1BWNA

Ph domain and btk motif from bruton's tyrosine kinase mutant e41k in complex with ins(1,3,4,5)p4
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
169
structure length
166
Chain Sequence
AAVILESIFLKRSQQKKKTSPLNFKKRLFLLTVHKLSYYKYDFERGRRGSKKGSIDVEKITCVETVVPEKNPPPERQIPRRGSEMEQISIIERFPYPFQVVYDEGPLYVFSPTEELRKRWIHQLKNVIRYNSDLVQKYHPCFWIDGQYLCCSQTAKNAMGCQILEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the PH domain from Bruton's tyrosine kinase in complex with inositol 1,3,4,5-tetrakisphosphate.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords BRUTON'S TYROSINE KINASE
total genus 36
structure length 166
sequence length 169
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 1998-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
A PF00779 BTK BTK motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1bwnA00
5DH9B 3MDBC 2V76A 1OMWA 4XWXA 2NZ8B 1V5PA 2D9VA 3PSCA 5KCVA 2Y8FA 1I7AA 4IOYX 3KSYA 2YT0A 2L2IA 5D27A 5D3WA 3HK0A 2J0KA 4A5KA 1U5GA 2I1KA 4HAXB 1M7RA 1KI1B 2I5FA 3M1IB 1WGUA 1U2BA 1LW3A 1V5MA 3PVWA 4A6FA 2DHJA 1E5WA 4C0AA 4D0NB 3DXEA 1Q67A 1FHWA 1XODA 2HE7A 2DHKA 2DKPA 3NSUA 1H10A 4GZUA 2LG1A 5D3XA 5C5BB 4B6HA 2R0DA 3RCPA 2GCLA 3ODWA 5L81A 5LOPB 5J3TA 1MAIA 2AEHA 5JP4A 4HAWB 1EF1A 3D8EA 2DYQA 3N7CA 2DKQA 4K2PA 5C79A 4GMXB 5C6RA 1P6SA 1SGHA 1RJ2A 4CYEA 1MIXA 4HATB 5HE2A 3TW1A 2RGNB 3TVVA 5JHHA 2NMBA 4K2OA 3VIAA 4P7IA 2YF0A 1NI2A 4KAXB 2D9ZA 4GXBA 2D9WA 1EVHA 2RLOA 3KRWA 5CLQB 3O96A 1W1GA 5FI0A 3SUZA 1GC7A 2MWNB 1QQGA 1PMSA 5J3QA 4PNKA 2YSZA 4ZRKA 4MT7A 2EJ8A 1V5UA 3CXBB 4IFSA 1P5TA 2G35A 3U7DA 1U5DA 1PLSA 5LONB 2DLWA 1H4RA 2XQNM 4HAZB 3TCAA 4BBKA 3SNHA 1WJMA 1BTKA 4DBBA 2BCJA 2ELAA 4CHJA 5HE3A 2LULA 2YT1A 4WVFB 2P0FA 4H8SA 1AQCA 2DYNA 5HE1A 1Y19B 1WVHA 3ML4A 1XR0B 2GCJA 3BINA 5FI1A 1IRSA 4K17A 2MFQA 2RSGA 5EFXA 3SV1A 2DX1A 1J19A 2YS5A 1ZSQA 3A8QA 1X05A 2COCA 1U5FA 3PG7A 1UPQA 5J3YA 1X86A 3ULBA 3GYPA 3ODOA 4EKUA 3DXDA 5JLJB 4DX90 1FOEA 3FSSA 4IAPA 1MK9B 3FM8C 4EMOA 1B55A 2YVCA 1Y5OA 2GS0A 3F5RA 4DXAB 2W2XC 2H7EA 2J0JA 2YRYA 1U27A 2X18A 4F7GA 3IVFA 4A6HA 1QC6A 1BTNA 4MK0A 4KHBB 1V61A 2LYDA 2IYBA 2RUKB 3ULCA 2YS3A 3P6AA 2EMTA 4WJ7A 2IFSA 3QWMA 1DDMA 2ELBA 2M38A 2HTHB 2MDXA 4MY6A 2ROVA 1DDWA 4Z2NA 2FJLA 1DROA 4HAUB 1MKEA 1NU2A 2ROZB 2Q13A 2D9YA 2P0DA 1WJ1A 4HDQA 3D8DA 1MPHA 4HB0B 3A8PA 1V89A 1RRPB 3MPXA 2LKOA 1AWEA 4ZRJA 2Z0OA 2DTCA 3ODXA 2D11A 2CODA 2Y7BA 1SHCA 2N23A 1K5DB 1LB1A 1WG7A 1KZGA 1KZ7A 2E2XA 4NY0A 3V5WA 2PZ1A 3KZ1A 4DX8A 2ZPYA 4TYZA 2OQBA 1WI1A 1ZVRA 1NTVA 1XCGA 3U8ZA 5D3YA 3T06A 2DA0A 2D2QA 3OANA 1UEFA 3DXCA 2KUPA 3UZTA 4Y94A 1UNPA 1FGZA 1GC6A 2D10A 2DFKA 1UNRA 1Z87A 2EMSA 1M7EA 1U5EA 1DYNA 1FAOA 1DDVA 2VKIA 1TJ6A 3VOQA 4HB2B 3ZVRA 3TFMA 1BAKA 4GPTB 4EJNA 3G9WA 1XKEA 3WYFB 4CHMA 1ISNA 2COAA 2W2WA 2DHIA 1V88A 2ADZA 3SO6A 3PVUA 1EGXA 1OQNA 2K00A 2QKLA 2RNRB 3P7ZA 4HAYB 4HB4B 2YS1A 3PZDA 3AU5A 1X11A 2J59M 3A98B 4YONA 2Y8GA 5C16A 2OTXA 4A6KA 