1Y5OA

Nmr structure of the amino-terminal domain from the tfb1 subunit of yeast tfiih
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
115
structure length
115
Chain Sequence
PSHSGAAIFEKVSGIIAINEDVSPAELTWRSTDGDKVHTVVLSTIDKLQATPASSEKMMLRLIGKVDESKKRKDNEGNEVVPKPQRHMFSFNNRTVMDNIKMTLQQIISRYKDAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA polymerase II transcription factor B 73 kDa subunit
publication title NMR Structure of the Amino-Terminal Domain from the Tfb1 Subunit of TFIIH and Characterization of Its Phosphoinositide and VP16 Binding Sites
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 18
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2004-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08567 PH_TFIIH TFIIH p62 subunit, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1y5oA00
1I7AA 1OMWA 1QQGA 3A8QA 1DDVA 3QIJA 3IVFA 1U29A 1DDMA 4H8SA 1FB8A 1WGUA 1EF1A 5FI1A 4F7GA 2KGXB 2VKIA 1FGYA 3F5RA 3PVUA 3QBVB 5J3TA 2DA0A 2DX1A 4GN1A 3TCAA 1TJ6A 2HTHB 1WG7A 4L6EA 1NU2A 2D10A 1NTYA 4EJNA 4HB0B 2M38A 1U5DA 1MPHA 4HDOA 4KHBB 4A6KA 3PEGA 5JP4A 1UNQA 2AL6A 2N0YA 3A8PA 2LKOA 2D4QA 2LOXA 4HAWB 3ZVRA 4K17A 1RRPB 2DHJA 3MDBC 2YS5A 3HW2B 1P3RA 1MK7B 2W2XD 2AEHA 1DROA 2COFA 1MAIA 2JP2A 4IFSA 2BCJA 1MIXA 2D9XA 5HE0A 4XWXA 2DKPA 1EGXA 5HE2A 4KVGB 3ULBA 1FHWA 1M7EA 1V61A 1X86A 1XR0B 3WYFB 2LOZA 4DBBA 2EMSA 3ODXA 5KQ1A 5DHAB 2D9ZA 1E5WA 1U27A 3CXBB 3GYOA 3HK0A 2OQBA 4DX8A 1ZSQA 1N3HA 2DYQA 2PZ1A 4NY0A 5DIFB 4Z2MB 5HE1A 2CRFA 2IYBA 2I1KA 1BWNA 2DFKA 3SUZA 2IFSA 3ODOA 3F0WA 1WGQA 3VIAA 1OQNA 2K00A 2G35A 1XCGA 2QKMA 2W2WA 1UEFA 1ZVRA 2DN6A 2EJ8A 1LB1A 4F7HA 2DTCA 3LJUX 2COCA 1AQCA 3SNHA 3U8ZA 4D0NB 1DDWA 5HE3A 2V76A 5FI0A 4CHJA 3BINA 1X1GA 4HAZB 4GPTB 4K2PA 1ISNA 4B6HA 3A98B 2CY5A 3TFMA 5JHHA 2ELAA 2D2QA 3PVLA 1Z87A 2CAYA 1P6SA 3FEHA 2GCJA 2J0JA 2D9WA 2P8VA 2P0FA 1H4RA 2K2UA 1J0WA 3WA0A 3KZ1A 1U5FA 1V5UA 2ADZA 1V88A 2YRYA 1MIZB 1WI1A 3ODWA 1RJ2A 1IRSA 1TXDA 5GOWB 3FSSA 3D8FA 2RSGA 2D11A 4IOYX 1XKEA 2ROZB 4MY6A 5CLQB 2YS1A 2Z0PA 2OTXA 2H7EA 3KY9A 3VOQA 2MWNB 2CY4A 1V5PA 2DHIA 2R0DA 1TQZA 1K5GB 4KHOA 2KCJA 4HAXB 3KRXA 5D3WA 2YVCA 1W1HA 2XQNM 4P7IA 3U7DA 2L2IA 4EMOA 2J0MA 3PSCA 3KRWA 3X23A 4A6HA 4KAXB 3PG7A 1DYNA 2Y7BA 1Y19B 2M14A 3TO1A 1WJMA 4YL8A 2LG1A 2LULA 2ELBA 4HHVA 2I1JA 2GS0A 4DXAB 3GYPA 1FHOA 1KI1B 5KQ4A 5KCVA 5D3YA 5JLJB 4PNKA 2J0KA 2EMTA 3PP2A 4TYZA 1LW3A 4WSFA 1SGHA 4GMVA 4GMXB 3G9WA 3D8DA 2E2XA 4A6FB 1I2HA 3OANA 5C6RA 4YONA 2YT0A 1U5EA 2Y8GA 2HE7A 2FJLA 2DYNA 1XODA 1ZC4B 1EVHA 5LOPB 1X1FA 2D9VA 1UPQA 1M7RA 2I5FA 1XD4A 4EKUA 1ZM0A 1QC6A 4Y94A 3PVWA 2YSZA 1MKEA 4ZRJA 5J3QA 1FAOA 3QWMA 3SV1A 2UZRA 4BBKA 1BAKA 2RLOA 2RGNB 4ZRIA 5C5BB 3SO6A 2Y8FA 2QKLA 4GZUA 4HB4B 1NTVA 1MK9B 1PLSA 2YT1A 5L81A 4K2OA 2ZPYA 3AJ4A 1EAZA 2KUPA 4Z2NA 3FM8C 4A5KA 1B55A 1UNRA 1V89A 4ZRKA 4DX90 5LONB 1FGZA 3PZDA 5EFXA 2RNRB 2DHKA 2EC1A 4HATB 3T06A 2DLWA 4MK0A 1Y5OA 2NZ8B 2DKQA 2ROVA 