PA 2DHKA 3ML4A 1X86A 2MWNB 1K5DB 5C16A 1I7AA 2D9VA 2HTHB 2K2JA 4DXAB 3SO6A 2VRWB 2Z0OA 2J59M 5D3XA 2HE7A 4F7UP 3KRXA 2DX1A 1U5EA 2UZSA 2ADZA 2DX5A 2GCJA 4HB4B 4PQ0A 1GC6A 2XQNM 1EF1A 5C79A 2P8VA 4CHMA 4KHBB 1XKEA 1UEFA 1V5MA 4HAUB 2W2WA 2OQBA 5DHAB 4EMOA 4KVGB 3IVFA 2LULA 2V76A 1QQGA 2K00A 3VIAA 4DX90 5JLJB 3CIKA 1V89A 1DDVA 3BJIA 2L1CA 1U29A 1EAZA 3ODOA 5D3VA 2K2UA 1H4RA 3SUZA 1TJ6A 5HE0A 4P7IA 4C0AA 1MAIA 1BTKA 1FGZA 5C5BB 1AQCA 2RSGA 3ODWA 3ZVRA 1OQNA 1PMSA 4PNKA 2NMBA 4A6FB 2VSZA 1ZVRA 5GOWB 1XX0A 2R0DA 1KI1B 3TCAA 4HHVA 1W1DA 3U8ZA 1GC7A 1LB1A 2ELAA 2LG1A 2DKQA 1ZC4B 5DIFB 5JP4A 3HQCA 4NY0A 3P7ZA 3KRWA 1X11A 1N3HA 1WG7A 1DYNA 1FHOA 1UPRA 2KCJA 4A6HA 1U27A 1RJ2A 1X1GA 3D8FA 2DHJA 3DXDA 1J19A 1DDWA 1FGYA 3A8QA 4MK0A 1BTNA 1X05A 1WVHA 2D9WA 1RRPB 3M1IB 1UPQA 1UNPA 3SV1A 2DKPA 4GMXB 1UNRA 1Q67A 1W1HA 2RLOA 3ZDTA 5C6RA 4BBKA 1P6SA 3FEHA 2L2IA 5C5BA 4A5KA 1U5DA 1DDMA 2Y8FA 2GS0A 5HE3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D4Q A;  2YF0 A;  1I2H A;  3GYO A;  1NU2 A;  4A6F A;  1U5G A;  2Z0Q A;  1OY2 A;  5DI9 B;  5EFX A;  2N0Y A;  3MPX A;  2YT0 A;  4ZRI A;  5L81 A;  2LYD A;  3MDB C;  2Y8G A;  4YL8 A;  2YS3 A;  2COD A;  2Z0P A;  3X23 A;  3QWM A;  1MIX A;  1FOE A;  2D9X A;  1EGX A;  2RVB B;  4GXB A;  3AU5 A;  2P0H A;  2M38 A;  4WJ7 A;  2YT1 A;  2QKL A;  4XWX A;  5J3T A;  2COF A;  2LOZ A;  2X18 A;  5D3Y A;  1W1G A;  2D10 A;  5CLQ B;  2ELB A;  2AL6 A;  2YS1 A;  4IOY X;  3PP2 A;  4A6K A;  4L6E A;  1FHX A;  3G9W A;  3TW1 A;  2MDX A;  2CY5 A;  3D8E A;  4ZRJ A;  3FSS A;  5D27 A;  2ROV A;  1DBH A;  4HAW B;  3RCP A;  4F7G A;  1GG3 A;  2N23 A;  3HW2 B;  3DXC A;  5JHH A;  4GN1 A;  1XCG A;  1NTY A;  4YON A;  1WJM A;  2AEH A;  4H8S A;  2D2Q A;  3ULB A;  2I1K A;  1MPH A;  4CYE A;  4EKU A;  5FI0 A;  1Z87 A;  2IFS A;  3ODX A;  2DTC A;  4ZRK A;  2E2X A;  3U7D A;  3LJU X;  2NZ8 B;  5HE2 A;  2OTX A;  3CXB B;  5FI1 A;  1FAO A;  4B6H A;  2COA A;  2D9Y A;  2J0K A;  3PVU A;  2J0M A;  4HB2 B;  1MK7 B;  2I5F A;  2CY4 A;  4Z2N A;  4K81 A;  4KAX B;  2GJY A;  3D8D A;  2KUP A;  4IFS