3AU4A 2N0YA 1FHOA 2M14A 2UZSA 2CY4A 3SYXA 1FHXA 3PVLA 1J0WA 2VSZA 1XD4A 1W1DA 4PQ0A 3KY9A 5GOWB 1WGQA 2DX5A 1OY2A 2MKRA 1U29A 1X1FA 2LOZA 2UZRA 1ZC4B 2Z0QA 2GJYA 3QBVB 3F0WA 3PEGA 5JHGA 2CRFA 1GG3A 2DN6A 1UNQA 5KQ4A 2CAYA 1N3HA 3KRXA 2R09A 2I1JA 1MIZB 3GYOA 5DHAB 4KVGB 5HE0A 1TQZA 2COFA 1FGYA 3QIJA 1MK7B 4KHOA 2J0MA 2RVBB 2I5CA 1BWNA 1TXDA 3HW2B 2W2XD 2LOXA 4GN1A 3BJIA 3TO1A 3D8FA 4HHVA 1ZM0A 4HB3B 1UPRA 5DI9B 1K5GB 4F7UP 2K2JA 4HDOA 2CY5A 2KGXB 4A6FB 2QKMA 2P0HA 1I2HA 2D4QA 2L1CA 4YL8A 2AL6A 2D9XA 4Z2MB 2VRWB 5KQ1A 5DHFB 3WA0A 1FB8A 4F7HA 1EAZA 4L6EA 4K81A 5CLLB 5DIFB 1X1GA 2H7DA 5D3VA 2K2UA 1XX0A 1P3RA 2Z0PA 2EC1A 3FEHA 3LJUX 4TKNA 3X23A 1NTYA 1PFJA 3ZDTA 4GMVA 5C5BA 1DBHA 3HQCA 1W1HA 2JP2A 4NSWA 3PP2A 2P8VA 4HAVB 2UVMA 3CIKA 4ZRIA 4KHAA 4WSFA 2KCJA 1ZC3B 3AJ4A
chains in the Genus database with same CATH superfamily
5DH9B 3MDBC 2V76A 1OMWA 4XWXA 2NZ8B 1V5PA 2D9VA 3PSCA 5KCVA 2Y8FA 1I7AA 4IOYX 3KSYA 2YT0A 2L2IA 5D27A 5D3WA 3HK0A 2J0KA 4A5KA 1U5GA 2I1KA 4HAXB 1M7RA 1KI1B 2I5FA 3M1IB 1WGUA 1U2BA 1LW3A 1V5MA 3PVWA 4A6FA 2DHJA 1E5WA 4C0AA 4D0NB 3DXEA 1Q67A 1FHWA 1XODA 2HE7A 2DHKA 2DKPA 3NSUA 1H10A 4GZUA 2LG1A 5D3XA 5C5BB 4B6HA 5LG4B 2R0DA 3RCPA 3OHMB 2GCLA 3ODWA 3A58A 5L81A 5LOPB 5J3TA 1MAIA 2AEHA 5JP4A 4HAWB 1EF1A 4HSIA 3D8EA 2DYQA 3N7CA 2DKQA 4K2PA 5C79A 4GMXB 5C6RA 1P6SA 2Z13A 1SGHA 1RJ2A 4CYEA 1MIXA 4HATB 5HE2A 3TW1A 2RGNB 3HSAA 3TVVA 5JHHA 2NMBA 4K2OA 3VIAA 4P7IA 2YF0A 1NI2A 4KAXB 4OSNA 2D9ZA 4GXBA 2D9WA 1T77A 1EVHA 2RLOA 3KRWA 4D6WA 5CLQB 3O96A 1W1GA 5FI0A 3SUZA 1GC7A 2MWNB 3FVCA 1QQGA 1PMSA 5J3QA 5I2SA 4PNKA 2YSZA 4ZRKA 4MT7A 2EJ8A 1V5UA 3CXBB 4IFSA 1P5TA 2G35A 3U7DA 1U5DA 1PLSA 5LONB 2DLWA 1H4RA 2XQNM 4HAZB 5I2MA 3TCAA 3SNHA 4BBKA 1WJMA 5M4YB 1BTKA 4DBBA 2BCJA 2ELAA 1MI1A 4CHJA 5HE3A 2LULA 2YT1A 4WVFB 4CSQA 2RRFA 2P0FA 4H8SA 2NBVA 1AQCA 2DYNA 5HE1A 1Y19B 1WVHA 3ML4A 1XR0B 2GCJA 3BINA 5FI1A 1IRSA 4K17A 2MFQA 2RSGA 5EFXA 3SV1A 2DX1A 1J19A 2YS5A 2Z14A 1ZSQA 3A8QA 1X05A 2COCA 1U5FA 3PG7A 1UPQA 3NWDA 5J3YA 2YT2A 1X86A 3ULBA 3GYPA 3ODOA 4EKUA 3DXDA 4OT1A 2Z4DA 5JLJB 4DX90 1FOEA 3FSSA 4IAPA 1MK9B 3FM8C 4EMOA 3NW8A 1B55A 3NWAA 2YVCA 1Y5OA 2GS0A 2K8EA 3F5RA 4DXAB 4QJ3B 2W2XC 2H7EA 2J0JA 2YRYA 1U27A 2X18A 3HIEA 4F7GA 3IVFA 4A6HA 1QC6A 1BTNA 3NWFA 4MK0A 2K49A 4KHBB 1V61A 2LYDA 2IYBA 2RUKB 3ULCA 2YS3A 3P6AA 2EMTA 4WJ7A 2IFSA 3QWMA 1DDMA 2ELBA 2M38A 2HTHB 2MDXA 4DIXA 4MY6A 2ROVA 1DDWA 4Z2NA 4GNKB 2FJLA 1DROA 4HAUB 1MKEA 1NU2A 2ROZB 2Q13A 2D9YA 2P0DA 1WJ1A 4HDQA 3D8DA 1MPHA 4HB0B 3A8PA 4L1RA 1V89A 1RRPB 3MPXA 2LKOA 1AWEA 4ZRJA 2Z0OA 2DTCA 3ODXA 2D11A 2CODA 2Y7BA 1SHCA 2N23A 1K5DB 1LB1A 1WG7A 1KZGA 1KZ7A 2E2XA 4NY0A 3V5WA 2PZ1A 3KZ1A 4DX8A 2ZPYA 4TYZA 2OQBA 1WI1A 1ZVRA 1NTVA 1XCGA 3U8ZA 4QJ5B 5D3YA 3T06A 2DA0A 2D2QA 3OANA 1UEFA 3DXCA 2KUPA 3UZTA 4Y94A 4QJ4B 1UNPA 1FGZA 1GC6A 2D10A 2DFKA 1UNRA 1Z87A 2EMSA 1M7EA 1U5EA 1DYNA 1FAOA 1DDVA 2VKIA 1TJ6A 3VOQA 4HB2B 3ZVRA 3TFMA 1BAKA 4GPTB 