1Y5OA

Nmr structure of the amino-terminal domain from the tfb1 subunit of yeast tfiih
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
115
structure length
115
Chain Sequence
PSHSGAAIFEKVSGIIAINEDVSPAELTWRSTDGDKVHTVVLSTIDKLQATPASSEKMMLRLIGKVDESKKRKDNEGNEVVPKPQRHMFSFNNRTVMDNIKMTLQQIISRYKDAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords RNA polymerase II transcription factor B 73 kDa subunit
publication title NMR Structure of the Amino-Terminal Domain from the Tfb1 Subunit of TFIIH and Characterization of Its Phosphoinositide and VP16 Binding Sites
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 18
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2004-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08567 PH_TFIIH TFIIH p62 subunit, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1y5oA00
3PVUA 2DHJA 3A98B 2D9WA 3G9WA 2I1KA 2DA0A 1DDMA 3M1IB 1KZGA 2MFQA 3ULBA 2K2UA 4B6HA 4HDOA 1GC6A 1ZSQA 1RJ2A 2I1JA 1U2BA 4HATB 2CODA 3F5RA 4C0AA 4HB2B 3GYOA 1NTYA 2D11A 2ELBA 2LOXA 2KUPA 1U27A 1U5GA 3TFMA 3DXCA 1KI1B 1SHCA 1U5DA 5CLLB 1MAIA 1M7RA 1PMSA 4EJNA 5D27A 3WYFB 5DH9B 1NI2A 3FSSA 3GYPA 2V76A 1EF1A 1ZVRA 2YF0A 2YS5A 1ZC3B 5D3YA 1SGHA 3D8DA 2J0KA 1XKEA 1XX0A 1GG3A 2J0JA 2MDXA 1I2HA 5JP4A 2Z0QA 3CXBB 1Q67A 3O96A 1WJ1A 4WVFB 3HK0A 4TKNA 2QKMA 3ML4A 3A8QA 2DFKA 5D3WA 2M14A 1NTVA 2D10A 5DIFB 2RNRB 2EMSA 2MKRA 2RGNB 2P0FA 4GN1A 2UZSA 1PLSA 4PNKA 4A6FB 3IVFA 4GZUA 1MK7B 3A8PA 4GXBA 3DXEA 4K17A 1X1GA 3T06A 2N23A 1WI1A 2I5FA 1BTNA 3ZVRA 1FAOA 3F0WA 1P5TA 1P3RA 2X18A 4CYEA 4EKUA 2VRWB 1LW3A 1WG7A 1FHXA 1BTKA 2YRYA 2KGXB 3QWMA 4HAYB 1X11A 3LJUX 2JP2A 2CY4A 2IFSA 4KHBB 5GOWB 3FEHA 1UNQA 4WJ7A 5CLQB 3PEGA 2R09A 3NSUA 3AU4A 1UPQA 2MWNB 1UNRA 2L2IA 2LG1A 5HE1A 5FI1A 2W2WA 4GMXB 4L6EA 1LB1A 1U29A 2IYBA 4P7IA 3PG7A 1PFJA 3SO6A 2GCJA 3FM8C 5C16A 2D2QA 5C5BA 4NY0A 1FGZA 3SV1A 4HB3B 2K00A 1Y19B 2H7EA 2M38A 5D3VA 2Y8FA 2Z0OA 5J3QA 3BINA 4HAVB 4WSFA 1AQCA 2DLWA 5LOPB 1MIZB 4A6KA 3SNHA 4HAUB 1X05A 2OTXA 1K5DB 3HW2B 3KSYA 5JHHA 4ZRKA 5FI0A 1UPRA 1TQZA 2BCJA 1UNPA 1DROA 4Z2MB 1GC7A 3VIAA 1J0WA 2RSGA 1U5FA 5DHAB 1ZC4B 2Q13A 2CAYA 2W2XD 4HDQA 4A5KA 2Z0PA 2YS1A 2R0DA 2DHKA 4HAXB 2N0YA 2PZ1A 1OY2A 3PVWA 3D8FA 5EFXA 3ULCA 1X1FA 2DYQA 2EC1A 4NSWA 2COCA 2D9VA 2J0MA 5KQ4A 2LULA 3SUZA 4MT7A 5KCVA 4Y94A 2G35A 1V89A 2YT0A 2HE7A 4CHMA 1N3HA 2D9ZA 3TVVA 1EVHA 1TXDA 3DXDA 2P0HA 1U5EA 2P0DA 1ISNA 2CRFA 1V5MA 2YT1A 3AJ4A 1W1HA 2EJ8A 2LYDA 1Y5OA 3ODOA 1OQNA 3V5WA 3KZ1A 1WGQA 1DDWA 1NU2A 3RCPA 1TJ6A 4CHJA 2AL6A 4HB4B 5LONB 1WVHA 4IOYX 2D9XA 1W1DA 3WA0A 5JHGA 1MK9B 3TO1A 2GJYA 3PVLA 2H7DA 4ZRIA 3PP2A 3U7DA 1IRSA 2P8VA 5C5BB 4HB0B 4D0NB 1MKEA 4EMOA 2DYNA 4XWXA 1B55A 5D3XA 1BWNA 4TYZA 4A6HA 4K81A 2I5CA 5KQ1A 2FJLA 1RRPB 2DHIA 2NZ8B 4F7GA 2ROZB 3HQCA 3P6AA 3TCAA 2YS3A 2J59M 4KAXB 2HTHB 4MY6A 3KRWA 4H8SA 3P7ZA 2UVMA 1MPHA 1H10A 1FB8A 3VOQA 2GS0A 5JLJB 5HE0A 1DYNA 4F7HA 3SYXA 4KVGB 2NMBA 1QC6A 3KY9A 