A;  1KZ7 A;  2M14 A;  4HB3 B;  2YVC A;  5DH9 B;  3ULC A;  2EJ8 A;  4GZU A;  4DX8 A;  5LON B;  2Y7B A;  1WI1 A;  1OMW A;  1X1F A;  4KHO A;  3O96 A;  3PZD A;  1U5F A;  4K2P A;  3PVW A;  3FM8 C;  1E5W A;  1TXD A;  2RNR B;  1WGQ A;  3PG7 A;  4GMV A;  2EMT A;  2ZPY A;  1XOD A;  1WGU A;  4K17 A;  2H7E A;  1ZC3 B;  1LW3 A;  1MKE A;  3TVV A;  1U2B A;  1V61 A;  2COC A;  3UZT A;  1P3R A;  3BIN A;  4HDO A;  2RUK B;  1IRS A;  2DLW A;  2QKM A;  3DXE A;  1Y19 B;  1PFJ A;  2DHI A;  4MT7 A;  4DBB A;  2I1J A;  3NSU A;  3TO1 A;  3KZ1 A;  1QC6 A;  1M7E A;  1SGH A;  2DA0 A;  2G35 A;  2YS5 A;  1DRO A;  3OAN A;  2MKR A;  4HB0 B;  1Y5O A;  2LOX A;  5JHG A;  2CRF A;  1H10 A;  3A8P A;  1TQZ A;  4HAZ B;  4HAV B;  2EMS A;  3PEG A;  5HE1 A;  2UVM A;  1KZG A;  1V88 A;  4TYZ A;  2D11 A;  4Z2M B;  3F5R A;  3AJ4 A;  1NTV A;  1ZSQ A;  2DN6 A;  4CHJ A;  3F0W A;  3VOQ A;  1BWN A;  2DYN A;  2BCJ A;  2D9Z A;  1MK9 B;  3SYX A;  2I5C A;  1V5U A;  2CAY A;  3SNH A;  3WA0 A;  1B55 A;  1XD4 A;  3PSC A;  4HDQ A;  3GYP A;  4NSW A;  3N7C A;  3KSY A;  4IAP A;  1M7R A;  3TFM A;  4HAX B;  5J3Q A;  2J0J A;  5DHF B;  3HK0 A;  4D0N B;  3QIJ A;  1EVH A;  1K5G B;  4F7H A;  1NI2 A;  3PVL A;  4Y94 A;  2MFQ A;  3V5W A;  2KGX B;  5LOP B;  2EC1 A;  3WYF B;  1ZM0 A;  3P6A A;  2VKI A;  4EJN A;  2JP2 A;  1J0W A;  4TKN A;  3KY9 A;  2IYB A;  2YRY A;  1XR0 B;  3AU4 A;  2LKO A;  2YSZ A;  4GPT B;  2DFK A;  2P0F A;  2Q13 A;  3A98 B;  5J3Y A;  2H7D A;  1WJ1 A;  5KCV A;  2DYQ A;  1FHW A;  5CLL B;  2ROZ B;  1SHC A;  2P0D A;  4KHA A;  4MY6 A;  2R09 A;  1P5T A;  1UNQ A;  1FB8 A;  1ISN A;  4K2O A;  3T06 A;  4HAT B;  5KQ1 A;  3QBV B;  2RGN B;  5KQ4 A;  2FJL A;  2UZR A;  4WVF B;  1AWE A;  2W2X D;  1PLS A;  2W2X C;  4WSF A;  5D3W A;  2PZ1 A;  2GCL A;  4HAY B;  1MIZ B;  1BAK A;  1V5P A;  2DHK A;  3ML4 A;  1X86 A;  2MWN B;  1K5D B;  5C16 A;  1I7A A;  2D9V A;  2HTH B;  2K2J A;  4DXA B;  3SO6 A;  2VRW B;  2Z0O A;  2J59 M;  5D3X A;  2HE7 A;  4F7U P;  3KRX A;  2DX1 A;  1U5E A;  2UZS A;  2ADZ A;  2DX5 A;  2GCJ A;  4HB4 B;  4PQ0 A;  1GC6 A;  