4EJNA 3G9WA 1XKEA 3WYFB 4CHMA 1ISNA 2COAA 2W2WA 2DHIA 1V88A 2ADZA 3SO6A 3PVUA 1EGXA 1OQNA 3U12A 2K00A 2QKLA 2RNRB 4QXAB 3P7ZA 4HAYB 4HB4B 2YS1A 3PZDA 3AU5A 1X11A 2J59M 2KR0A 3A98B 4YONA 2Y8GA 5C16A 2OTXA 4A6KA 3AU4A 2N0YA 1FHOA 2M14A 2UZSA 2CY4A 3SYXA 2KIEA 1FHXA 3PVLA 1J0WA 2VSZA 1XD4A 1W1DA 4PQ0A 3KY9A 5GOWB 1WGQA 2DX5A 1OY2A 2MKRA 1U29A 1X1FA 2LOZA 2UZRA 1ZC4B 2Z0QA 2GJYA 3QBVB 3F0WA 3PEGA 5JHGA 2CRFA 1GG3A 2DN6A 1UNQA 5KQ4A 2GUMA 2CAYA 1N3HA 3KRXA 2R09A 2I1JA 1MIZB 3GYOA 2KUQA 2FJUB 5DHAB 4KVGB 5HE0A 1TQZA 2COFA 1FGYA 3QIJA 1MK7B 4KHOA 2J0MA 2RVBB 2I5CA 1BWNA 1TXDA 3HW2B 2W2XD 2LOXA 4GN1A 3DCXA 3BJIA 3TO1A 3D8FA 4HHVA 1ZM0A 2KIGA 1ZYIA 4HB3B 1UPRA 5DI9B 1K5GB 4F7UP 2K2JA 4HDOA 2CY5A 2KGXB 4A6FB 2QKMA 2P0HA 1I2HA 4GOUA 2D4QA 2L1CA 4YL8A 2AL6A 2D9XA 3B77A 4Z2MB 2VRWB 5KQ1A 5DHFB 3WA0A 1FB8A 4F7HA 1EAZA 4L6EA 4K81A 5CLLB 5DIFB 1X1GA 2H7DA 5D3VA 2K2UA 1XX0A 1P3RA 2Z0PA 2EC1A 3FEHA 3LJUX 4TKNA 3X23A 1NTYA 1PFJA 5IRSA 3ZDTA 4GMVA 2ZKMX 5C5BA 1DBHA 3HQCA 1W1HA 2JP2A 4NSWA 3PP2A 2R2YA 2Z59A 2P8VA 4HAVB 2UVMA 3CIKA 4ZRIA 4KHAA 4WSFA 4KHBA 2KCJA 1ZC3B 3AJ4A
chains in the Genus database with same CATH topology
5DH9B 3MDBC 2V76A 1OMWA 4XWXA 2NZ8B 1V5PA 2D9VA 3PSCA 5KCVA 2Y8FA 1I7AA 4IOYX 3KSYA 2YT0A 2L2IA 5D27A 5D3WA 3HK0A 2J0KA 4A5KA 1U5GA 2I1KA 4HAXB 1M7RA 1KI1B 2I5FA 3M1IB 1WGUA 1U2BA 1LW3A 1V5MA 3PVWA 4A6FA 2DHJA 1E5WA 4C0AA 4D0NB 3DXEA 1Q67A 1FHWA 1XODA 2HE7A 2DHKA 2DKPA 3NSUA 1H10A 4GZUA 2LG1A 5D3XA 5C5BB 4B6HA 2R0DA 3RCPA 2GCLA 3ODWA 5L81A 5LOPB 5J3TA 1MAIA 2AEHA 5JP4A 4HAWB 1EF1A 3D8EA 2DYQA 3N7CA 2DKQA 4K2PA 5C79A 4GMXB 5C6RA 1P6SA 1SGHA 1RJ2A 4CYEA 1MIXA 4HATB 5HE2A 3TW1A 2RGNB 3TVVA 5JHHA 2NMBA 4K2OA 3VIAA 4P7IA 2YF0A 1NI2A 4KAXB 2D9ZA 4GXBA 2D9WA 1EVHA 2RLOA 3KRWA 5CLQB 3O96A 1W1GA 5FI0A 3SUZA 1GC7A 2MWNB 1QQGA 1PMSA 5J3QA 4PNKA 2YSZA 4ZRKA 4MT7A 2EJ8A 1V5UA 3CXBB 4IFSA 1P5TA 2G35A 3U7DA 1U5DA 1PLSA 5LONB 2DLWA 1H4RA 2XQNM 4HAZB 3TCAA 4BBKA 3SNHA 1WJMA 1BTKA 4DBBA 2BCJA 2ELAA 4CHJA 5HE3A 2LULA 2YT1A 4WVFB 2P0FA 4H8SA 1AQCA 2DYNA 5HE1A 1Y19B 1WVHA 3ML4A 1XR0B 2GCJA 3BINA 5FI1A 1IRSA 4K17A 2MFQA 2RSGA 5EFXA 3SV1A 2DX1A 1J19A 2YS5A 1ZSQA 3A8QA 1X05A 2COCA 1U5FA 3PG7A 1UPQA 5J3YA 1X86A 3ULBA 3GYPA 3ODOA 4EKUA 3DXDA 5JLJB 4DX90 1FOEA 3FSSA 4IAPA 1MK9B 3FM8C 4EMOA 1B55A 2YVCA 1Y5OA 2GS0A 3F5RA 4DXAB 2W2XC 2H7EA 2J0JA 2YRYA 1U27A 2X18A 4F7GA 3IVFA 4A6HA 1QC6A 1BTNA 4MK0A 4KHBB 1V61A 2LYDA 2IYBA 2RUKB 3ULCA 2YS3A 3P6AA 2EMTA 4WJ7A 2IFSA 3QWMA 1DDMA 2ELBA 2M38A 2HTHB 2MDXA 4MY6A 2ROVA 1DDWA 4Z2NA 2FJLA 1DROA 4HAUB 1MKEA 1NU2A 2ROZB 2Q13A 2D9YA 2P0DA 1WJ1A 4HDQA 3D8DA 1MPHA 4HB0B 3A8PA 1V89A 1RRPB 3MPXA 2LKOA 1AWEA 4ZRJA 2Z0OA 2DTCA 3ODXA 2D11A 2CODA 2Y7BA 1SHCA 2N23A 1K5DB 1LB1A 1WG7A 1KZGA 1KZ7A 2E2XA 4NY0A 3V5WA 2PZ1A 3KZ1A 4DX8A 2ZPYA 4TYZA 2OQBA 1WI1A 1ZVRA 1NTVA 1XCGA 3U8ZA 5D3YA 3T06A 2DA0A 2D2QA 3OANA 1UEFA 3DXCA 2KUPA 3UZTA 4Y94A 1UNPA 1FGZA 1GC6A 2D10A 2DFKA 1UNRA 1Z87A 