1AWEA 1UNPA 2L1CA 2I5CA 2LYDA 2YS3A 3NSUA 3DXEA 2MKRA 2MFQA 4CHMA 3DXCA 3AU4A 2UVMA 1W1GA 2COAA 2RUKB 1OY2A 3ULCA 3N7CA 4HB3B 2X18A 2K2JA 1P5TA 3D8EA 2YF0A 4NSWA 4A6FA 3TW1A 4GXBA 1DBHA 1Q67A 1U5GA 1U2BA 2J59M 2NMBA 3BJIA 1WVHA 1GG3A 2GCLA 2P0HA 1SHCA 3ML4A 1GC7A 2R09A 5JHGA 3MPXA 3RCPA 4HDQA 1PFJA 2DX5A 1X11A 1H10A 1XX0A 1FOEA 2CODA 3UZTA 1ZC3B 5C5BA 5DHFB 1K5DB 3M1IB 1NI2A 2D9YA 3KSYA 4WJ7A 3TVVA 2Z0QA 3P6AA 4KHAA 3V5WA 2P0DA 3SYXA 5C79A 4PQ0A 5D3XA 5J3YA 3AU5A 2VRWB 2MDXA 5D3VA 5CLLB 4CYEA 1PMSA 2Z0OA 3P7ZA 1KZ7A 1FHXA 3DXDA 1BTNA 4HAUB 4MT7A 1UPRA 4F7UP 1W1DA 4HAVB 5C16A 2N23A 2GJYA 2VSZA 1GC6A 5DH9B 1KZGA 4HB2B 2RVBB 2Q13A 4K81A 5DI9B 4IAPA 1V5MA 1X05A 2H7DA 3CIKA 1J19A 3ZDTA 4TKNA 3HQCA 1WJ1A 4HAYB 3O96A 1BTKA 2UZSA 4WVFB 4C0AA 2W2XC 5D27A
chains in the Genus database with same CATH superfamily
1I7AA 1OMWA 3OHMB 1QQGA 3A8QA 1DDVA 3QIJA 3IVFA 1U29A 1DDMA 4H8SA 1FB8A 4GNKB 4QJ5B 1WGUA 1EF1A 4OT1A 2ZKMX 5I2SA 5FI1A 4F7GA 2KGXB 2VKIA 1FGYA 3F5RA 3PVUA 3QBVB 5J3TA 2DA0A 2DX1A 4GN1A 3TCAA 3U12A 1TJ6A 2HTHB 1WG7A 2FJUB 4L6EA 1NU2A 2D10A 1NTYA 4EJNA 4HB0B 2M38A 1U5DA 1MPHA 4HDOA 4KHBB 4A6KA 3PEGA 5JP4A 1UNQA 2AL6A 2N0YA 3A8PA 2LKOA 2D4QA 2LOXA 4HAWB 3ZVRA 4K17A 1RRPB 2DHJA 1MI1A 3MDBC 2YS5A 3HW2B 1P3RA 3NWAA 1MK7B 2KR0A 2W2XD 2AEHA 3NWDA 1DROA 2Z14A 2COFA 1MAIA 2JP2A 4IFSA 2BCJA 3DCXA 2RRFA 4D6WA 1MIXA 2D9XA 5HE0A 4XWXA 2DKPA 1EGXA 5HE2A 4KVGB 3ULBA 1FHWA 1M7EA 1V61A 1X86A 1XR0B 3WYFB 2LOZA 4DBBA 3B77A 2EMSA 3ODXA 5KQ1A 5DHAB 2D9ZA 1E5WA 1U27A 2Z4DA 2KIGA 3CXBB 3GYOA 3HK0A 4QJ3B 2OQBA 4DX8A 1ZSQA 1N3HA 2DYQA 2PZ1A 4NY0A 5DIFB 4Z2MB 4QJ4B 5HE1A 2CRFA 2IYBA 2I1KA 1BWNA 2DFKA 3SUZA 2IFSA 3ODOA 3F0WA 1WGQA 4KHBA 3VIAA 1OQNA 2K00A 2G35A 1XCGA 2QKMA 2W2WA 1UEFA 1ZVRA 2DN6A 2EJ8A 1LB1A 4F7HA 2DTCA 3LJUX 2COCA 1AQCA 3SNHA 3U8ZA 4D0NB 1DDWA 5HE3A 2V76A 3FVCA 5FI0A 4CHJA 3BINA 1X1GA 4HAZB 4GPTB 4K2PA 1ISNA 4B6HA 3A98B 2CY5A 3TFMA 5JHHA 2ELAA 2D2QA 2KIEA 3PVLA 1Z87A 2CAYA 1P6SA 3FEHA 2GCJA 2J0JA 4QXAB 2D9WA 2P8VA 4HSIA 3NW8A 2P0FA 1H4RA 2K2UA 1J0WA 3WA0A 3KZ1A 1U5FA 1V5UA 2ADZA 1V88A 1ZYIA 2YRYA 1MIZB 1WI1A 3ODWA 1RJ2A 1IRSA 1TXDA 5GOWB 3FSSA 3D8FA 2RSGA 2D11A 4IOYX 1XKEA 2ROZB 4MY6A 5CLQB 2YS1A 2Z0PA 2OTXA 2H7EA 3KY9A 3VOQA 2MWNB 2CY4A 1V5PA 2DHIA 2R0DA 1TQZA 1K5GB 4KHOA 2KCJA 4HAXB 3KRXA 5D3WA 2YVCA 1W1HA 2XQNM 4P7IA 2YT2A 3U7DA 2L2IA 4EMOA 2J0MA 3PSCA 3KRWA 3X23A 4A6HA 4KAXB 3PG7A 1DYNA 2Y7BA 1Y19B 2M14A 3TO1A 1WJMA 4YL8A 2LG1A 2LULA 2ELBA 4HHVA 2I1JA 2GS0A 4DXAB 5I2MA 3GYPA 1FHOA 1KI1B 5KQ4A 5KCVA 5D3YA 5JLJB 3NWFA 4PNKA 2Z13A 2J0KA 2EMTA 3PP2A 4TYZA 1LW3A 4WSFA 1SGHA 4GMVA 4GMXB 3G9WA 3D8DA 2E2XA 4A6FB 1I2HA 3OANA 5C6RA 4CSQA 4YONA 2YT0A 1U5EA 2Y8GA 2HE7A 2FJLA 2DYNA 1XODA 1ZC4B 1EVHA 5LOPB 1X1FA 2D9VA 1UPQA 1M7RA 2I5FA 1XD4A 4EKUA 1ZM0A 1QC6A 4Y94A 3PVWA 2YSZA 1MKEA 4ZRJA 5J3QA 1FAOA 3QWMA 3SV1A 2UZRA 4BBKA 2Z59A 1BAKA 2RLOA 2RGNB 4ZRIA 5C5BB 3SO6A 2Y8FA 2QKLA 4GZUA 4HB4B 1NTVA 