2XQN M;  1EF1 A;  5C79 A;  2P8V A;  4CHM A;  4KHB B;  1XKE A;  1UEF A;  1V5M A;  4HAU B;  2W2W A;  2OQB A;  5DHA B;  4EMO A;  4KVG B;  3IVF A;  2LUL A;  2V76 A;  1QQG A;  2K00 A;  3VIA A;  4DX9 0;  5JLJ B;  3CIK A;  1V89 A;  1DDV A;  3BJI A;  2L1C A;  1U29 A;  1EAZ A;  3ODO A;  5D3V A;  2K2U A;  1H4R A;  3SUZ A;  1TJ6 A;  5HE0 A;  4P7I A;  4C0A A;  1MAI A;  1BTK A;  1FGZ A;  5C5B B;  1AQC A;  2RSG A;  3ODW A;  3ZVR A;  1OQN A;  1PMS A;  4PNK A;  2NMB A;  4A6F B;  2VSZ A;  1ZVR A;  5GOW B;  1XX0 A;  2R0D A;  1KI1 B;  3TCA A;  4HHV A;  1W1D A;  3U8Z A;  1GC7 A;  1LB1 A;  2ELA A;  2LG1 A;  2DKQ A;  1ZC4 B;  5DIF B;  5JP4 A;  3HQC A;  4NY0 A;  3P7Z A;  3KRW A;  1X11 A;  1N3H A;  1WG7 A;  1DYN A;  1FHO A;  1UPR A;  2KCJ A;  4A6H A;  1U27 A;  1RJ2 A;  1X1G A;  3D8F A;  2DHJ A;  3DXD A;  1J19 A;  1DDW A;  1FGY A;  3A8Q A;  4MK0 A;  1BTN A;  1X05 A;  1WVH A;  2D9W A;  1RRP B;  3M1I B;  1UPQ A;  1UNP A;  3SV1 A;  2DKP A;  4GMX B;  1UNR A;  1Q67 A;  1W1H A;  2RLO A;  3ZDT A;  5C6R A;  4BBK A;  1P6S A;  3FEH A;  2L2I A;  5C5B A;  4A5K A;  1U5D A;  1DDM A;  2Y8F A;  2GS0 A;  5HE3 A; 
#chains in the Genus database with same CATH topology
 2D4Q A;  2YF0 A;  4GOU A;  1I2H A;  3GYO A;  1NU2 A;  4A6F A;  2K49 A;  1U5G A;  2Z0Q A;  1OY2 A;  5DI9 B;  5EFX A;  2N0Y A;  3MPX A;  2YT0 A;  4ZRI A;  5L81 A;  2LYD A;  3MDB C;  2Y8G A;  4YL8 A;  2YS3 A;  2COD A;  3FVC A;  2Z0P A;  3X23 A;  3QWM A;  1MIX A;  1FOE A;  2D9X A;  1EGX A;  2RVB B;  4GXB A;  3AU5 A;  2P0H A;  2Z14 A;  2M38 A;  4WJ7 A;  2YT1 A;  2QKL A;  4XWX A;  5J3T A;  2COF A;  2LOZ A;  2X18 A;  5D3Y A;  1W1G A;  2D10 A;  5CLQ B;  5LG4 B;  2ELB A;  2AL6 A;  2YS1 A;  4IOY X;  3PP2 A;  4A6K A;  4L6E A;  1FHX A;  3G9W A;  3TW1 A;  5IRS A;  2MDX A;  2CY5 A;  3D8E A;  4ZRJ A;  3FSS A;  5D27 A;  2ROV A;  1DBH A;  4HAW B;  3RCP A;  4F7G A;  1GG3 A;  2N23 A;  3HW2 B;  4QJ4 B;  3DXC A;  5JHH A;  4GN1 A;  1XCG A;  1NTY A;  4YON A;  1WJM A;  2RRF A;  2KUQ A;  2AEH A;  1ZYI A;  4H8S A;  2D2Q A;  3ULB A;  2I1K A;  1MPH A;  4CYE A;  3DCX