2EMSA 1M7EA 1U5EA 1DYNA 1FAOA 1DDVA 2VKIA 1TJ6A 3VOQA 4HB2B 3ZVRA 3TFMA 1BAKA 4GPTB 4EJNA 3G9WA 1XKEA 3WYFB 4CHMA 1ISNA 2COAA 2W2WA 2DHIA 1V88A 2ADZA 3SO6A 3PVUA 1EGXA 1OQNA 2K00A 2QKLA 2RNRB 3P7ZA 4HAYB 4HB4B 2YS1A 3PZDA 3AU5A 1X11A 2J59M 3A98B 4YONA 2Y8GA 5C16A 2OTXA 4A6KA 3AU4A 2N0YA 1FHOA 2M14A 2UZSA 2CY4A 3SYXA 1FHXA 3PVLA 1J0WA 2VSZA 1XD4A 1W1DA 4PQ0A 3KY9A 5GOWB 1WGQA 2DX5A 1OY2A 2MKRA 1U29A 1X1FA 2LOZA 2UZRA 1ZC4B 2Z0QA 2GJYA 3QBVB 3F0WA 3PEGA 5JHGA 2CRFA 1GG3A 2DN6A 1UNQA 5KQ4A 2CAYA 1N3HA 3KRXA 2R09A 2I1JA 1MIZB 3GYOA 5DHAB 4KVGB 5HE0A 1TQZA 2COFA 1FGYA 3QIJA 1MK7B 4KHOA 2J0MA 2RVBB 2I5CA 1BWNA 1TXDA 3HW2B 2W2XD 2LOXA 4GN1A 3BJIA 3TO1A 3D8FA 4HHVA 1ZM0A 4HB3B 1UPRA 5DI9B 1K5GB 4F7UP 2K2JA 4HDOA 2CY5A 2KGXB 4A6FB 2QKMA 2P0HA 1I2HA 2D4QA 2L1CA 4YL8A 2AL6A 2D9XA 4Z2MB 2VRWB 5KQ1A 5DHFB 3WA0A 1FB8A 4F7HA 1EAZA 4L6EA 4K81A 5CLLB 5DIFB 1X1GA 2H7DA 5D3VA 2K2UA 1XX0A 1P3RA 2Z0PA 2EC1A 3FEHA 3LJUX 4TKNA 3X23A 1NTYA 1PFJA 3ZDTA 4GMVA 5C5BA 1DBHA 3HQCA 1W1HA 2JP2A 4NSWA 3PP2A 2P8VA 4HAVB 2UVMA 3CIKA 4ZRIA 4KHAA 4WSFA 2KCJA 1ZC3B 3AJ4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DH9 B;  3MDB C;  2V76 A;  1OMW A;  4XWX A;  2NZ8 B;  1V5P A;  2D9V A;  3PSC A;  5KCV A;  2Y8F A;  1I7A A;  4IOY X;  3KSY A;  2YT0 A;  2L2I A;  5D27 A;  5D3W A;  3HK0 A;  2J0K A;  4A5K A;  1U5G A;  2I1K A;  4HAX B;  1M7R A;  1KI1 B;  2I5F A;  3M1I B;  1WGU A;  1U2B A;  1LW3 A;  1V5M A;  3PVW A;  4A6F A;  2DHJ A;  1E5W A;  4C0A A;  4D0N B;  3DXE A;  1Q67 A;  1FHW A;  1XOD A;  2HE7 A;  2DHK A;  2DKP A;  3NSU A;  1H10 A;  4GZU A;  2LG1 A;  5D3X A;  5C5B B;  4B6H A;  2R0D A;  3RCP A;  2GCL A;  3ODW A;  5L81 A;  5LOP B;  5J3T A;  1MAI A;  2AEH A;  5JP4 A;  4HAW B;  1EF1 A;  3D8E A;  2DYQ A;  3N7C A;  2DKQ A;  4K2P A;  5C79 A;  4GMX B;  5C6R A;  1P6S A;  1SGH A;  1RJ2 A;  4CYE A;  1MIX A;  4HAT B;  5HE2 A;  3TW1 A;  2RGN B;  3TVV A;  5JHH A;  2NMB A;  4K2O A;  3VIA A;  4P7I A;  2YF0 A;  1NI2 A;  4KAX B;  2D9Z A;  4GXB A;  2D9W A;  1EVH A;  2RLO A;  3KRW A;  5CLQ B;  3O96 A;  1W1G A;  5FI0 A;  3SUZ A;  1GC7 A;  2MWN B;  1QQG A;  1PMS A;  5J3Q A;  4PNK A;  2YSZ A;  4ZRK A;  4MT7 A;  2EJ8 A;  1V5U A;  3CXB B;  4IFS A;  1P5T A;  2G35 A;  3U7D A;  1U5D A;  1PLS A;  5LON B;  2DLW A;  1H4R A;  2XQN M;  4HAZ B;  3TCA A;  4BBK A;  3SNH A;  1WJM A;  1BTK A;  4DBB A;  2BCJ A;  2ELA A;  4CHJ A;  5HE3 A;  2LUL A;  2YT1 A;  4WVF B;  2P0F A;  4H8S A;  1AQC A;  2DYN A;  5HE1 A;  1Y19 B;  1WVH A;  3ML4 A;  1XR0 B;  2GCJ A;  3BIN A;  5FI1 A;  1IRS A;  4K17 A;  2MFQ A;  2RSG A;  5EFX A;  3SV1 A;  2DX1 A;  1J19 A;  2YS5 A;  1ZSQ A;  3A8Q A;  1X05 A;  2COC A;  1U5F A;  3PG7 A;  1UPQ A;  5J3Y A;  1X86 A;  3ULB A;  3GYP A;  3ODO A;  4EKU A;  3DXD A;  5JLJ B;  4DX9 0;  1FOE A;  3FSS A;  4IAP A;  1MK9 B;  3FM8 C;  4EMO A;  1B55 A;  2YVC A;  1Y5O A;  2GS0 A;  3F5R A;  4DXA B;  2W2X C;  2H7E A;  2J0J A;  2YRY A;  1U27 A;  