1MK9B 1PLSA 2YT1A 2K49A 5L81A 4K2OA 4L1RA 2ZPYA 3AJ4A 1EAZA 2KUPA 4Z2NA 3FM8C 4A5KA 1B55A 1UNRA 1V89A 4ZRKA 4DX90 5LONB 1FGZA 3PZDA 5EFXA 2RNRB 2DHKA 2EC1A 4HATB 3T06A 2DLWA 4MK0A 1Y5OA 2NZ8B 2DKQA 2ROVA 1AWEA 1UNPA 2L1CA 2I5CA 2LYDA 2YS3A 3NSUA 3DXEA 2MKRA 5IRSA 2MFQA 4CHMA 3DXCA 5M4YB 3AU4A 2UVMA 2NBVA 1W1GA 2COAA 2RUKB 1OY2A 3ULCA 3N7CA 4DIXA 1T77A 4HB3B 2X18A 2K2JA 2R2YA 1P5TA 3D8EA 2YF0A 4NSWA 4A6FA 3TW1A 4GXBA 1DBHA 2KUQA 1Q67A 1U5GA 1U2BA 2J59M 2NMBA 3BJIA 1WVHA 1GG3A 2GCLA 2P0HA 1SHCA 2GUMA 3ML4A 1GC7A 2R09A 5JHGA 3MPXA 3RCPA 4HDQA 1PFJA 2DX5A 1X11A 1H10A 1XX0A 1FOEA 2CODA 5LG4B 3UZTA 1ZC3B 5C5BA 4GOUA 5DHFB 1K5DB 3M1IB 1NI2A 2D9YA 3KSYA 4WJ7A 3TVVA 2Z0QA 3P6AA 4KHAA 3V5WA 2P0DA 3SYXA 5C79A 4PQ0A 5D3XA 5J3YA 3AU5A 2VRWB 2MDXA 5D3VA 5CLLB 4CYEA 1PMSA 2Z0OA 3P7ZA 1KZ7A 1FHXA 3DXDA 1BTNA 4HAUB 4MT7A 1UPRA 4F7UP 1W1DA 4HAVB 5C16A 3HIEA 3A58A 3HSAA 2N23A 2GJYA 2VSZA 1GC6A 5DH9B 1KZGA 4HB2B 2RVBB 2Q13A 4K81A 5DI9B 4IAPA 1V5MA 1X05A 2H7DA 3CIKA 2K8EA 1J19A 3ZDTA 4TKNA 3HQCA 1WJ1A 4HAYB 3O96A 1BTKA 2UZSA 4WVFB 4C0AA 4OSNA 2W2XC 5D27A
chains in the Genus database with same CATH topology
1I7AA 1OMWA 1QQGA 3A8QA 1DDVA 3QIJA 3IVFA 1U29A 1DDMA 4H8SA 1FB8A 1WGUA 1EF1A 5FI1A 4F7GA 2KGXB 2VKIA 1FGYA 3F5RA 3PVUA 3QBVB 5J3TA 2DA0A 2DX1A 4GN1A 3TCAA 1TJ6A 2HTHB 1WG7A 4L6EA 1NU2A 2D10A 1NTYA 4EJNA 4HB0B 2M38A 1U5DA 1MPHA 4HDOA 4KHBB 4A6KA 3PEGA 5JP4A 1UNQA 2AL6A 2N0YA 3A8PA 2LKOA 2D4QA 2LOXA 4HAWB 3ZVRA 4K17A 1RRPB 2DHJA 3MDBC 2YS5A 3HW2B 1P3RA 1MK7B 2W2XD 2AEHA 1DROA 2COFA 1MAIA 2JP2A 4IFSA 2BCJA 1MIXA 2D9XA 5HE0A 4XWXA 2DKPA 1EGXA 5HE2A 4KVGB 3ULBA 1FHWA 1M7EA 1V61A 1X86A 1XR0B 3WYFB 2LOZA 4DBBA 2EMSA 3ODXA 5KQ1A 5DHAB 2D9ZA 1E5WA 1U27A 3CXBB 3GYOA 3HK0A 2OQBA 4DX8A 1ZSQA 1N3HA 2DYQA 2PZ1A 4NY0A 5DIFB 4Z2MB 5HE1A 2CRFA 2IYBA 2I1KA 1BWNA 2DFKA 3SUZA 2IFSA 3ODOA 3F0WA 1WGQA 3VIAA 1OQNA 2K00A 2G35A 1XCGA 2QKMA 2W2WA 1UEFA 1ZVRA 2DN6A 2EJ8A 1LB1A 4F7HA 2DTCA 3LJUX 2COCA 1AQCA 3SNHA 3U8ZA 4D0NB 1DDWA 5HE3A 2V76A 5FI0A 4CHJA 3BINA 1X1GA 4HAZB 4GPTB 4K2PA 1ISNA 4B6HA 3A98B 2CY5A 3TFMA 5JHHA 2ELAA 2D2QA 3PVLA 1Z87A 2CAYA 1P6SA 3FEHA 2GCJA 2J0JA 2D9WA 2P8VA 2P0FA 1H4RA 2K2UA 1J0WA 3WA0A 3KZ1A 1U5FA 1V5UA 2ADZA 1V88A 2YRYA 1MIZB 1WI1A 3ODWA 1RJ2A 1IRSA 1TXDA 5GOWB 3FSSA 3D8FA 2RSGA 2D11A 4IOYX 1XKEA 2ROZB 4MY6A 5CLQB 2YS1A 2Z0PA 2OTXA 2H7EA 3KY9A 3VOQA 2MWNB 2CY4A 1V5PA 2DHIA 2R0DA 1TQZA 1K5GB 4KHOA 2KCJA 4HAXB 3KRXA 5D3WA 2YVCA 1W1HA 2XQNM 4P7IA 3U7DA 2L2IA 4EMOA 2J0MA 3PSCA 3KRWA 3X23A 4A6HA 4KAXB 3PG7A 1DYNA 2Y7BA 1Y19B 2M14A 3TO1A 1WJMA 4YL8A 2LG1A 2LULA 2ELBA 4HHVA 2I1JA 2GS0A 4DXAB 3GYPA 1FHOA 1KI1B 5KQ4A 5KCVA 5D3YA 5JLJB 4PNKA 2J0KA 2EMTA 3PP2A 4TYZA 1LW3A 4WSFA 1SGHA 4GMVA 4GMXB 3G9WA 3D8DA 2E2XA 4A6FB 1I2HA 3OANA 5C6RA 4YONA 2YT0A 1U5EA 2Y8GA 2HE7A 2FJLA 2DYNA 1XODA 1ZC4B 1EVHA 5LOPB 1X1FA 2D9VA 1UPQA 1M7RA 2I5FA 1XD4A 4EKUA 1ZM0A 1QC6A 4Y94A 3PVWA 2YSZA 1MKEA 4ZRJA 5J3QA 1FAOA 