3BJIA 2COAA 1FHWA 5L81A 2QKLA 2LKOA 4IAPA 1XD4A 1W1GA 1V61A 2DX5A 2EMTA 4DXAB 2ZPYA 4F7UP 2ADZA 1MIXA 1H4RA 2DKPA 1FHOA 2CY5A 1V5UA 1UEFA 3UZTA 1WJMA 4DBBA 1EAZA 4HAZB 1P6SA 5DHFB 5J3YA 2ELAA 5HE3A 1J19A 3PSCA 4KHAA 4HAWB 1FGYA 2YVCA 4DX90 3U8ZA 4DX8A 2DKQA 2DX1A 1DDVA 2E2XA 5C79A 2KCJA 2VSZA 4K2PA 2W2XC 2RLOA 4K2OA 3CIKA 2Y7BA 2XQNM 2ROVA 3MDBC 4A6FA 1V88A 1WGUA 1KZ7A 2K2JA 3ODXA 5J3TA 2DTCA 5HE2A 2RVBB 3PZDA 4HHVA 1DBHA 3N7CA 3ZDTA 1K5GB 1XR0B 2DN6A 3QIJA 4IFSA 1AWEA 2RUKB 4GMVA 3TW1A 4GPTB 1X86A 4PQ0A 4BBKA 4YL8A 4YONA 2D4QA 1EGXA 2YSZA 2LOZA 4MK0A 2Y8GA 3AU5A 1M7EA 3ODWA 4Z2NA 1V5PA 2COFA 1XODA 3D8EA 3OANA 2GCLA 1OMWA 1BAKA 5C6RA 4ZRJA 2D9YA 3QBVB 2OQBA 3X23A 1I7AA 1XCGA 3MPXA 3KRXA 2L1CA 2AEHA 1Z87A 1ZM0A 1QQGA 1FOEA 4KHOA 2UZRA 1E5WA 2VKIA 5DI9B
chains in the Genus database with same CATH superfamily
3PVUA 2DHJA 3A98B 2D9WA 3G9WA 2I1KA 2DA0A 1DDMA 3M1IB 1KZGA 2Z14A 2MFQA 3ULBA 2K2UA 4B6HA 4HDOA 1GC6A 1ZSQA 1RJ2A 2I1JA 1U2BA 4CSQA 4HATB 2CODA 3F5RA 4C0AA 4HB2B 3GYOA 1NTYA 2D11A 2ELBA 2LOXA 2KUPA 1U27A 1U5GA 3TFMA 3DXCA 1KI1B 1SHCA 1U5DA 5CLLB 1MAIA 1M7RA 1PMSA 3HSAA 4EJNA 5D27A 3WYFB 5DH9B 1NI2A 3FSSA 3GYPA 2V76A 1EF1A 1ZVRA 2YF0A 2YS5A 4L1RA 1ZC3B 5D3YA 1SGHA 3D8DA 4QXAB 2J0KA 1XKEA 1XX0A 1GG3A 2J0JA 2MDXA 1I2HA 5JP4A 2Z0QA 2K49A 3CXBB 1Q67A 3O96A 1WJ1A 2ZKMX 4WVFB 3HK0A 4TKNA 4D6WA 2QKMA 3ML4A 3A8QA 2DFKA 5D3WA 2M14A 1NTVA 2D10A 5DIFB 2RNRB 2EMSA 2MKRA 2RGNB 2P0FA 4OT1A 4GN1A 3FVCA 2UZSA 1PLSA 4PNKA 2KIEA 4A6FB 3IVFA 4GZUA 1MK7B 3A8PA 2Z59A 4GOUA 3DXEA 4GXBA 4K17A 1X1GA 3T06A 2N23A 1WI1A 2I5FA 1BTNA 3ZVRA 5IRSA 1FAOA 3F0WA 1P5TA 1P3RA 2X18A 4CYEA 4EKUA 2VRWB 1LW3A 1WG7A 1FHXA 1BTKA 2YRYA 2KGXB 3QWMA 4HAYB 1X11A 3LJUX 3DCXA 1MI1A 2JP2A 2CY4A 2IFSA 4KHBB 5GOWB 3FEHA 1UNQA 4WJ7A 2GUMA 5CLQB 3PEGA 2R09A 3NSUA 3AU4A 1UPQA 2MWNB 1UNRA 2L2IA 2LG1A 5HE1A 5FI1A 2W2WA 4GMXB 4L6EA 1LB1A 1U29A 2IYBA 4P7IA 3PG7A 1PFJA 3SO6A 2GCJA 3FM8C 5C16A 3OHMB 2D2QA 4OSNA 5C5BA 4NY0A 1FGZA 3SV1A 4HB3B 2K00A 1Y19B 2H7EA 2M38A 5D3VA 2Y8FA 2Z0OA 5J3QA 3HIEA 3BINA 4HAVB 4WSFA 1AQCA 2DLWA 5LOPB 2K8EA 1MIZB 4A6KA 3SNHA 4HAUB 1X05A 2OTXA 1K5DB 3HW2B 3KSYA 5JHHA 2Z4DA 4ZRKA 5FI0A 1UPRA 1TQZA 2BCJA 1UNPA 1DROA 4Z2MB 1GC7A 3VIAA 1J0WA 2RSGA 1U5FA 5DHAB 1ZC4B 2Q13A 2CAYA 2W2XD 4HDQA 4A5KA 2Z0PA 2YS1A 2YT2A 2R0DA 2DHKA 4HAXB 2N0YA 2PZ1A 1OY2A 3PVWA 3NW8A 3D8FA 5EFXA 3ULCA 1X1FA 2DYQA 2EC1A 4NSWA 2COCA 2D9VA 2J0MA 5KQ4A 2LULA 3SUZA 4MT7A 5KCVA 4Y94A 2G35A 1V89A 2YT0A 2HE7A 4CHMA 1N3HA 2D9ZA 3TVVA 1EVHA 1TXDA 3DXDA 2P0HA 1U5EA 4QJ4B 1ZYIA 2P0DA 1ISNA 2CRFA 1V5MA 2YT1A 3AJ4A 1W1HA 2EJ8A 2LYDA 1Y5OA 2Z13A 2NBVA 3ODOA 1OQNA 3U12A 3V5WA 3KZ1A 1WGQA 1T77A 1DDWA 1NU2A 3RCPA 1TJ6A 4CHJA 2AL6A 4HB4B 5LONB 1WVHA 2FJUB 4IOYX 5LG4B 2D9XA 1W1DA 3WA0A 5JHGA 1MK9B 3TO1A 2GJYA 3PVLA 3NWFA 2H7DA 4ZRIA 3PP2A 3U7DA 1IRSA 2P8VA 5C5BB 4HB0B 4D0NB 1MKEA 4EMOA 2DYNA 4XWXA 1B55A 5D3XA 1BWNA 4TYZA 4A6HA 4K81A 5I2SA 2I5CA 5KQ1A 