2X18 A;  4F7G A;  3IVF A;  4A6H A;  1QC6 A;  1BTN A;  4MK0 A;  4KHB B;  1V61 A;  2LYD A;  2IYB A;  2RUK B;  3ULC A;  2YS3 A;  3P6A A;  2EMT A;  4WJ7 A;  2IFS A;  3QWM A;  1DDM A;  2ELB A;  2M38 A;  2HTH B;  2MDX A;  4MY6 A;  2ROV A;  1DDW A;  4Z2N A;  2FJL A;  1DRO A;  4HAU B;  1MKE A;  1NU2 A;  2ROZ B;  2Q13 A;  2D9Y A;  2P0D A;  1WJ1 A;  4HDQ A;  3D8D A;  1MPH A;  4HB0 B;  3A8P A;  1V89 A;  1RRP B;  3MPX A;  2LKO A;  1AWE A;  4ZRJ A;  2Z0O A;  2DTC A;  3ODX A;  2D11 A;  2COD A;  2Y7B A;  1SHC A;  2N23 A;  1K5D B;  1LB1 A;  1WG7 A;  1KZG A;  1KZ7 A;  2E2X A;  4NY0 A;  3V5W A;  2PZ1 A;  3KZ1 A;  4DX8 A;  2ZPY A;  4TYZ A;  2OQB A;  1WI1 A;  1ZVR A;  1NTV A;  1XCG A;  3U8Z A;  5D3Y A;  3T06 A;  2DA0 A;  2D2Q A;  3OAN A;  1UEF A;  3DXC A;  2KUP A;  3UZT A;  4Y94 A;  1UNP A;  1FGZ A;  1GC6 A;  2D10 A;  2DFK A;  1UNR A;  1Z87 A;  2EMS A;  1M7E A;  1U5E A;  1DYN A;  1FAO A;  1DDV A;  2VKI A;  1TJ6 A;  3VOQ A;  4HB2 B;  3ZVR A;  3TFM A;  1BAK A;  4GPT B;  4EJN A;  3G9W A;  1XKE A;  3WYF B;  4CHM A;  1ISN A;  2COA A;  2W2W A;  2DHI A;  1V88 A;  2ADZ A;  3SO6 A;  3PVU A;  1EGX A;  1OQN A;  2K00 A;  2QKL A;  2RNR B;  3P7Z A;  4HAY B;  4HB4 B;  2YS1 A;  3PZD A;  3AU5 A;  1X11 A;  2J59 M;  3A98 B;  4YON A;  2Y8G A;  5C16 A;  2OTX A;  4A6K A;  3AU4 A;  2N0Y A;  1FHO A;  2M14 A;  2UZS A;  2CY4 A;  3SYX A;  1FHX A;  3PVL A;  1J0W A;  2VSZ A;  1XD4 A;  1W1D A;  4PQ0 A;  3KY9 A;  5GOW B;  1WGQ A;  2DX5 A;  1OY2 A;  2MKR A;  1U29 A;  1X1F A;  2LOZ A;  2UZR A;  1ZC4 B;  2Z0Q A;  2GJY A;  3QBV B;  3F0W A;  3PEG A;  5JHG A;  2CRF A;  1GG3 A;  2DN6 A;  1UNQ A;  5KQ4 A;  2CAY A;  1N3H A;  3KRX A;  2R09 A;  2I1J A;  1MIZ B;  3GYO A;  5DHA B;  4KVG B;  5HE0 A;  1TQZ A;  2COF A;  1FGY A;  3QIJ A;  1MK7 B;  4KHO A;  2J0M A;  2RVB B;  2I5C A;  1BWN A;  1TXD A;  3HW2 B;  2W2X D;  2LOX A;  4GN1 A;  3BJI A;  3TO1 A;  3D8F A;  4HHV A;  1ZM0 A;  4HB3 B;  1UPR A;  5DI9 B;  1K5G B;  4F7U P;  2K2J A;  4HDO A;  2CY5 A;  2KGX B;  4A6F B;  2QKM A;  2P0H A;  1I2H A;  2D4Q A;  2L1C A;  4YL8 A;  2AL6 A;  2D9X A;  4Z2M B;  2VRW B;  5KQ1 A;  5DHF B;  3WA0 A;  1FB8 A;  4F7H A;  1EAZ A;  4L6E A;  4K81 A;  5CLL B;  5DIF B;  1X1G A;  2H7D A;  5D3V A;  2K2U A;  1XX0 A;  1P3R A;  2Z0P A;  2EC1 A;  3FEH A;  3LJU X;  4TKN A;  3X23 A;  1NTY A;  1PFJ A;  3ZDT A;  4GMV A;  5C5B A;  1DBH A;  3HQC A;  1W1H A;  2JP2 A;  4NSW A;  3PP2 A;  2P8V A;  4HAV B;  2UVM A;  3CIK A;  4ZRI A;  4KHA A;  4WSF A;  2KCJ A;  1ZC3 B;  3AJ4 A; 
#chains in the Genus database with same CATH topology