3QWMA 3SV1A 2UZRA 4BBKA 1BAKA 2RLOA 2RGNB 4ZRIA 5C5BB 3SO6A 2Y8FA 2QKLA 4GZUA 4HB4B 1NTVA 1MK9B 1PLSA 2YT1A 5L81A 4K2OA 2ZPYA 3AJ4A 1EAZA 2KUPA 4Z2NA 3FM8C 4A5KA 1B55A 1UNRA 1V89A 4ZRKA 4DX90 5LONB 1FGZA 3PZDA 5EFXA 2RNRB 2DHKA 2EC1A 4HATB 3T06A 2DLWA 4MK0A 1Y5OA 2NZ8B 2DKQA 2ROVA 1AWEA 1UNPA 2L1CA 2I5CA 2LYDA 2YS3A 3NSUA 3DXEA 2MKRA 2MFQA 4CHMA 3DXCA 3AU4A 2UVMA 1W1GA 2COAA 2RUKB 1OY2A 3ULCA 3N7CA 4HB3B 2X18A 2K2JA 1P5TA 3D8EA 2YF0A 4NSWA 4A6FA 3TW1A 4GXBA 1DBHA 1Q67A 1U5GA 1U2BA 2J59M 2NMBA 3BJIA 1WVHA 1GG3A 2GCLA 2P0HA 1SHCA 3ML4A 1GC7A 2R09A 5JHGA 3MPXA 3RCPA 4HDQA 1PFJA 2DX5A 1X11A 1H10A 1XX0A 1FOEA 2CODA 3UZTA 1ZC3B 5C5BA 5DHFB 1K5DB 3M1IB 1NI2A 2D9YA 3KSYA 4WJ7A 3TVVA 2Z0QA 3P6AA 4KHAA 3V5WA 2P0DA 3SYXA 5C79A 4PQ0A 5D3XA 5J3YA 3AU5A 2VRWB 2MDXA 5D3VA 5CLLB 4CYEA 1PMSA 2Z0OA 3P7ZA 1KZ7A 1FHXA 3DXDA 1BTNA 4HAUB 4MT7A 1UPRA 4F7UP 1W1DA 4HAVB 5C16A 2N23A 2GJYA 2VSZA 1GC6A 5DH9B 1KZGA 4HB2B 2RVBB 2Q13A 4K81A 5DI9B 4IAPA 1V5MA 1X05A 2H7DA 3CIKA 1J19A 3ZDTA 4TKNA 3HQCA 1WJ1A 4HAYB 3O96A 1BTKA 2UZSA 4WVFB 4C0AA 2W2XC 5D27A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I7A A;  1OMW A;  1QQG A;  3A8Q A;  1DDV A;  3QIJ A;  3IVF A;  1U29 A;  1DDM A;  4H8S A;  1FB8 A;  1WGU A;  1EF1 A;  5FI1 A;  4F7G A;  2KGX B;  2VKI A;  1FGY A;  3F5R A;  3PVU A;  3QBV B;  5J3T A;  2DA0 A;  2DX1 A;  4GN1 A;  3TCA A;  1TJ6 A;  2HTH B;  1WG7 A;  4L6E A;  1NU2 A;  2D10 A;  1NTY A;  4EJN A;  4HB0 B;  2M38 A;  1U5D A;  1MPH A;  4HDO A;  4KHB B;  4A6K A;  3PEG A;  5JP4 A;  1UNQ A;  2AL6 A;  2N0Y A;  3A8P A;  2LKO A;  2D4Q A;  2LOX A;  4HAW B;  3ZVR A;  4K17 A;  1RRP B;  2DHJ A;  3MDB C;  2YS5 A;  3HW2 B;  1P3R A;  1MK7 B;  2W2X D;  2AEH A;  1DRO A;  2COF A;  1MAI A;  2JP2 A;  4IFS A;  2BCJ A;  1MIX A;  2D9X A;  5HE0 A;  4XWX A;  2DKP A;  1EGX A;  5HE2 A;  4KVG B;  3ULB A;  1FHW A;  1M7E A;  1V61 A;  1X86 A;  1XR0 B;  3WYF B;  2LOZ A;  4DBB A;  2EMS A;  3ODX A;  5KQ1 A;  5DHA B;  2D9Z A;  1E5W A;  1U27 A;  3CXB B;  3GYO A;  3HK0 A;  2OQB A;  4DX8 A;  1ZSQ A;  1N3H A;  2DYQ A;  2PZ1 A;  4NY0 A;  5DIF B;  4Z2M B;  5HE1 A;  2CRF A;  2IYB A;  2I1K A;  1BWN A;  2DFK A;  3SUZ A;  2IFS A;  3ODO A;  3F0W A;  1WGQ A;  3VIA A;  1OQN A;  2K00 A;  2G35 A;  1XCG A;  2QKM A;  2W2W A;  1UEF A;  1ZVR A;  2DN6 A;  2EJ8 A;  1LB1 A;  4F7H A;  2DTC A;  3LJU X;  2COC A;  1AQC A;  3SNH A;  3U8Z A;  4D0N B;  1DDW A;  5HE3 A;  2V76 A;  5FI0 A;  4CHJ A;  3BIN A;  1X1G A;  4HAZ B;  4GPT B;  4K2P A;  1ISN A;  4B6H A;  3A98 B;  2CY5 A;  3TFM A;  5JHH A;  2ELA A;  2D2Q A;  3PVL A;  1Z87 A;  2CAY A;  1P6S A;  3FEH A;  2GCJ A;  2J0J A;  2D9W A;  2P8V A;  2P0F A;  1H4R A;  2K2U A;  1J0W A;  3WA0 A;  3KZ1 A;  1U5F A;  1V5U A;  2ADZ A;  1V88 A;  2YRY A;  1MIZ B;  1WI1 A;  3ODW A;  1RJ2 A;  1IRS A;  1TXD A;  5GOW B;  3FSS A;  3D8F A;  2RSG A;  2D11 A;  4IOY X;  1XKE A;  2ROZ B;  4MY6 A;  5CLQ B;  2YS1 A;  2Z0P A;  2OTX A;  2H7E