2FJLA 1RRPB 2DHIA 2NZ8B 4F7GA 2ROZB 3HQCA 3P6AA 3B77A 4DIXA 3TCAA 2YS3A 2J59M 4KAXB 2HTHB 4MY6A 3KRWA 4H8SA 3P7ZA 2UVMA 1MPHA 1H10A 1FB8A 3VOQA 2GS0A 4QJ5B 5JLJB 5HE0A 1DYNA 4F7HA 3SYXA 4KVGB 2NMBA 1QC6A 3KY9A 3BJIA 2COAA 5M4YB 1FHWA 5L81A 2QKLA 2LKOA 4IAPA 2KUQA 1XD4A 1W1GA 1V61A 2DX5A 2EMTA 4DXAB 2ZPYA 4F7UP 2ADZA 1MIXA 1H4RA 2DKPA 3NWAA 1FHOA 2CY5A 1V5UA 1UEFA 3UZTA 1WJMA 4DBBA 1EAZA 4HAZB 1P6SA 5DHFB 5J3YA 2ELAA 5HE3A 1J19A 3PSCA 4KHAA 4HAWB 1FGYA 2YVCA 2RRFA 4DX90 3U8ZA 4DX8A 2DKQA 2DX1A 1DDVA 2E2XA 5C79A 2KCJA 2VSZA 4K2PA 2W2XC 2RLOA 4K2OA 3CIKA 2Y7BA 2XQNM 2KIGA 2ROVA 3NWDA 3MDBC 4A6FA 4HSIA 1V88A 1WGUA 1KZ7A 2K2JA 3ODXA 5J3TA 2DTCA 4GNKB 5HE2A 2RVBB 3PZDA 4HHVA 1DBHA 3N7CA 3ZDTA 1K5GB 1XR0B 2DN6A 4QJ3B 3QIJA 4IFSA 1AWEA 2RUKB 4GMVA 3TW1A 4GPTB 1X86A 4PQ0A 4BBKA 4YL8A 4YONA 4KHBA 2D4QA 1EGXA 2YSZA 2LOZA 4MK0A 2Y8GA 3AU5A 1M7EA 3ODWA 4Z2NA 1V5PA 3A58A 2COFA 1XODA 3D8EA 3OANA 2GCLA 2R2YA 1OMWA 1BAKA 5C6RA 5I2MA 4ZRJA 2D9YA 3QBVB 2OQBA 3X23A 1I7AA 1XCGA 3MPXA 3KRXA 2L1CA 2AEHA 1Z87A 2KR0A 1ZM0A 1QQGA 1FOEA 4KHOA 2UZRA 1E5WA 2VKIA 5DI9B
chains in the Genus database with same CATH topology
3PVUA 2DHJA 3A98B 2D9WA 3G9WA 2I1KA 2DA0A 1DDMA 3M1IB 1KZGA 2MFQA 3ULBA 2K2UA 4B6HA 4HDOA 1GC6A 1ZSQA 1RJ2A 2I1JA 1U2BA 4HATB 2CODA 3F5RA 4C0AA 4HB2B 3GYOA 1NTYA 2D11A 2ELBA 2LOXA 2KUPA 1U27A 1U5GA 3TFMA 3DXCA 1KI1B 1SHCA 1U5DA 5CLLB 1MAIA 1M7RA 1PMSA 4EJNA 5D27A 3WYFB 5DH9B 1NI2A 3FSSA 3GYPA 2V76A 1EF1A 1ZVRA 2YF0A 2YS5A 1ZC3B 5D3YA 1SGHA 3D8DA 2J0KA 1XKEA 1XX0A 1GG3A 2J0JA 2MDXA 1I2HA 5JP4A 2Z0QA 3CXBB 1Q67A 3O96A 1WJ1A 4WVFB 3HK0A 4TKNA 2QKMA 3ML4A 3A8QA 2DFKA 5D3WA 2M14A 1NTVA 2D10A 5DIFB 2RNRB 2EMSA 2MKRA 2RGNB 2P0FA 4GN1A 2UZSA 1PLSA 4PNKA 4A6FB 3IVFA 4GZUA 1MK7B 3A8PA 4GXBA 3DXEA 4K17A 1X1GA 3T06A 2N23A 1WI1A 2I5FA 1BTNA 3ZVRA 1FAOA 3F0WA 1P5TA 1P3RA 2X18A 4CYEA 4EKUA 2VRWB 1LW3A 1WG7A 1FHXA 1BTKA 2YRYA 2KGXB 3QWMA 4HAYB 1X11A 3LJUX 2JP2A 2CY4A 2IFSA 4KHBB 5GOWB 3FEHA 1UNQA 4WJ7A 5CLQB 3PEGA 2R09A 3NSUA 3AU4A 1UPQA 2MWNB 1UNRA 2L2IA 2LG1A 5HE1A 5FI1A 2W2WA 4GMXB 4L6EA 1LB1A 1U29A 2IYBA 4P7IA 3PG7A 1PFJA 3SO6A 2GCJA 3FM8C 5C16A 2D2QA 5C5BA 4NY0A 1FGZA 3SV1A 4HB3B 2K00A 1Y19B 2H7EA 2M38A 5D3VA 2Y8FA 2Z0OA 5J3QA 3BINA 4HAVB 4WSFA 1AQCA 2DLWA 5LOPB 1MIZB 4A6KA 3SNHA 4HAUB 1X05A 2OTXA 1K5DB 3HW2B 3KSYA 5JHHA 4ZRKA 5FI0A 1UPRA 1TQZA 2BCJA 1UNPA 1DROA 4Z2MB 1GC7A 3VIAA 1J0WA 2RSGA 1U5FA 5DHAB 1ZC4B 2Q13A 2CAYA 2W2XD 4HDQA 4A5KA 2Z0PA 2YS1A 2R0DA 2DHKA 4HAXB 2N0YA 2PZ1A 1OY2A 3PVWA 3D8FA 5EFXA 3ULCA 1X1FA 2DYQA 2EC1A 4NSWA 2COCA 2D9VA 2J0MA 5KQ4A 2LULA 3SUZA 4MT7A 5KCVA 4Y94A 2G35A 1V89A 2YT0A 2HE7A 4CHMA 1N3HA 2D9ZA 3TVVA 1EVHA 1TXDA 3DXDA 2P0HA 1U5EA 2P0DA 1ISNA 2CRFA 1V5MA 2YT1A 3AJ4A 1W1HA 2EJ8A 2LYDA 1Y5OA 3ODOA 1OQNA 3V5WA 3KZ1A 1WGQA 1DDWA 1NU2A 3RCPA 1TJ6A 4CHJA 2AL6A 4HB4B 5LONB 1WVHA 4IOYX 2D9XA 1W1DA 3WA0A 5JHGA 1MK9B 3TO1A 2GJYA 3PVLA 2H7DA 4ZRIA 3PP2A 3U7DA 1IRSA 2P8VA 