 5DH9 B;  3MDB C;  2V76 A;  1OMW A;  4XWX A;  2NZ8 B;  1V5P A;  2D9V A;  3PSC A;  5KCV A;  2Y8F A;  1I7A A;  4IOY X;  3KSY A;  2YT0 A;  2L2I A;  5D27 A;  5D3W A;  3HK0 A;  2J0K A;  4A5K A;  1U5G A;  2I1K A;  4HAX B;  1M7R A;  1KI1 B;  2I5F A;  3M1I B;  1WGU A;  1U2B A;  1LW3 A;  1V5M A;  3PVW A;  4A6F A;  2DHJ A;  1E5W A;  4C0A A;  4D0N B;  3DXE A;  1Q67 A;  1FHW A;  1XOD A;  2HE7 A;  2DHK A;  2DKP A;  3NSU A;  1H10 A;  4GZU A;  2LG1 A;  5D3X A;  5C5B B;  4B6H A;  5LG4 B;  2R0D A;  3RCP A;  3OHM B;  2GCL A;  3ODW A;  3A58 A;  5L81 A;  5LOP B;  5J3T A;  1MAI A;  2AEH A;  5JP4 A;  4HAW B;  1EF1 A;  4HSI A;  3D8E A;  2DYQ A;  3N7C A;  2DKQ A;  4K2P A;  5C79 A;  4GMX B;  5C6R A;  1P6S A;  2Z13 A;  1SGH A;  1RJ2 A;  4CYE A;  1MIX A;  4HAT B;  5HE2 A;  3TW1 A;  2RGN B;  3HSA A;  3TVV A;  5JHH A;  2NMB A;  4K2O A;  3VIA A;  4P7I A;  2YF0 A;  1NI2 A;  4KAX B;  4OSN A;  2D9Z A;  4GXB A;  2D9W A;  1T77 A;  1EVH A;  2RLO A;  3KRW A;  4D6W A;  5CLQ B;  3O96 A;  1W1G A;  5FI0 A;  3SUZ A;  1GC7 A;  2MWN B;  3FVC A;  1QQG A;  1PMS A;  5J3Q A;  5I2S A;  4PNK A;  2YSZ A;  4ZRK A;  4MT7 A;  2EJ8 A;  1V5U A;  3CXB B;  4IFS A;  1P5T A;  2G35 A;  3U7D A;  1U5D A;  1PLS A;  5LON B;  2DLW A;  1H4R A;  2XQN M;  4HAZ B;  5I2M A;  3TCA A;  3SNH A;  4BBK A;  1WJM A;  5M4Y B;  1BTK A;  4DBB A;  2BCJ A;  2ELA A;  1MI1 A;  4CHJ A;  5HE3 A;  2LUL A;  2YT1 A;  4WVF B;  4CSQ A;  2RRF A;  2P0F A;  4H8S A;  2NBV A;  1AQC A;  2DYN A;  5HE1 A;  1Y19 B;  1WVH A;  3ML4 A;  1XR0 B;  2GCJ A;  3BIN A;  5FI1 A;  1IRS A;  4K17 A;  2MFQ A;  2RSG A;  5EFX A;  3SV1 A;  2DX1 A;  1J19 A;  2YS5 A;  2Z14 A;  1ZSQ A;  3A8Q A;  1X05 A;  2COC A;  1U5F A;  3PG7 A;  1UPQ A;  3NWD A;  5J3Y A;  2YT2 A;  1X86 A;  3ULB A;  3GYP A;  3ODO A;  4EKU A;  3DXD A;  4OT1 A;  2Z4D A;  5JLJ B;  4DX9 0;  1FOE A;  3FSS A;  4IAP A;  1MK9 B;  3FM8 C;  4EMO A;  3NW8 A;  1B55 A;  3NWA A;  2YVC A;  1Y5O A;  2GS0 A;  2K8E A;  3F5R A;  4DXA B;  4QJ3 B;  2W2X C;  2H7E A;  2J0J A;  2YRY A;  1U27 A;  2X18 A;  3HIE A;  4F7G A;  3IVF A;  4A6H A;  1QC6 A;  1BTN A;  3NWF A;  4MK0 A;  2K49 A;  4KHB B;  1V61 A;  2LYD A;  2IYB A;  2RUK B;  3ULC A;  2YS3 A;  3P6A A;  2EMT A;  4WJ7 A;  2IFS A;  3QWM A;  1DDM A;  2ELB A;  2M38 A;  2HTH B;  2MDX A;  4DIX A;  4MY6 A;  2ROV A;  1DDW A;  4Z2N A;  4GNK B;  2FJL A;  1DRO A;  4HAU B;  1MKE A;  1NU2 A;  2ROZ B;  2Q13 A;  2D9Y A;  2P0D A;  1WJ1 A;  4HDQ A;  3D8D A;  1MPH A;  4HB0 B;  3A8P A;  4L1R A;  1V89 A;  1RRP B;  3MPX A;  2LKO A;  1AWE A;  4ZRJ A;  2Z0O A;  2DTC A;  3ODX A;  2D11 A;  2COD A;  2Y7B A;  1SHC A;  2N23 A;  1K5D B;  1LB1 A;  1WG7 A;  1KZG A;  1KZ7 A;  2E2X A;  4NY0 A;  3V5W A;  2PZ1 A;  3KZ1 A;  4DX8 A;  2ZPY A;  4TYZ A;  2OQB A;  1WI1 A;  1ZVR A;  1NTV A;  1XCG A;  3U8Z A;  4QJ5 B;  5D3Y A;  3T06 A;  2DA0 A;  2D2Q A;  3OAN A;  1UEF A;  3DXC A;  2KUP A;  3UZT A;  4Y94 A;  4QJ4 B;  1UNP A;  1FGZ A;  1GC6 A;  2D10 A;  2DFK A;  1UNR A;  1Z87 A;  2EMS A;  1M7E A;  1U5E A;  1DYN A;  1FAO A;  1DDV A;  2VKI A;  1TJ6 A;  3VOQ A;  4HB2 B;  3ZVR A;  3TFM A;  1BAK A;  4GPT B;  4EJN A;  3G9W A;  1XKE A;  3WYF B;  4CHM A;  1ISN A;  2COA A;  2W2W A;  2DHI A;  1V88 A;  2ADZ A;  3SO6 A;  3PVU A;  1EGX A;  1OQN A;  3U12 A;  2K00 A;  2QKL A;  2RNR B;  4QXA B;  3P7Z A;  4HAY