A;  4EKU A;  5FI0 A;  1Z87 A;  2IFS A;  3ODX A;  2DTC A;  4ZRK A;  2E2X A;  3U7D A;  2ZKM X;  3LJU X;  2NZ8 B;  5HE2 A;  2OTX A;  3CXB B;  5FI1 A;  1FAO A;  4B6H A;  2COA A;  2D9Y A;  2J0K A;  3PVU A;  2J0M A;  2Z4D A;  4HB2 B;  1MK7 B;  2I5F A;  5I2M A;  2CY4 A;  4Z2N A;  4K81 A;  4L1R A;  4KAX B;  2GJY A;  3D8D A;  2KUP A;  4IFS A;  1KZ7 A;  2M14 A;  4HB3 B;  2YVC A;  5DH9 B;  3ULC A;  2EJ8 A;  4GZU A;  4DX8 A;  5LON B;  2Y7B A;  1WI1 A;  1OMW A;  1X1F A;  4KHO A;  3O96 A;  3PZD A;  1U5F A;  4K2P A;  3PVW A;  3FM8 C;  1E5W A;  1TXD A;  2RNR B;  1WGQ A;  3PG7 A;  4GMV A;  4DIX A;  2EMT A;  2ZPY A;  1XOD A;  1WGU A;  4K17 A;  2H7E A;  1ZC3 B;  1LW3 A;  1MKE A;  3TVV A;  1U2B A;  1V61 A;  2COC A;  3UZT A;  1P3R A;  3BIN A;  4HDO A;  2RUK B;  1IRS A;  2DLW A;  2QKM A;  3DXE A;  1Y19 B;  1PFJ A;  2DHI A;  4MT7 A;  4DBB A;  2I1J A;  3NSU A;  3TO1 A;  3KZ1 A;  1QC6 A;  2Z13 A;  1M7E A;  1SGH A;  2DA0 A;  2G35 A;  2YS5 A;  1DRO A;  3OAN A;  2MKR A;  4HB0 B;  1Y5O A;  2LOX A;  5JHG A;  2CRF A;  1H10 A;  3A8P A;  1TQZ A;  4HAZ B;  4HAV B;  2EMS A;  3HIE A;  3PEG A;  5HE1 A;  3NWF A;  2UVM A;  1KZG A;  1V88 A;  3NWA A;  4TYZ A;  2D11 A;  4Z2M B;  3F5R A;  3AJ4 A;  1NTV A;  1ZSQ A;  2DN6 A;  4CSQ A;  4CHJ A;  3F0W A;  3VOQ A;  1BWN A;  2DYN A;  2BCJ A;  2D9Z A;  2KIE A;  1MK9 B;  3SYX A;  2I5C A;  1V5U A;  2CAY A;  3SNH A;  3WA0 A;  1B55 A;  1XD4 A;  3PSC A;  4HDQ A;  3GYP A;  4NSW A;  3N7C A;  2Z59 A;  3KSY A;  4IAP A;  1M7R A;  3TFM A;  4HAX B;  5J3Q A;  2J0J A;  5DHF B;  3HK0 A;  4D0N B;  3QIJ A;  1EVH A;  1K5G B;  4F7H A;  1NI2 A;  3OHM B;  3PVL A;  4Y94 A;  2MFQ A;  3V5W A;  2KGX B;  5LOP B;  2EC1 A;  3WYF B;  1ZM0 A;  3P6A A;  2VKI A;  4EJN A;  2YT2 A;  2JP2 A;  1J0W A;  4TKN A;  3KY9 A;  2IYB A;  2YRY A;  1XR0 B;  3AU4 A;  2LKO A;  2YSZ A;  4GPT B;  2DFK A;  2P0F A;  2K8E A;  2KR0 A;  3B77 A;  2Q13 A;  3A98 B;  5J3Y A;  2H7D A;  1WJ1 A;  5KCV A;  2DYQ A;  1FHW A;  5CLL B;  2ROZ B;  1SHC A;  5M4Y B;  2P0D A;  4KHA A;  4MY6 A;  2R09 A;  1P5T A;  1UNQ A;  1FB8 A;  