A;  3KY9 A;  3VOQ A;  2MWN B;  2CY4 A;  1V5P A;  2DHI A;  2R0D A;  1TQZ A;  1K5G B;  4KHO A;  2KCJ A;  4HAX B;  3KRX A;  5D3W A;  2YVC A;  1W1H A;  2XQN M;  4P7I A;  3U7D A;  2L2I A;  4EMO A;  2J0M A;  3PSC A;  3KRW A;  3X23 A;  4A6H A;  4KAX B;  3PG7 A;  1DYN A;  2Y7B A;  1Y19 B;  2M14 A;  3TO1 A;  1WJM A;  4YL8 A;  2LG1 A;  2LUL A;  2ELB A;  4HHV A;  2I1J A;  2GS0 A;  4DXA B;  3GYP A;  1FHO A;  1KI1 B;  5KQ4 A;  5KCV A;  5D3Y A;  5JLJ B;  4PNK A;  2J0K A;  2EMT A;  3PP2 A;  4TYZ A;  1LW3 A;  4WSF A;  1SGH A;  4GMV A;  4GMX B;  3G9W A;  3D8D A;  2E2X A;  4A6F B;  1I2H A;  3OAN A;  5C6R A;  4YON A;  2YT0 A;  1U5E A;  2Y8G A;  2HE7 A;  2FJL A;  2DYN A;  1XOD A;  1ZC4 B;  1EVH A;  5LOP B;  1X1F A;  2D9V A;  1UPQ A;  1M7R A;  2I5F A;  1XD4 A;  4EKU A;  1ZM0 A;  1QC6 A;  4Y94 A;  3PVW A;  2YSZ A;  1MKE A;  4ZRJ A;  5J3Q A;  1FAO A;  3QWM A;  3SV1 A;  2UZR A;  4BBK A;  1BAK A;  2RLO A;  2RGN B;  4ZRI A;  5C5B B;  3SO6 A;  2Y8F A;  2QKL A;  4GZU A;  4HB4 B;  1NTV A;  1MK9 B;  1PLS A;  2YT1 A;  5L81 A;  4K2O A;  2ZPY A;  3AJ4 A;  1EAZ A;  2KUP A;  4Z2N A;  3FM8 C;  4A5K A;  1B55 A;  1UNR A;  1V89 A;  4ZRK A;  4DX9 0;  5LON B;  1FGZ A;  3PZD A;  5EFX A;  2RNR B;  2DHK A;  2EC1 A;  4HAT B;  3T06 A;  2DLW A;  4MK0 A;  1Y5O A;  2NZ8 B;  2DKQ A;  2ROV A;  1AWE A;  1UNP A;  2L1C A;  2I5C A;  2LYD A;  2YS3 A;  3NSU A;  3DXE A;  2MKR A;  2MFQ A;  4CHM A;  3DXC A;  3AU4 A;  2UVM A;  1W1G A;  2COA A;  2RUK B;  1OY2 A;  3ULC A;  3N7C A;  4HB3 B;  2X18 A;  2K2J A;  1P5T A;  3D8E A;  2YF0 A;  4NSW A;  4A6F A;  3TW1 A;  4GXB A;  1DBH A;  1Q67 A;  1U5G A;  1U2B A;  2J59 M;  2NMB A;  3BJI A;  1WVH A;  1GG3 A;  2GCL A;  2P0H A;  1SHC A;  3ML4 A;  1GC7 A;  2R09 A;  5JHG A;  3MPX A;  3RCP A;  4HDQ A;  1PFJ A;  2DX5 A;  1X11 A;  1H10 A;  1XX0 A;  1FOE A;  2COD A;  3UZT A;  1ZC3 B;  5C5B A;  5DHF B;  1K5D B;  3M1I B;  1NI2 A;  2D9Y A;  3KSY A;  4WJ7 A;  3TVV A;  2Z0Q A;  3P6A A;  4KHA A;  3V5W A;  2P0D A;  3SYX A;  5C79 A;  4PQ0 A;  5D3X A;  5J3Y A;  3AU5 A;  2VRW B;  2MDX A;  5D3V A;  5CLL B;  4CYE A;  1PMS A;  2Z0O A;  3P7Z A;  1KZ7 A;  1FHX A;  3DXD A;  1BTN A;  4HAU B;  4MT7 A;  1UPR A;  4F7U P;  1W1D A;  4HAV B;  5C16 A;  2N23 A;  2GJY A;  2VSZ A;  1GC6 A;  5DH9 B;  1KZG A;  4HB2 B;  2RVB B;  2Q13 A;  4K81 A;  5DI9 B;  4IAP A;  1V5M A;  1X05 A;  2H7D A;  3CIK A;  1J19 A;  3ZDT A;  4TKN A;  3HQC A;  1WJ1 A;  4HAY B;  3O96 A;  1BTK A;  2UZS A;  4WVF B;  4C0A A;  2W2X C;  5D27 A; 
#chains in the Genus database with same CATH topology