B;  4HB4 B;  2YS1 A;  3PZD A;  3AU5 A;  1X11 A;  2J59 M;  2KR0 A;  3A98 B;  4YON A;  2Y8G A;  5C16 A;  2OTX A;  4A6K A;  3AU4 A;  2N0Y A;  1FHO A;  2M14 A;  2UZS A;  2CY4 A;  3SYX A;  2KIE A;  1FHX A;  3PVL A;  1J0W A;  2VSZ A;  1XD4 A;  1W1D A;  4PQ0 A;  3KY9 A;  5GOW B;  1WGQ A;  2DX5 A;  1OY2 A;  2MKR A;  1U29 A;  1X1F A;  2LOZ A;  2UZR A;  1ZC4 B;  2Z0Q A;  2GJY A;  3QBV B;  3F0W A;  3PEG A;  5JHG A;  2CRF A;  1GG3 A;  2DN6 A;  1UNQ A;  5KQ4 A;  2GUM A;  2CAY A;  1N3H A;  3KRX A;  2R09 A;  2I1J A;  1MIZ B;  3GYO A;  2KUQ A;  2FJU B;  5DHA B;  4KVG B;  5HE0 A;  1TQZ A;  2COF A;  1FGY A;  3QIJ A;  1MK7 B;  4KHO A;  2J0M A;  2RVB B;  2I5C A;  1BWN A;  1TXD A;  3HW2 B;  2W2X D;  2LOX A;  4GN1 A;  3DCX A;  3BJI A;  3TO1 A;  3D8F A;  4HHV A;  1ZM0 A;  2KIG A;  1ZYI A;  4HB3 B;  1UPR A;  5DI9 B;  1K5G B;  4F7U P;  2K2J A;  4HDO A;  2CY5 A;  2KGX B;  4A6F B;  2QKM A;  2P0H A;  1I2H A;  4GOU A;  2D4Q A;  2L1C A;  4YL8 A;  2AL6 A;  2D9X A;  3B77 A;  4Z2M B;  2VRW B;  5KQ1 A;  5DHF B;  3WA0 A;  1FB8 A;  4F7H A;  1EAZ A;  4L6E A;  4K81 A;  5CLL B;  5DIF B;  1X1G A;  2H7D A;  5D3V A;  2K2U A;  1XX0 A;  1P3R A;  2Z0P A;  2EC1 A;  3FEH A;  3LJU X;  4TKN A;  3X23 A;  1NTY A;  1PFJ A;  5IRS A;  3ZDT A;  4GMV A;  2ZKM X;  5C5B A;  1DBH A;  3HQC A;  1W1H A;  2JP2 A;  4NSW A;  3PP2 A;  2R2Y A;  2Z59 A;  2P8V A;  4HAV B;  2UVM A;  3CIK A;  4ZRI A;  4KHA A;  4WSF A;  4KHB A;  2KCJ A;  1ZC3 B;  3AJ4 A; 
#chains in the Genus database with same CATH homology
 5DH9 B;  3MDB C;  2V76 A;  1OMW A;  4XWX A;  2NZ8 B;  1V5P A;  2D9V A;  3PSC A;  5KCV A;  2Y8F A;  1I7A A;  4IOY X;  3KSY A;  2YT0 A;  2L2I A;  5D27 A;  5D3W A;  3HK0 A;  2J0K A;  4A5K A;  1U5G A;  2I1K A;  4HAX B;  1M7R A;  1KI1 B;  2I5F A;  3M1I B;  1WGU A;  1U2B A;  1LW3 A;  1V5M A;  3PVW A;  4A6F A;  2DHJ A;  1E5W A;  4C0A A;  4D0N B;  3DXE A;  1Q67 A;  1FHW A;  1XOD A;  2HE7 A;  2DHK A;  2DKP A;  3NSU A;  1H10 A;  4GZU A;  2LG1 A;  5D3X A;  5C5B B;  4B6H A;  2R0D A;  3RCP A;  2GCL A;  3ODW A;  5L81 A;  5LOP B;  5J3T A;  1MAI A;  2AEH A;  5JP4 A;  4HAW B;  1EF1 A;  3D8E A;  2DYQ A;  3N7C A;  2DKQ A;  4K2P A;  5C79 A;  4GMX B;  5C6R A;  1P6S A;  1SGH A;  1RJ2 A;  4CYE A;  1MIX A;  4HAT B;  5HE2 A;  3TW1 A;  2RGN B;  3TVV A;  5JHH A;  2NMB A;  4K2O A;  3VIA A;  4P7I A;  2YF0 A;  1NI2 A;  4KAX B;  2D9Z A;  4GXB A;  2D9W A;  1EVH A;  2RLO A;  3KRW A;  5CLQ B;  3O96 A;  1W1G A;  5FI0 A;  3SUZ A;  1GC7 A;  2MWN B;  1QQG A;  1PMS A;  5J3Q A;  4PNK A;  2YSZ A;  4ZRK A;  4MT7 A;  2EJ8 A;  1V5U A;  3CXB B;  4IFS A;  1P5T A;  2G35 A;  3U7D A;  1U5D A;  1PLS A;  5LON B;  2DLW A;  1H4R A;  2XQN M;  4HAZ B;  3TCA A;  4BBK A;  3SNH A;  1WJM A;  1BTK A;  4DBB A;  2BCJ A;  2ELA A;  4CHJ A;  5HE3 A;  2LUL A;  2YT1 A;  4WVF B;  2P0F A;  4H8S A;  1AQC A;  2DYN A;  5HE1 A;  1Y19 B;  1WVH A;  3ML4 A;  1XR0 B;  2GCJ A;  3BIN A;  5FI1 A;  1IRS A;  4K17 A;  