1ISN A;  4OSN A;  4K2O A;  3T06 A;  4HAT B;  5KQ1 A;  3QBV B;  2RGN B;  5KQ4 A;  2FJL A;  3NW8 A;  4D6W A;  2UZR A;  4WVF B;  1AWE A;  2W2X D;  1PLS A;  2W2X C;  4OT1 A;  4WSF A;  5D3W A;  2PZ1 A;  2GCL A;  4HAY B;  1MIZ B;  2FJU B;  1BAK A;  1V5P A;  2DHK A;  3ML4 A;  1X86 A;  5I2S A;  2MWN B;  4HSI A;  1K5D B;  5C16 A;  1I7A A;  2D9V A;  2HTH B;  2K2J A;  4DXA B;  3SO6 A;  2VRW B;  2Z0O A;  2J59 M;  5D3X A;  2HE7 A;  4F7U P;  3KRX A;  2DX1 A;  4QXA B;  1U5E A;  2UZS A;  2ADZ A;  2DX5 A;  2GCJ A;  4HB4 B;  4PQ0 A;  1GC6 A;  2XQN M;  1EF1 A;  5C79 A;  2P8V A;  4CHM A;  4KHB B;  1XKE A;  1UEF A;  1V5M A;  4HAU B;  2W2W A;  2OQB A;  5DHA B;  4EMO A;  4KVG B;  3IVF A;  2R2Y A;  2LUL A;  2V76 A;  1QQG A;  2K00 A;  3NWD A;  3VIA A;  4DX9 0;  5JLJ B;  3CIK A;  1V89 A;  4QJ5 B;  1DDV A;  3BJI A;  2L1C A;  1U29 A;  1EAZ A;  3ODO A;  5D3V A;  2K2U A;  1H4R A;  3SUZ A;  1TJ6 A;  5HE0 A;  4P7I A;  1MI1 A;  4C0A A;  1MAI A;  1T77 A;  1BTK A;  1FGZ A;  5C5B B;  1AQC A;  4GNK B;  2GUM A;  2RSG A;  3ODW A;  3ZVR A;  1OQN A;  1PMS A;  3HSA A;  4PNK A;  2NMB A;  4QJ3 B;  4A6F B;  2VSZ A;  1ZVR A;  5GOW B;  1XX0 A;  2R0D A;  1KI1 B;  3TCA A;  4HHV A;  1W1D A;  3U8Z A;  1GC7 A;  1LB1 A;  2ELA A;  2LG1 A;  2NBV A;  2DKQ A;  1ZC4 B;  5DIF B;  5JP4 A;  3HQC A;  4NY0 A;  3P7Z A;  3KRW A;  1X11 A;  1N3H A;  1WG7 A;  1DYN A;  1FHO A;  4KHB A;  1UPR A;  2KCJ A;  3A58 A;  4A6H A;  1U27 A;  1RJ2 A;  1X1G A;  3D8F A;  2DHJ A;  3DXD A;  1J19 A;  1DDW A;  1FGY A;  3A8Q A;  4MK0 A;  1BTN A;  1X05 A;  1WVH A;  2D9W A;  1RRP B;  3M1I B;  1UPQ A;  1UNP A;  3SV1 A;  2DKP A;  4GMX B;  1UNR A;  1Q67 A;  1W1H A;  2RLO A;  3ZDT A;  2KIG A;  5C6R A;  4BBK A;  1P6S A;  3FEH A;  3U12 A;  2L2I A;  5C5B A;  4A5K A;  1U5D A;  1DDM A;  2Y8F A;  2GS0 A;  5HE3 A; 
#chains in the Genus database with same CATH homology