5C5BB 4HB0B 4D0NB 1MKEA 4EMOA 2DYNA 4XWXA 1B55A 5D3XA 1BWNA 4TYZA 4A6HA 4K81A 2I5CA 5KQ1A 2FJLA 1RRPB 2DHIA 2NZ8B 4F7GA 2ROZB 3HQCA 3P6AA 3TCAA 2YS3A 2J59M 4KAXB 2HTHB 4MY6A 3KRWA 4H8SA 3P7ZA 2UVMA 1MPHA 1H10A 1FB8A 3VOQA 2GS0A 5JLJB 5HE0A 1DYNA 4F7HA 3SYXA 4KVGB 2NMBA 1QC6A 3KY9A 3BJIA 2COAA 1FHWA 5L81A 2QKLA 2LKOA 4IAPA 1XD4A 1W1GA 1V61A 2DX5A 2EMTA 4DXAB 2ZPYA 4F7UP 2ADZA 1MIXA 1H4RA 2DKPA 1FHOA 2CY5A 1V5UA 1UEFA 3UZTA 1WJMA 4DBBA 1EAZA 4HAZB 1P6SA 5DHFB 5J3YA 2ELAA 5HE3A 1J19A 3PSCA 4KHAA 4HAWB 1FGYA 2YVCA 4DX90 3U8ZA 4DX8A 2DKQA 2DX1A 1DDVA 2E2XA 5C79A 2KCJA 2VSZA 4K2PA 2W2XC 2RLOA 4K2OA 3CIKA 2Y7BA 2XQNM 2ROVA 3MDBC 4A6FA 1V88A 1WGUA 1KZ7A 2K2JA 3ODXA 5J3TA 2DTCA 5HE2A 2RVBB 3PZDA 4HHVA 1DBHA 3N7CA 3ZDTA 1K5GB 1XR0B 2DN6A 3QIJA 4IFSA 1AWEA 2RUKB 4GMVA 3TW1A 4GPTB 1X86A 4PQ0A 4BBKA 4YL8A 4YONA 2D4QA 1EGXA 2YSZA 2LOZA 4MK0A 2Y8GA 3AU5A 1M7EA 3ODWA 4Z2NA 1V5PA 2COFA 1XODA 3D8EA 3OANA 2GCLA 1OMWA 1BAKA 5C6RA 4ZRJA 2D9YA 3QBVB 2OQBA 3X23A 1I7AA 1XCGA 3MPXA 3KRXA 2L1CA 2AEHA 1Z87A 1ZM0A 1QQGA 1FOEA 4KHOA 2UZRA 1E5WA 2VKIA 5DI9B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PVU A;  2DHJ A;  3A98 B;  2D9W A;  3G9W A;  2I1K A;  2DA0 A;  1DDM A;  3M1I B;  1KZG A;  2MFQ A;  3ULB A;  2K2U A;  4B6H A;  4HDO A;  1GC6 A;  1ZSQ A;  1RJ2 A;  2I1J A;  1U2B A;  4HAT B;  2COD A;  3F5R A;  4C0A A;  4HB2 B;  3GYO A;  1NTY A;  2D11 A;  2ELB A;  2LOX A;  2KUP A;  1U27 A;  1U5G A;  3TFM A;  3DXC A;  1KI1 B;  1SHC A;  1U5D A;  5CLL B;  1MAI A;  1M7R A;  1PMS A;  4EJN A;  5D27 A;  3WYF B;  5DH9 B;  1NI2 A;  3FSS A;  3GYP A;  2V76 A;  1EF1 A;  1ZVR A;  2YF0 A;  2YS5 A;  1ZC3 B;  5D3Y A;  1SGH A;  3D8D A;  2J0K A;  1XKE A;  1XX0 A;  1GG3 A;  2J0J A;  2MDX A;  1I2H A;  5JP4 A;  2Z0Q A;  3CXB B;  1Q67 A;  3O96 A;  1WJ1 A;  4WVF B;  3HK0 A;  4TKN A;  2QKM A;  3ML4 A;  3A8Q A;  2DFK A;  5D3W A;  2M14 A;  1NTV A;  2D10 A;  5DIF B;  2RNR B;  2EMS A;  2MKR A;  2RGN B;  2P0F A;  4GN1 A;  2UZS A;  1PLS A;  4PNK A;  4A6F B;  3IVF A;  4GZU A;  1MK7 B;  3A8P A;  4GXB A;  3DXE A;  4K17 A;  1X1G A;  3T06 A;  2N23 A;  1WI1 A;  2I5F A;  1BTN A;  3ZVR A;  1FAO A;  3F0W A;  1P5T A;  1P3R A;  2X18 A;  4CYE A;  4EKU A;  2VRW B;  1LW3 A;  1WG7 A;  1FHX A;  1BTK A;  2YRY A;  2KGX B;  3QWM A;  4HAY B;  1X11 A;  3LJU X;  2JP2 A;  2CY4 A;  2IFS A;  4KHB B;  5GOW B;  3FEH A;  1UNQ A;  4WJ7 A;  5CLQ B;  3PEG A;  2R09 A;  3NSU A;  3AU4 A;  1UPQ A;  2MWN B;  1UNR A;  2L2I A;  2LG1 A;  5HE1 A;  5FI1 A;  2W2W A;  4GMX B;  4L6E A;  1LB1 A;  1U29 A;  2IYB A;  4P7I A;  3PG7 A;  1PFJ A;  3SO6 A;  2GCJ A;  3FM8 C;  5C16 A;  2D2Q A;  5C5B A;  4NY0 A;  1FGZ A;  3SV1 A;  4HB3 B;  2K00 A;  1Y19 B;  2H7E A;  2M38 A;  5D3V A;  2Y8F A;  2Z0O A;  5J3Q A;  3BIN A;  4HAV B;  4WSF A;  1AQC A;  2DLW A;  5LOP B;  1MIZ B;  4A6K A;  3SNH A;  4HAU B;  1X05 A;  2OTX A;  1K5D B;  3HW2 B;  3KSY A;  5JHH A;  4ZRK A;  5FI0 A;  1UPR A;  1TQZ A;  