 1I7A A;  1OMW A;  3OHM B;  1QQG A;  3A8Q A;  1DDV A;  3QIJ A;  3IVF A;  1U29 A;  1DDM A;  4H8S A;  1FB8 A;  4GNK B;  4QJ5 B;  1WGU A;  1EF1 A;  4OT1 A;  2ZKM X;  5I2S A;  5FI1 A;  4F7G A;  2KGX B;  2VKI A;  1FGY A;  3F5R A;  3PVU A;  3QBV B;  5J3T A;  2DA0 A;  2DX1 A;  4GN1 A;  3TCA A;  3U12 A;  1TJ6 A;  2HTH B;  1WG7 A;  2FJU B;  4L6E A;  1NU2 A;  2D10 A;  1NTY A;  4EJN A;  4HB0 B;  2M38 A;  1U5D A;  1MPH A;  4HDO A;  4KHB B;  4A6K A;  3PEG A;  5JP4 A;  1UNQ A;  2AL6 A;  2N0Y A;  3A8P A;  2LKO A;  2D4Q A;  2LOX A;  4HAW B;  3ZVR A;  4K17 A;  1RRP B;  2DHJ A;  1MI1 A;  3MDB C;  2YS5 A;  3HW2 B;  1P3R A;  3NWA A;  1MK7 B;  2KR0 A;  2W2X D;  2AEH A;  3NWD A;  1DRO A;  2Z14 A;  2COF A;  1MAI A;  2JP2 A;  4IFS A;  2BCJ A;  3DCX A;  2RRF A;  4D6W A;  1MIX A;  2D9X A;  5HE0 A;  4XWX A;  2DKP A;  1EGX A;  5HE2 A;  4KVG B;  3ULB A;  1FHW A;  1M7E A;  1V61 A;  1X86 A;  1XR0 B;  3WYF B;  2LOZ A;  4DBB A;  3B77 A;  2EMS A;  3ODX A;  5KQ1 A;  5DHA B;  2D9Z A;  1E5W A;  1U27 A;  2Z4D A;  2KIG A;  3CXB B;  3GYO A;  3HK0 A;  4QJ3 B;  2OQB A;  4DX8 A;  1ZSQ A;  1N3H A;  2DYQ A;  2PZ1 A;  4NY0 A;  5DIF B;  4Z2M B;  4QJ4 B;  5HE1 A;  2CRF A;  2IYB A;  2I1K A;  1BWN A;  2DFK A;  3SUZ A;  2IFS A;  3ODO A;  3F0W A;  1WGQ A;  4KHB A;  3VIA A;  1OQN A;  2K00 A;  2G35 A;  1XCG A;  2QKM A;  2W2W A;  1UEF A;  1ZVR A;  2DN6 A;  2EJ8 A;  1LB1 A;  4F7H A;  2DTC A;  3LJU X;  2COC A;  1AQC A;  3SNH A;  3U8Z A;  4D0N B;  1DDW A;  5HE3 A;  2V76 A;  3FVC A;  5FI0 A;  4CHJ A;  3BIN A;  1X1G A;  4HAZ B;  4GPT B;  4K2P A;  1ISN A;  4B6H A;  3A98 B;  2CY5 A;  3TFM A;  5JHH A;  2ELA A;  2D2Q A;  2KIE A;  3PVL A;  1Z87 A;  2CAY A;  1P6S A;  3FEH A;  2GCJ A;  2J0J A;  4QXA B;  2D9W A;  2P8V A;  4HSI A;  3NW8 A;  2P0F A;  1H4R A;  2K2U A;  1J0W A;  3WA0 A;  3KZ1 A;  1U5F A;  1V5U A;  2ADZ A;  1V88 A;  1ZYI A;  2YRY A;  1MIZ B;  1WI1 A;  3ODW A;  1RJ2 A;  1IRS A;  1TXD A;  5GOW B;  3FSS A;  3D8F A;  2RSG A;  2D11 A;  4IOY X;  1XKE A;  2ROZ B;  4MY6 A;  5CLQ B;  2YS1 A;  2Z0P A;  2OTX A;  2H7E A;  3KY9 A;  3VOQ A;  2MWN B;  2CY4 A;  1V5P A;  2DHI A;  2R0D A;  1TQZ A;  1K5G B;  4KHO A;  2KCJ A;  4HAX B;  3KRX A;  5D3W A;  2YVC A;  1W1H A;  2XQN M;  4P7I A;  2YT2 A;  3U7D A;  2L2I A;  4EMO A;  2J0M A;  3PSC A;  3KRW A;  3X23 A;  4A6H A;  4KAX B;  3PG7 A;  1DYN A;  2Y7B A;  1Y19 B;  2M14 A;  3TO1 A;  1WJM A;  4YL8 A;  2LG1 A;  2LUL A;  2ELB A;  4HHV A;  2I1J A;  2GS0 A;  4DXA B;  5I2M A;  3GYP A;  1FHO A;  1KI1 B;  5KQ4 A;  5KCV A;  5D3Y A;  5JLJ B;  3NWF A;  4PNK A;  2Z13 A;  2J0K A;  2EMT A;  3PP2 A;  4TYZ A;  1LW3 A;  4WSF A;  1SGH A;  4GMV A;  4GMX B;  3G9W A;  3D8D A;  2E2X A;  4A6F B;  1I2H A;  3OAN A;  5C6R A;  4CSQ A;  4YON A;  2YT0 A;  1U5E A;  2Y8G A;  2HE7 A;  2FJL A;  2DYN A;  1XOD A;  1ZC4 B;  1EVH A;  5LOP B;  1X1F A;  2D9V A;  1UPQ A;  1M7R A;  2I5F A;  1XD4 A;  4EKU A;  1ZM0 A;  1QC6 A;  4Y94 A;  3PVW A;  2YSZ A;  1MKE A;  4ZRJ A;  5J3Q A;  1FAO A;  3QWM A;  3SV1 A;  2UZR A;  4BBK A;  2Z59 A;  1BAK A;  2RLO A;  2RGN B;  4ZRI A;  5C5B B;  3SO6 A;  2Y8F A;  2QKL A;  4GZU A;  4HB4 B;  1NTV A;  1MK9 B;  1PLS A;  2YT1 A;  2K49 A;  5L81 A;  4K2O A;  4L1R A;  2ZPY A;  3AJ4 A;  1EAZ A;  2KUP A;  4Z2N A;  3FM8 C;  4A5K A;  1B55 A;  1UNR A;  1V89 A;  4ZRK A;  4DX9 0;  