 2D4Q A;  2YF0 A;  1I2H A;  3GYO A;  1NU2 A;  4A6F A;  1U5G A;  2Z0Q A;  1OY2 A;  5DI9 B;  5EFX A;  2N0Y A;  3MPX A;  2YT0 A;  4ZRI A;  5L81 A;  2LYD A;  3MDB C;  2Y8G A;  4YL8 A;  2YS3 A;  2COD A;  2Z0P A;  3X23 A;  3QWM A;  1MIX A;  1FOE A;  2D9X A;  1EGX A;  2RVB B;  4GXB A;  3AU5 A;  2P0H A;  2M38 A;  4WJ7 A;  2YT1 A;  2QKL A;  4XWX A;  5J3T A;  2COF A;  2LOZ A;  2X18 A;  5D3Y A;  1W1G A;  2D10 A;  5CLQ B;  2ELB A;  2AL6 A;  2YS1 A;  4IOY X;  3PP2 A;  4A6K A;  4L6E A;  1FHX A;  3G9W A;  3TW1 A;  2MDX A;  2CY5 A;  3D8E A;  4ZRJ A;  3FSS A;  5D27 A;  2ROV A;  1DBH A;  4HAW B;  3RCP A;  4F7G A;  1GG3 A;  2N23 A;  3HW2 B;  3DXC A;  5JHH A;  4GN1 A;  1XCG A;  1NTY A;  4YON A;  1WJM A;  2AEH A;  4H8S A;  2D2Q A;  3ULB A;  2I1K A;  1MPH A;  4CYE A;  4EKU A;  5FI0 A;  1Z87 A;  2IFS A;  3ODX A;  2DTC A;  4ZRK A;  2E2X A;  3U7D A;  3LJU X;  2NZ8 B;  5HE2 A;  2OTX A;  3CXB B;  5FI1 A;  1FAO A;  4B6H A;  2COA A;  2D9Y A;  2J0K A;  3PVU A;  2J0M A;  4HB2 B;  1MK7 B;  2I5F A;  2CY4 A;  4Z2N A;  4K81 A;  4KAX B;  2GJY A;  3D8D A;  2KUP A;  4IFS A;  1KZ7 A;  2M14 A;  4HB3 B;  2YVC A;  5DH9 B;  3ULC A;  2EJ8 A;  4GZU A;  4DX8 A;  5LON B;  2Y7B A;  1WI1 A;  1OMW A;  1X1F A;  4KHO A;  3O96 A;  3PZD A;  1U5F A;  4K2P A;  3PVW A;  3FM8 C;  1E5W A;  1TXD A;  2RNR B;  1WGQ A;  3PG7 A;  4GMV A;  2EMT A;  2ZPY A;  1XOD A;  1WGU A;  4K17 A;  2H7E A;  1ZC3 B;  1LW3 A;  1MKE A;  3TVV A;  1U2B A;  1V61 A;  2COC A;  3UZT A;  1P3R A;  3BIN A;  4HDO A;  2RUK B;  1IRS A;  2DLW A;  2QKM A;  3DXE A;  1Y19 B;  1PFJ A;  2DHI A;  4MT7 A;  4DBB A;  2I1J A;  3NSU A;  3TO1 A;  3KZ1 A;  1QC6 A;  1M7E A;  1SGH A;  2DA0 A;  2G35 A;  2YS5 A;  1DRO A;  3OAN A;  2MKR A;  4HB0 B;  1Y5O A;  2LOX A;  5JHG A;  2CRF A;  1H10 A;  3A8P A;  1TQZ A;  4HAZ B;  4HAV B;  2EMS A;  3PEG A;  5HE1 A;  2UVM A;  1KZG A;  1V88 A;  4TYZ A;  2D11 A;  4Z2M B;  3F5R A;  3AJ4 A;  1NTV A;  1ZSQ A;  2DN6 A;  4CHJ A;  3F0W A;  3VOQ A;  1BWN A;  2DYN A;  2BCJ A;  2D9Z A;  1MK9 B;  3SYX A;  2I5C A;  1V5U A;  2CAY A;  3SNH A;  3WA0 A;  1B55 A;  1XD4 A;  3PSC A;  4HDQ A;  3GYP A;  4NSW A;  3N7C A;  3KSY A;  4IAP A;  1M7R A;  3TFM A;  4HAX B;  5J3Q A;  2J0J A;  5DHF B;  3HK0 A;  4D0N B;  3QIJ A;  1EVH A;  1K5G B;  4F7H A;  