2BCJ A;  1UNP A;  1DRO A;  4Z2M B;  1GC7 A;  3VIA A;  1J0W A;  2RSG A;  1U5F A;  5DHA B;  1ZC4 B;  2Q13 A;  2CAY A;  2W2X D;  4HDQ A;  4A5K A;  2Z0P A;  2YS1 A;  2R0D A;  2DHK A;  4HAX B;  2N0Y A;  2PZ1 A;  1OY2 A;  3PVW A;  3D8F A;  5EFX A;  3ULC A;  1X1F A;  2DYQ A;  2EC1 A;  4NSW A;  2COC A;  2D9V A;  2J0M A;  5KQ4 A;  2LUL A;  3SUZ A;  4MT7 A;  5KCV A;  4Y94 A;  2G35 A;  1V89 A;  2YT0 A;  2HE7 A;  4CHM A;  1N3H A;  2D9Z A;  3TVV A;  1EVH A;  1TXD A;  3DXD A;  2P0H A;  1U5E A;  2P0D A;  1ISN A;  2CRF A;  1V5M A;  2YT1 A;  3AJ4 A;  1W1H A;  2EJ8 A;  2LYD A;  1Y5O A;  3ODO A;  1OQN A;  3V5W A;  3KZ1 A;  1WGQ A;  1DDW A;  1NU2 A;  3RCP A;  1TJ6 A;  4CHJ A;  2AL6 A;  4HB4 B;  5LON B;  1WVH A;  4IOY X;  2D9X A;  1W1D A;  3WA0 A;  5JHG A;  1MK9 B;  3TO1 A;  2GJY A;  3PVL A;  2H7D A;  4ZRI A;  3PP2 A;  3U7D A;  1IRS A;  2P8V A;  5C5B B;  4HB0 B;  4D0N B;  1MKE A;  4EMO A;  2DYN A;  4XWX A;  1B55 A;  5D3X A;  1BWN A;  4TYZ A;  4A6H A;  4K81 A;  2I5C A;  5KQ1 A;  2FJL A;  1RRP B;  2DHI A;  2NZ8 B;  4F7G A;  2ROZ B;  3HQC A;  3P6A A;  3TCA A;  2YS3 A;  2J59 M;  4KAX B;  2HTH B;  4MY6 A;  3KRW A;  4H8S A;  3P7Z A;  2UVM A;  1MPH A;  1H10 A;  1FB8 A;  3VOQ A;  2GS0 A;  5JLJ B;  5HE0 A;  1DYN A;  4F7H A;  3SYX A;  4KVG B;  2NMB A;  1QC6 A;  3KY9 A;  3BJI A;  2COA A;  1FHW A;  5L81 A;  2QKL A;  2LKO A;  4IAP A;  1XD4 A;  1W1G A;  1V61 A;  2DX5 A;  2EMT A;  4DXA B;  2ZPY A;  4F7U P;  2ADZ A;  1MIX A;  1H4R A;  2DKP A;  1FHO A;  2CY5 A;  1V5U A;  1UEF A;  3UZT A;  1WJM A;  4DBB A;  1EAZ A;  4HAZ B;  1P6S A;  5DHF B;  5J3Y A;  2ELA A;  5HE3 A;  1J19 A;  3PSC A;  4KHA A;  4HAW B;  1FGY A;  2YVC A;  4DX9 0;  3U8Z A;  4DX8 A;  2DKQ A;  2DX1 A;  1DDV A;  2E2X A;  5C79 A;  2KCJ A;  2VSZ A;  4K2P A;  2W2X C;  2RLO A;  4K2O A;  3CIK A;  2Y7B A;  2XQN M;  2ROV A;  3MDB C;  4A6F A;  1V88 A;  1WGU A;  1KZ7 A;  2K2J A;  3ODX A;  5J3T A;  2DTC A;  5HE2 A;  2RVB B;  3PZD A;  4HHV A;  1DBH A;  3N7C A;  3ZDT A;  1K5G B;  1XR0 B;  2DN6 A;  3QIJ A;  4IFS A;  1AWE A;  2RUK B;  4GMV A;  3TW1 A;  4GPT B;  1X86 A;  4PQ0 A;  4BBK A;  4YL8 A;  4YON A;  2D4Q A;  1EGX A;  2YSZ A;  2LOZ A;  4MK0 A;  2Y8G A;  3AU5 A;  1M7E A;  3ODW A;  4Z2N A;  1V5P A;  2COF A;  1XOD A;  3D8E A;  3OAN A;  2GCL A;  1OMW A;  1BAK A;  5C6R A;  4ZRJ A;  2D9Y A;  3QBV B;  2OQB A;  3X23 A;  1I7A A;  1XCG A;  3MPX A;  3KRX A;  2L1C A;  2AEH A;  1Z87 A;  1ZM0 A;  1QQG A;  1FOE A;  4KHO A;  2UZR A;  1E5W A;  2VKI A;  5DI9 B; 
#chains in the Genus database with same CATH topology