5LON B;  1FGZ A;  3PZD A;  5EFX A;  2RNR B;  2DHK A;  2EC1 A;  4HAT B;  3T06 A;  2DLW A;  4MK0 A;  1Y5O A;  2NZ8 B;  2DKQ A;  2ROV A;  1AWE A;  1UNP A;  2L1C A;  2I5C A;  2LYD A;  2YS3 A;  3NSU A;  3DXE A;  2MKR A;  5IRS A;  2MFQ A;  4CHM A;  3DXC A;  5M4Y B;  3AU4 A;  2UVM A;  2NBV A;  1W1G A;  2COA A;  2RUK B;  1OY2 A;  3ULC A;  3N7C A;  4DIX A;  1T77 A;  4HB3 B;  2X18 A;  2K2J A;  2R2Y A;  1P5T A;  3D8E A;  2YF0 A;  4NSW A;  4A6F A;  3TW1 A;  4GXB A;  1DBH A;  2KUQ A;  1Q67 A;  1U5G A;  1U2B A;  2J59 M;  2NMB A;  3BJI A;  1WVH A;  1GG3 A;  2GCL A;  2P0H A;  1SHC A;  2GUM A;  3ML4 A;  1GC7 A;  2R09 A;  5JHG A;  3MPX A;  3RCP A;  4HDQ A;  1PFJ A;  2DX5 A;  1X11 A;  1H10 A;  1XX0 A;  1FOE A;  2COD A;  5LG4 B;  3UZT A;  1ZC3 B;  5C5B A;  4GOU A;  5DHF B;  1K5D B;  3M1I B;  1NI2 A;  2D9Y A;  3KSY A;  4WJ7 A;  3TVV A;  2Z0Q A;  3P6A A;  4KHA A;  3V5W A;  2P0D A;  3SYX A;  5C79 A;  4PQ0 A;  5D3X A;  5J3Y A;  3AU5 A;  2VRW B;  2MDX A;  5D3V A;  5CLL B;  4CYE A;  1PMS A;  2Z0O A;  3P7Z A;  1KZ7 A;  1FHX A;  3DXD A;  1BTN A;  4HAU B;  4MT7 A;  1UPR A;  4F7U P;  1W1D A;  4HAV B;  5C16 A;  3HIE A;  3A58 A;  3HSA A;  2N23 A;  2GJY A;  2VSZ A;  1GC6 A;  5DH9 B;  1KZG A;  4HB2 B;  2RVB B;  2Q13 A;  4K81 A;  5DI9 B;  4IAP A;  1V5M A;  1X05 A;  2H7D A;  3CIK A;  2K8E A;  1J19 A;  3ZDT A;  4TKN A;  3HQC A;  1WJ1 A;  4HAY B;  3O96 A;  1BTK A;  2UZS A;  4WVF B;  4C0A A;  4OSN A;  2W2X C;  5D27 A; 
#chains in the Genus database with same CATH homology
 1I7A A;  1OMW A;  1QQG A;  3A8Q A;  1DDV A;  3QIJ A;  3IVF A;  1U29 A;  1DDM A;  4H8S A;  1FB8 A;  1WGU A;  1EF1 A;  5FI1 A;  4F7G A;  2KGX B;  2VKI A;  1FGY A;  3F5R A;  3PVU A;  3QBV B;  5J3T A;  2DA0 A;  2DX1 A;  4GN1 A;  3TCA A;  1TJ6 A;  2HTH B;  1WG7 A;  4L6E A;  1NU2 A;  2D10 A;  1NTY A;  4EJN A;  4HB0 B;  2M38 A;  1U5D A;  1MPH A;  4HDO A;  4KHB B;  4A6K A;  3PEG A;  5JP4 A;  1UNQ A;  2AL6 A;  2N0Y A;  3A8P A;  2LKO A;  2D4Q A;  2LOX A;  4HAW B;  3ZVR A;  4K17 A;  1RRP B;  2DHJ A;  3MDB C;  2YS5 A;  3HW2 B;  1P3R A;  1MK7 B;  2W2X D;  2AEH A;  1DRO A;  2COF A;  1MAI A;  2JP2 A;  4IFS A;  2BCJ A;  1MIX A;  2D9X A;  5HE0 A;  4XWX A;  2DKP A;  1EGX A;  5HE2 A;  4KVG B;  3ULB A;  1FHW A;  1M7E A;  1V61 A;  1X86 A;  1XR0 B;  3WYF B;  2LOZ A;  4DBB A;  2EMS A;  3ODX A;  5KQ1 A;  5DHA B;  2D9Z A;  1E5W A;  1U27 A;  3CXB B;  3GYO A;  3HK0 A;  2OQB A;  4DX8 A;  1ZSQ A;  1N3H A;  2DYQ A;  2PZ1 A;  4NY0 A;  5DIF B;  4Z2M B;  5HE1 A;  2CRF A;  2IYB A;  2I1K A;  1BWN A;  2DFK A;  3SUZ A;  2IFS A;  3ODO A;  3F0W A;  1WGQ A;  3VIA A;  1OQN A;  2K00 A;  2G35 A;  1XCG A;  2QKM A;  2W2W A;  1UEF A;  1ZVR A;  2DN6 A;  2EJ8 A;  1LB1 A;  4F7H A;  2DTC A;  3LJU X;  2COC A;  1AQC A;  3SNH A;  3U8Z A;  4D0N B;  1DDW A;  5HE3 A;  2V76 A;  5FI0 A;  4CHJ A;  3BIN A;  1X1G A;  4HAZ B;  4GPT B;  4K2P A;  1ISN A;  4B6H A;  3A98 B;  2CY5 A;  3TFM A;  5JHH A;  2ELA