1NI2 A;  3PVL A;  4Y94 A;  2MFQ A;  3V5W A;  2KGX B;  5LOP B;  2EC1 A;  3WYF B;  1ZM0 A;  3P6A A;  2VKI A;  4EJN A;  2JP2 A;  1J0W A;  4TKN A;  3KY9 A;  2IYB A;  2YRY A;  1XR0 B;  3AU4 A;  2LKO A;  2YSZ A;  4GPT B;  2DFK A;  2P0F A;  2Q13 A;  3A98 B;  5J3Y A;  2H7D A;  1WJ1 A;  5KCV A;  2DYQ A;  1FHW A;  5CLL B;  2ROZ B;  1SHC A;  2P0D A;  4KHA A;  4MY6 A;  2R09 A;  1P5T A;  1UNQ A;  1FB8 A;  1ISN A;  4K2O A;  3T06 A;  4HAT B;  5KQ1 A;  3QBV B;  2RGN B;  5KQ4 A;  2FJL A;  2UZR A;  4WVF B;  1AWE A;  2W2X D;  1PLS A;  2W2X C;  4WSF A;  5D3W A;  2PZ1 A;  2GCL A;  4HAY B;  1MIZ B;  1BAK A;  1V5P A;  2DHK A;  3ML4 A;  1X86 A;  2MWN B;  1K5D B;  5C16 A;  1I7A A;  2D9V A;  2HTH B;  2K2J A;  4DXA B;  3SO6 A;  2VRW B;  2Z0O A;  2J59 M;  5D3X A;  2HE7 A;  4F7U P;  3KRX A;  2DX1 A;  1U5E A;  2UZS A;  2ADZ A;  2DX5 A;  2GCJ A;  4HB4 B;  4PQ0 A;  1GC6 A;  2XQN M;  1EF1 A;  5C79 A;  2P8V A;  4CHM A;  4KHB B;  1XKE A;  1UEF A;  1V5M A;  4HAU B;  2W2W A;  2OQB A;  5DHA B;  4EMO A;  4KVG B;  3IVF A;  2LUL A;  2V76 A;  1QQG A;  2K00 A;  3VIA A;  4DX9 0;  5JLJ B;  3CIK A;  1V89 A;  1DDV A;  3BJI A;  2L1C A;  1U29 A;  1EAZ A;  3ODO A;  5D3V A;  2K2U A;  1H4R A;  3SUZ A;  1TJ6 A;  5HE0 A;  4P7I A;  4C0A A;  1MAI A;  1BTK A;  1FGZ A;  5C5B B;  1AQC A;  2RSG A;  3ODW A;  3ZVR A;  1OQN A;  1PMS A;  4PNK A;  2NMB A;  4A6F B;  2VSZ A;  1ZVR A;  5GOW B;  1XX0 A;  2R0D A;  1KI1 B;  3TCA A;  4HHV A;  1W1D A;  3U8Z A;  1GC7 A;  1LB1 A;  2ELA A;  2LG1 A;  2DKQ A;  1ZC4 B;  5DIF B;  5JP4 A;  3HQC A;  4NY0 A;  3P7Z A;  3KRW A;  1X11 A;  1N3H A;  1WG7 A;  1DYN A;  1FHO A;  1UPR A;  2KCJ A;  4A6H A;  1U27 A;  1RJ2 A;  1X1G A;  3D8F A;  2DHJ A;  3DXD A;  1J19 A;  1DDW A;  1FGY A;  3A8Q A;  4MK0 A;  1BTN A;  1X05 A;  1WVH A;  2D9W A;  1RRP B;  3M1I B;  1UPQ A;  1UNP A;  3SV1 A;  2DKP A;  4GMX B;  1UNR A;  1Q67 A;  1W1H A;  2RLO A;  3ZDT A;  5C6R A;  4BBK A;  1P6S A;  3FEH A;  2L2I A;  5C5B A;  4A5K A;  1U5D A;  1DDM A;  2Y8F A;  2GS0 A;  5HE3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...