 3PVU A;  2DHJ A;  3A98 B;  2D9W A;  3G9W A;  2I1K A;  2DA0 A;  1DDM A;  3M1I B;  1KZG A;  2Z14 A;  2MFQ A;  3ULB A;  2K2U A;  4B6H A;  4HDO A;  1GC6 A;  1ZSQ A;  1RJ2 A;  2I1J A;  1U2B A;  4CSQ A;  4HAT B;  2COD A;  3F5R A;  4C0A A;  4HB2 B;  3GYO A;  1NTY A;  2D11 A;  2ELB A;  2LOX A;  2KUP A;  1U27 A;  1U5G A;  3TFM A;  3DXC A;  1KI1 B;  1SHC A;  1U5D A;  5CLL B;  1MAI A;  1M7R A;  1PMS A;  3HSA A;  4EJN A;  5D27 A;  3WYF B;  5DH9 B;  1NI2 A;  3FSS A;  3GYP A;  2V76 A;  1EF1 A;  1ZVR A;  2YF0 A;  2YS5 A;  4L1R A;  1ZC3 B;  5D3Y A;  1SGH A;  3D8D A;  4QXA B;  2J0K A;  1XKE A;  1XX0 A;  1GG3 A;  2J0J A;  2MDX A;  1I2H A;  5JP4 A;  2Z0Q A;  2K49 A;  3CXB B;  1Q67 A;  3O96 A;  1WJ1 A;  2ZKM X;  4WVF B;  3HK0 A;  4TKN A;  4D6W A;  2QKM A;  3ML4 A;  3A8Q A;  2DFK A;  5D3W A;  2M14 A;  1NTV A;  2D10 A;  5DIF B;  2RNR B;  2EMS A;  2MKR A;  2RGN B;  2P0F A;  4OT1 A;  4GN1 A;  3FVC A;  2UZS A;  1PLS A;  4PNK A;  2KIE A;  4A6F B;  3IVF A;  4GZU A;  1MK7 B;  3A8P A;  2Z59 A;  4GOU A;  3DXE A;  4GXB A;  4K17 A;  1X1G A;  3T06 A;  2N23 A;  1WI1 A;  2I5F A;  1BTN A;  3ZVR A;  5IRS A;  1FAO A;  3F0W A;  1P5T A;  1P3R A;  2X18 A;  4CYE A;  4EKU A;  2VRW B;  1LW3 A;  1WG7 A;  1FHX A;  1BTK A;  2YRY A;  2KGX B;  3QWM A;  4HAY B;  1X11 A;  3LJU X;  3DCX A;  1MI1 A;  2JP2 A;  2CY4 A;  2IFS A;  4KHB B;  5GOW B;  3FEH A;  1UNQ A;  4WJ7 A;  2GUM A;  5CLQ B;  3PEG A;  2R09 A;  3NSU A;  3AU4 A;  1UPQ A;  2MWN B;  1UNR A;  2L2I A;  2LG1 A;  5HE1 A;  5FI1 A;  2W2W A;  4GMX B;  4L6E A;  1LB1 A;  1U29 A;  2IYB A;  4P7I A;  3PG7 A;  1PFJ A;  3SO6 A;  2GCJ A;  3FM8 C;  5C16 A;  3OHM B;  2D2Q A;  4OSN A;  5C5B A;  4NY0 A;  1FGZ A;  3SV1 A;  4HB3 B;  2K00 A;  1Y19 B;  2H7E A;  2M38 A;  5D3V A;  2Y8F A;  2Z0O A;  5J3Q A;  3HIE A;  3BIN A;  4HAV B;  4WSF A;  1AQC A;  2DLW A;  5LOP B;  2K8E A;  1MIZ B;  4A6K A;  3SNH A;  4HAU B;  1X05 A;  2OTX A;  1K5D B;  3HW2 B;  3KSY A;  5JHH A;  2Z4D A;  4ZRK A;  5FI0 A;  1UPR A;  1TQZ A;  2BCJ A;  1UNP A;  1DRO A;  4Z2M B;  1GC7 A;  3VIA A;  1J0W A;  2RSG A;  1U5F A;  5DHA B;  1ZC4 B;  2Q13 A;  2CAY A;  2W2X D;  4HDQ A;  4A5K A;  2Z0P A;  2YS1 A;  2YT2 A;  2R0D A;  2DHK A;  4HAX B;  2N0Y A;  2PZ1 A;  1OY2 A;  3PVW A;  3NW8 A;  3D8F A;  5EFX A;  3ULC A;  1X1F A;  2DYQ A;  2EC1 A;  4NSW A;  2COC A;  2D9V A;  2J0M A;  5KQ4 A;  2LUL A;  3SUZ A;  4MT7 A;  5KCV A;  4Y94 A;  2G35 A;  1V89 A;  2YT0 A;  2HE7 A;  4CHM A;  1N3H A;  2D9Z A;  3TVV A;  1EVH A;  1TXD A;  3DXD A;  2P0H A;  1U5E A;  4QJ4 B;  1ZYI A;  2P0D A;  1ISN A;  2CRF A;  1V5M A;  2YT1 A;  3AJ4 A;  1W1H A;  2EJ8 A;  2LYD A;  1Y5O A;  2Z13 A;  2NBV A;  3ODO A;  1OQN A;  3U12 A;  3V5W A;  3KZ1 A;  1WGQ A;  1T77 A;  1DDW A;  1NU2 A;  3RCP A;  1TJ6 A;  4CHJ A;  2AL6 A;  4HB4 B;  5LON B;  1WVH A;  2FJU B;  4IOY X;  5LG4 B;  2D9X A;  1W1D A;  3WA0 A;  5JHG A;  1MK9 B;  3TO1 A;  2GJY A;  3PVL A;  3NWF A;  2H7D A;  4ZRI A;  3PP2 A;  3U7D A;  1IRS A;  2P8V A;  5C5B B;  4HB0 B;  4D0N B;  1MKE A;  4EMO A;  2DYN A;  4XWX A;  1B55 A;  5D3X A;  1BWN A;  4TYZ A;  4A6H A;  4K81 A;  5I2S A;  2I5C A;  5KQ1 A;  2FJL A;  1RRP B;  2DHI A;  2NZ8 B;  4F7G A;  2ROZ B;  3HQC A;  3P6A A;  3B77 A;  4DIX A;  3TCA A;  2YS3 A;  2J59 M;  4KAX B;  2HTH B;  4MY6 A;  3KRW A;  4H8S A;  3P7Z A;  2UVM A;  