A;  2D2Q A;  3PVL A;  1Z87 A;  2CAY A;  1P6S A;  3FEH A;  2GCJ A;  2J0J A;  2D9W A;  2P8V A;  2P0F A;  1H4R A;  2K2U A;  1J0W A;  3WA0 A;  3KZ1 A;  1U5F A;  1V5U A;  2ADZ A;  1V88 A;  2YRY A;  1MIZ B;  1WI1 A;  3ODW A;  1RJ2 A;  1IRS A;  1TXD A;  5GOW B;  3FSS A;  3D8F A;  2RSG A;  2D11 A;  4IOY X;  1XKE A;  2ROZ B;  4MY6 A;  5CLQ B;  2YS1 A;  2Z0P A;  2OTX A;  2H7E A;  3KY9 A;  3VOQ A;  2MWN B;  2CY4 A;  1V5P A;  2DHI A;  2R0D A;  1TQZ A;  1K5G B;  4KHO A;  2KCJ A;  4HAX B;  3KRX A;  5D3W A;  2YVC A;  1W1H A;  2XQN M;  4P7I A;  3U7D A;  2L2I A;  4EMO A;  2J0M A;  3PSC A;  3KRW A;  3X23 A;  4A6H A;  4KAX B;  3PG7 A;  1DYN A;  2Y7B A;  1Y19 B;  2M14 A;  3TO1 A;  1WJM A;  4YL8 A;  2LG1 A;  2LUL A;  2ELB A;  4HHV A;  2I1J A;  2GS0 A;  4DXA B;  3GYP A;  1FHO A;  1KI1 B;  5KQ4 A;  5KCV A;  5D3Y A;  5JLJ B;  4PNK A;  2J0K A;  2EMT A;  3PP2 A;  4TYZ A;  1LW3 A;  4WSF A;  1SGH A;  4GMV A;  4GMX B;  3G9W A;  3D8D A;  2E2X A;  4A6F B;  1I2H A;  3OAN A;  5C6R A;  4YON A;  2YT0 A;  1U5E A;  2Y8G A;  2HE7 A;  2FJL A;  2DYN A;  1XOD A;  1ZC4 B;  1EVH A;  5LOP B;  1X1F A;  2D9V A;  1UPQ A;  1M7R A;  2I5F A;  1XD4 A;  4EKU A;  1ZM0 A;  1QC6 A;  4Y94 A;  3PVW A;  2YSZ A;  1MKE A;  4ZRJ A;  5J3Q A;  1FAO A;  3QWM A;  3SV1 A;  2UZR A;  4BBK A;  1BAK A;  2RLO A;  2RGN B;  4ZRI A;  5C5B B;  3SO6 A;  2Y8F A;  2QKL A;  4GZU A;  4HB4 B;  1NTV A;  1MK9 B;  1PLS A;  2YT1 A;  5L81 A;  4K2O A;  2ZPY A;  3AJ4 A;  1EAZ A;  2KUP A;  4Z2N A;  3FM8 C;  4A5K A;  1B55 A;  1UNR A;  1V89 A;  4ZRK A;  4DX9 0;  5LON B;  1FGZ A;  3PZD A;  5EFX A;  2RNR B;  2DHK A;  2EC1 A;  4HAT B;  3T06 A;  2DLW A;  4MK0 A;  1Y5O A;  2NZ8 B;  2DKQ A;  2ROV A;  1AWE A;  1UNP A;  2L1C A;  2I5C A;  2LYD A;  2YS3 A;  3NSU A;  3DXE A;  2MKR A;  2MFQ A;  4CHM A;  3DXC A;  3AU4 A;  2UVM A;  1W1G A;  2COA A;  2RUK B;  1OY2 A;  3ULC A;  3N7C A;  4HB3 B;  2X18 A;  2K2J A;  1P5T A;  3D8E A;  2YF0 A;  4NSW A;  4A6F A;  3TW1 A;  4GXB A;  1DBH A;  1Q67 A;  1U5G A;  1U2B A;  2J59 M;  2NMB A;  3BJI A;  1WVH A;  1GG3 A;  2GCL A;  2P0H A;  1SHC A;  3ML4 A;  1GC7 A;  2R09 A;  5JHG A;  3MPX A;  3RCP A;  4HDQ A;  1PFJ A;  2DX5 A;  1X11 A;  1H10 A;  1XX0 A;  1FOE A;  2COD A;  3UZT A;  1ZC3 B;  5C5B A;  5DHF B;  1K5D B;  3M1I B;  1NI2 A;  2D9Y A;  3KSY A;  4WJ7 A;  3TVV A;  2Z0Q A;  3P6A A;  4KHA A;  3V5W A;  2P0D A;  3SYX A;  5C79 A;  4PQ0 A;  5D3X A;  5J3Y A;  3AU5 A;  2VRW B;  2MDX A;  5D3V A;  5CLL B;  4CYE A;  1PMS A;  2Z0O A;  3P7Z A;  1KZ7 A;  1FHX A;  3DXD A;  1BTN A;  4HAU B;  4MT7 A;  1UPR A;  4F7U P;  1W1D A;  4HAV B;  5C16 A;  2N23 A;  2GJY A;  2VSZ A;  1GC6 A;  5DH9 B;  1KZG A;  4HB2 B;  2RVB B;  2Q13 A;  4K81 A;  5DI9 B;  4IAP A;  1V5M A;  1X05 A;  2H7D A;  3CIK A;  1J19 A;  3ZDT A;  4TKN A;  3HQC A;  1WJ1 A;  4HAY B;  3O96 A;  1BTK A;  2UZS A;  4WVF B;  4C0A A;  2W2X C;  5D27 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...