2MFQ A;  2RSG A;  5EFX A;  3SV1 A;  2DX1 A;  1J19 A;  2YS5 A;  1ZSQ A;  3A8Q A;  1X05 A;  2COC A;  1U5F A;  3PG7 A;  1UPQ A;  5J3Y A;  1X86 A;  3ULB A;  3GYP A;  3ODO A;  4EKU A;  3DXD A;  5JLJ B;  4DX9 0;  1FOE A;  3FSS A;  4IAP A;  1MK9 B;  3FM8 C;  4EMO A;  1B55 A;  2YVC A;  1Y5O A;  2GS0 A;  3F5R A;  4DXA B;  2W2X C;  2H7E A;  2J0J A;  2YRY A;  1U27 A;  2X18 A;  4F7G A;  3IVF A;  4A6H A;  1QC6 A;  1BTN A;  4MK0 A;  4KHB B;  1V61 A;  2LYD A;  2IYB A;  2RUK B;  3ULC A;  2YS3 A;  3P6A A;  2EMT A;  4WJ7 A;  2IFS A;  3QWM A;  1DDM A;  2ELB A;  2M38 A;  2HTH B;  2MDX A;  4MY6 A;  2ROV A;  1DDW A;  4Z2N A;  2FJL A;  1DRO A;  4HAU B;  1MKE A;  1NU2 A;  2ROZ B;  2Q13 A;  2D9Y A;  2P0D A;  1WJ1 A;  4HDQ A;  3D8D A;  1MPH A;  4HB0 B;  3A8P A;  1V89 A;  1RRP B;  3MPX A;  2LKO A;  1AWE A;  4ZRJ A;  2Z0O A;  2DTC A;  3ODX A;  2D11 A;  2COD A;  2Y7B A;  1SHC A;  2N23 A;  1K5D B;  1LB1 A;  1WG7 A;  1KZG A;  1KZ7 A;  2E2X A;  4NY0 A;  3V5W A;  2PZ1 A;  3KZ1 A;  4DX8 A;  2ZPY A;  4TYZ A;  2OQB A;  1WI1 A;  1ZVR A;  1NTV A;  1XCG A;  3U8Z A;  5D3Y A;  3T06 A;  2DA0 A;  2D2Q A;  3OAN A;  1UEF A;  3DXC A;  2KUP A;  3UZT A;  4Y94 A;  1UNP A;  1FGZ A;  1GC6 A;  2D10 A;  2DFK A;  1UNR A;  1Z87 A;  2EMS A;  1M7E A;  1U5E A;  1DYN A;  1FAO A;  1DDV A;  2VKI A;  1TJ6 A;  3VOQ A;  4HB2 B;  3ZVR A;  3TFM A;  1BAK A;  4GPT B;  4EJN A;  3G9W A;  1XKE A;  3WYF B;  4CHM A;  1ISN A;  2COA A;  2W2W A;  2DHI A;  1V88 A;  2ADZ A;  3SO6 A;  3PVU A;  1EGX A;  1OQN A;  2K00 A;  2QKL A;  2RNR B;  3P7Z A;  4HAY B;  4HB4 B;  2YS1 A;  3PZD A;  3AU5 A;  1X11 A;  2J59 M;  3A98 B;  4YON A;  2Y8G A;  5C16 A;  2OTX A;  4A6K A;  3AU4 A;  2N0Y A;  1FHO A;  2M14 A;  2UZS A;  2CY4 A;  3SYX A;  1FHX A;  3PVL A;  1J0W A;  2VSZ A;  1XD4 A;  1W1D A;  4PQ0 A;  3KY9 A;  5GOW B;  1WGQ A;  2DX5 A;  1OY2 A;  2MKR A;  1U29 A;  1X1F A;  2LOZ A;  2UZR A;  1ZC4 B;  2Z0Q A;  2GJY A;  3QBV B;  3F0W A;  3PEG A;  5JHG A;  2CRF A;  1GG3 A;  2DN6 A;  1UNQ A;  5KQ4 A;  2CAY A;  1N3H A;  3KRX A;  2R09 A;  2I1J A;  1MIZ B;  3GYO A;  5DHA B;  4KVG B;  5HE0 A;  1TQZ A;  2COF A;  1FGY A;  3QIJ A;  1MK7 B;  4KHO A;  2J0M A;  2RVB B;  2I5C A;  1BWN A;  1TXD A;  3HW2 B;  2W2X D;  2LOX A;  4GN1 A;  3BJI A;  3TO1 A;  3D8F A;  4HHV A;  1ZM0 A;  4HB3 B;  1UPR A;  5DI9 B;  1K5G B;  4F7U P;  2K2J A;  4HDO A;  2CY5 A;  2KGX B;  4A6F B;  2QKM A;  2P0H A;  1I2H A;  2D4Q A;  2L1C A;  4YL8 A;  2AL6 A;  2D9X A;  4Z2M B;  2VRW B;  5KQ1 A;  5DHF B;  3WA0 A;  1FB8 A;  4F7H A;  1EAZ A;  4L6E A;  4K81 A;  5CLL B;  5DIF B;  1X1G A;  2H7D A;  5D3V A;  2K2U A;  1XX0 A;  1P3R A;  2Z0P A;  2EC1 A;  3FEH A;  3LJU X;  4TKN A;  3X23 A;  1NTY A;  1PFJ A;  3ZDT A;  4GMV A;  5C5B A;  1DBH A;  3HQC A;  1W1H A;  2JP2 A;  4NSW A;  3PP2 A;  2P8V A;  4HAV B;  2UVM A;  3CIK A;  4ZRI A;  4KHA A;  4WSF A;  2KCJ A;  1ZC3 B;  3AJ4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...