1MPH A;  1H10 A;  1FB8 A;  3VOQ A;  2GS0 A;  4QJ5 B;  5JLJ B;  5HE0 A;  1DYN A;  4F7H A;  3SYX A;  4KVG B;  2NMB A;  1QC6 A;  3KY9 A;  3BJI A;  2COA A;  5M4Y B;  1FHW A;  5L81 A;  2QKL A;  2LKO A;  4IAP A;  2KUQ A;  1XD4 A;  1W1G A;  1V61 A;  2DX5 A;  2EMT A;  4DXA B;  2ZPY A;  4F7U P;  2ADZ A;  1MIX A;  1H4R A;  2DKP A;  3NWA A;  1FHO A;  2CY5 A;  1V5U A;  1UEF A;  3UZT A;  1WJM A;  4DBB A;  1EAZ A;  4HAZ B;  1P6S A;  5DHF B;  5J3Y A;  2ELA A;  5HE3 A;  1J19 A;  3PSC A;  4KHA A;  4HAW B;  1FGY A;  2YVC A;  2RRF A;  4DX9 0;  3U8Z A;  4DX8 A;  2DKQ A;  2DX1 A;  1DDV A;  2E2X A;  5C79 A;  2KCJ A;  2VSZ A;  4K2P A;  2W2X C;  2RLO A;  4K2O A;  3CIK A;  2Y7B A;  2XQN M;  2KIG A;  2ROV A;  3NWD A;  3MDB C;  4A6F A;  4HSI A;  1V88 A;  1WGU A;  1KZ7 A;  2K2J A;  3ODX A;  5J3T A;  2DTC A;  4GNK B;  5HE2 A;  2RVB B;  3PZD A;  4HHV A;  1DBH A;  3N7C A;  3ZDT A;  1K5G B;  1XR0 B;  2DN6 A;  4QJ3 B;  3QIJ A;  4IFS A;  1AWE A;  2RUK B;  4GMV A;  3TW1 A;  4GPT B;  1X86 A;  4PQ0 A;  4BBK A;  4YL8 A;  4YON A;  4KHB A;  2D4Q A;  1EGX A;  2YSZ A;  2LOZ A;  4MK0 A;  2Y8G A;  3AU5 A;  1M7E A;  3ODW A;  4Z2N A;  1V5P A;  3A58 A;  2COF A;  1XOD A;  3D8E A;  3OAN A;  2GCL A;  2R2Y A;  1OMW A;  1BAK A;  5C6R A;  5I2M A;  4ZRJ A;  2D9Y A;  3QBV B;  2OQB A;  3X23 A;  1I7A A;  1XCG A;  3MPX A;  3KRX A;  2L1C A;  2AEH A;  1Z87 A;  2KR0 A;  1ZM0 A;  1QQG A;  1FOE A;  4KHO A;  2UZR A;  1E5W A;  2VKI A;  5DI9 B; 
#chains in the Genus database with same CATH homology
 3PVU A;  2DHJ A;  3A98 B;  2D9W A;  3G9W A;  2I1K A;  2DA0 A;  1DDM A;  3M1I B;  1KZG A;  2MFQ A;  3ULB A;  2K2U A;  4B6H A;  4HDO A;  1GC6 A;  1ZSQ A;  1RJ2 A;  2I1J A;  1U2B A;  4HAT B;  2COD A;  3F5R A;  4C0A A;  4HB2 B;  3GYO A;  1NTY A;  2D11 A;  2ELB A;  2LOX A;  2KUP A;  1U27 A;  1U5G A;  3TFM A;  3DXC A;  1KI1 B;  1SHC A;  1U5D A;  5CLL B;  1MAI A;  1M7R A;  1PMS A;  4EJN A;  5D27 A;  3WYF B;  5DH9 B;  1NI2 A;  3FSS A;  3GYP A;  2V76 A;  1EF1 A;  1ZVR A;  2YF0 A;  2YS5 A;  1ZC3 B;  5D3Y A;  1SGH A;  3D8D A;  2J0K A;  1XKE A;  1XX0 A;  1GG3 A;  2J0J A;  2MDX A;  1I2H A;  5JP4 A;  2Z0Q A;  3CXB B;  1Q67 A;  3O96 A;  1WJ1 A;  4WVF B;  3HK0 A;  4TKN A;  2QKM A;  3ML4 A;  3A8Q A;  2DFK A;  5D3W A;  2M14 A;  1NTV A;  2D10 A;  5DIF B;  2RNR B;  2EMS A;  2MKR A;  2RGN B;  2P0F A;  4GN1 A;  2UZS A;  1PLS A;  4PNK A;  4A6F B;  3IVF A;  4GZU A;  1MK7 B;  3A8P A;  4GXB A;  3DXE A;  4K17 A;  1X1G A;  3T06 A;  2N23 A;  1WI1 A;  2I5F A;  1BTN A;  3ZVR A;  1FAO A;  3F0W A;  1P5T A;  1P3R A;  2X18 A;  4CYE A;  4EKU A;  2VRW B;  1LW3 A;  1WG7 A;  1FHX A;  1BTK A;  2YRY A;  2KGX B;  3QWM A;  4HAY B;  1X11 A;  3LJU X;  2JP2 A;  2CY4 A;  2IFS A;  4KHB B;  5GOW B;  3FEH A;  1UNQ A;  4WJ7 A;  5CLQ B;  3PEG A;  2R09 A;  3NSU A;  3AU4 A;  1UPQ A;  2MWN B;  1UNR A;  2L2I A;  2LG1 A;  5HE1 A;  5FI1 A;  2W2W A;  4GMX B;  4L6E A;  1LB1 A;  1U29 A;  2IYB A;  4P7I A;  3PG7 A;  1PFJ A;  3SO6 A;  2GCJ A;  3FM8 C;  5C16 A;  2D2Q A;  5C5B A;  4NY0 A;  1FGZ A;  3SV1 A;  4HB3 B;  2K00 A;  1Y19 B;  2H7E A;  2M38 A;  5D3V A;  2Y8F A;  2Z0O A;  5J3Q A;  3BIN A;  4HAV B;  4WSF A;  1AQC A;  2DLW A;  5LOP B;  1MIZ B;  4A6K A;  3SNH A;  4HAU B;  1X05 A;  2OTX A;  1K5D B;  3HW2 B;  3KSY A;  5JHH A;  4ZRK A;  5FI0 A;  1UPR A;  1TQZ A;  2BCJ A;  1UNP A;  1DRO A;  4Z2M B;  1GC7 A;  3VIA A;  1J0W A;  2RSG A;  1U5F A;  5DHA B;  1ZC4 B;  2Q13 A;  2CAY A;  2W2X D;  4HDQ A;  4A5K A;  2Z0P A;  2YS1 A;  2R0D A;  2DHK A;  4HAX B;  2N0Y A;  2PZ1 A;  1OY2 A;  3PVW A;  3D8F A;  5EFX A;  3ULC A;  1X1F A;  2DYQ A;  2EC1 A;  4NSW A;  2COC A;  2D9V A;  2J0M A;  5KQ4 A;  2LUL A;  3SUZ A;  4MT7 A;  5KCV A;  4Y94 A;  2G35 A;  1V89 A;  2YT0 A;  2HE7 A;  4CHM A;  1N3H A;  2D9Z A;  3TVV A;  1EVH A;  1TXD A;  3DXD A;  2P0H A;  1U5E A;  2P0D A;  1ISN A;  2CRF A;  1V5M A;  2YT1 A;  3AJ4 A;  1W1H A;  2EJ8 A;  2LYD A;  1Y5O A;  3ODO A;  1OQN A;  3V5W A;  3KZ1 A;  1WGQ A;  1DDW A;  1NU2 A;  3RCP A;  1TJ6 A;  4CHJ A;  2AL6 A;  4HB4 B;  5LON B;  1WVH A;  4IOY X;  2D9X A;  1W1D A;  3WA0 A;  5JHG A;  1MK9 B;  3TO1 A;  2GJY A;  3PVL A;  2H7D A;  4ZRI A;  3PP2 A;  3U7D A;  1IRS A;  2P8V A;  5C5B B;  4HB0 B;  4D0N B;  1MKE A;  4EMO A;  2DYN A;  4XWX A;  1B55 A;  5D3X A;  1BWN A;  4TYZ A;  4A6H A;  4K81 A;  2I5C A;  5KQ1 A;  2FJL A;  1RRP B;  2DHI A;  2NZ8 B;  4F7G A;  2ROZ B;  3HQC A;  3P6A A;  3TCA A;  2YS3 A;  2J59 M;  4KAX B;  2HTH B;  4MY6 A;  3KRW A;  4H8S A;  3P7Z A;  2UVM A;  1MPH A;  1H10 A;  1FB8 A;  3VOQ A;  2GS0 A;  5JLJ B;  5HE0 A;  1DYN A;  4F7H A;  3SYX A;  4KVG B;  2NMB A;  1QC6 A;  3KY9 A;  3BJI A;  2COA A;  1FHW A;  5L81 A;  2QKL A;  2LKO A;  4IAP A;  1XD4 A;  1W1G A;  1V61 A;  2DX5 A;  2EMT A;  4DXA B;  2ZPY A;  4F7U P;  2ADZ A;  1MIX A;  1H4R A;  2DKP A;  1FHO A;  2CY5 A;  1V5U A;  1UEF A;  3UZT A;  1WJM A;  4DBB A;  1EAZ A;  4HAZ B;  1P6S A;  5DHF B;  5J3Y A;  2ELA A;  5HE3 A;  1J19 A;  3PSC A;  4KHA A;  4HAW B;  1FGY A;  2YVC A;  4DX9 0;  3U8Z A;  4DX8 A;  2DKQ A;  2DX1 A;  1DDV A;  2E2X A;  5C79 A;  2KCJ A;  2VSZ A;  4K2P A;  2W2X C;  2RLO A;  4K2O A;  3CIK A;  2Y7B A;  2XQN M;  2ROV A;  3MDB C;  4A6F A;  1V88 A;  1WGU A;  1KZ7 A;  2K2J A;  3ODX A;  5J3T A;  2DTC A;  5HE2 A;  2RVB B;  3PZD A;  4HHV A;  1DBH A;  3N7C A;  3ZDT A;  1K5G B;  1XR0 B;  2DN6 A;  3QIJ A;  4IFS A;  1AWE A;  2RUK B;  4GMV A;  3TW1 A;  4GPT B;  1X86 A;  4PQ0 A;  4BBK A;  4YL8 A;  4YON A;  2D4Q A;  1EGX A;  2YSZ A;  2LOZ A;  4MK0 A;  2Y8G A;  3AU5 A;  1M7E A;  3ODW A;  4Z2N A;  1V5P A;  2COF A;  1XOD A;  3D8E A;  3OAN A;  2GCL A;  1OMW A;  1BAK A;  5C6R A;  4ZRJ A;  2D9Y A;  3QBV B;  2OQB A;  3X23 A;  1I7A A;  1XCG A;  3MPX A;  3KRX A;  2L1C A;  2AEH A;  1Z87 A;  1ZM0 A;  1QQG A;  1FOE A;  4KHO A;  2UZR A;  1E5W A;  2VKI A;  5DI9 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...