1BWNA

Ph domain and btk motif from bruton's tyrosine kinase mutant e41k in complex with ins(1,3,4,5)p4
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
169
structure length
166
Chain Sequence
AAVILESIFLKRSQQKKKTSPLNFKKRLFLLTVHKLSYYKYDFERGRRGSKKGSIDVEKITCVETVVPEKNPPPERQIPRRGSEMEQISIIERFPYPFQVVYDEGPLYVFSPTEELRKRWIHQLKNVIRYNSDLVQKYHPCFWIDGQYLCCSQTAKNAMGCQILEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BRUTON'S TYROSINE KINASE
publication title Structure of the PH domain from Bruton's tyrosine kinase in complex with inositol 1,3,4,5-tetrakisphosphate.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 36
structure length 166
sequence length 169
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 1998-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
A PF00779 BTK BTK motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1bwnA00
2W2XC 5DHAB 4ZRJA 1NU2A 3HK0A 2IFSA 2YS1A 4WJ7A 1FGYA 2K2JA 1OQNA 2VKIA 2M14A 3AJ4A 2Z0QA 4HB0B 4ZRIA 5CLQB 2P0HA 4DX90 1P5TA 2LKOA 3TO1A 2COAA 4A5KA 1U5FA 2CY5A 3U8ZA 2MKRA 3MPXA 2N0YA 1Z87A 1X05A 5DIFB 2QKLA 1GC6A 4XWXA 5C6RA 2J0JA 1OY2A 2H7DA 3KRWA 1XR0B 2EMTA 2AEHA 1XX0A 4HDOA 3A8PA 1TXDA 5HE0A 2COCA 4IFSA 1QC6A 4EMOA 3PVWA 4IOYX 4K2OA 1WJMA 3GYOA 3VOQA 1RJ2A 3ODOA 2UZSA 5D3VA 5HE2A 2R0DA 5L81A 3M1IB 3KZ1A 2NZ8B 1J19A 3F5RA 4HAYB 4HDQA 2FJLA 2LG1A 2YT0A 1FHXA 2LYDA 2P8VA 1X1FA 3CIKA 3HW2B 1Y19B 4F7UP 1AQCA 3O96A 4PNKA 2XQNM 1BWNA 1V61A 2EC1A 1J0WA 2Y8FA 1MPHA 4MT7A 2I5CA 2G35A 4KHOA 1B55A 4HAWB 1EGXA 2YVCA 3DXEA 2W2WA 1XKEA 2I5FA 2JP2A 2V76A 3CXBB 3LJUX 2EMSA 2DX1A 2YS3A 1U5EA 2Z0OA 2Z0PA 1K5DB 2HE7A 1V89A 5KCVA 2OQBA 5C5BA 2J0MA 2RSGA 3WA0A 5LOPB 2OTXA 1LW3A 5J3QA 1H4RA 3QBVB 1I2HA 2LULA 2D11A 1ZSQA 3D8DA 2DN6A 2P0DA 4CHJA 2ELAA 3D8FA 1MIZB 1BTKA 1X86A 2YF0A 3T06A 3ODXA 1WGUA 1GC7A 4PQ0A 1K5GB 2D4QA 2Y8GA 2J0KA 1NTVA 2UZRA 1UNRA 1DBHA 1FB8A 1X11A 3HQCA 2RVBB 1M7RA 3SO6A 2PZ1A 2X18A 2HTHB 2D9VA 2DYNA 1W1HA 2D2QA 1TJ6A 1OMWA 4F7GA 2ZPYA 1DDVA 3DXDA 4A6HA 1BTNA 1ZC3B 2RGNB 2DKQA 2DHKA 4HHVA 3TCAA 1UPQA 4A6KA 3IVFA 1P3RA 5FI1A 1MKEA 1V5MA 2R09A 1FGZA 4GXBA 1WGQA 4WVFB 2W2XD 3KRXA 2VSZA 1RRPB 2CAYA 2Y7BA 2QKMA 3TW1A 2RUKB 5C5BB 1FOEA 1H10A 2D9XA 4GZUA 5D3YA 1E5WA 1N3HA 2RLOA 1NTYA 1QQGA 5J3YA 1ISNA 2CODA 4A6FA 2EJ8A 4IAPA 1TQZA 5DI9B 3SYXA 2VRWB 4L6EA 2ADZA 4EKUA 1EAZA 3ZVRA 2D10A 3NSUA 1I7AA 3MDBC 2Q13A 1BAKA 2L2IA 1WI1A 5JLJB 2DFKA 4B6HA 1KZGA 4HB3B 1M7EA 5DH9B 2KUPA 3V5WA 3WYFB 3BJIA 1PMSA 2BCJA 2GJYA 1XD4A 4NSWA 1U2BA 3AU5A 1UEFA 2COFA 4TYZA 4YL8A 2D9WA 3SV1A 4YONA 3TVVA 3D8EA 1PFJA 2I1JA 4HATB 1W1DA 5DHFB 5LONB 4Y94A 2M38A 2P0FA 4HAVB 5JHHA 1PLSA 3BINA 2E2XA 4D0NB 2NMBA 4F7HA 4A6FB 1UNPA 2N23A 3F0WA 4GPTB 4GMVA 3ULCA 2D9ZA 3G9WA 2UVMA 2I1KA 3KSYA 3RCPA 2DTCA 2DX5A 2D9YA 3X23A 4GN1A 1WG7A 4DX8A 5KQ1A 5EFXA 1XCGA 2DLWA 3FSSA 5KQ4A 4BBKA 2J59M 2KGXB 5D3WA 3PP2A 5JP4A 1EF1A 2RNRB 2LOXA 3A8QA 1V5PA 4KAXB 1Y5OA 3OANA 2K2UA 3U7DA 1W1GA 1FAOA 1MIXA 3N7CA 1ZM0A 3SUZA 2MDXA 4GMXB 1XODA 1SGHA 4CYEA 2DHIA 2DA0A 3PEGA 2MFQA 4Z2NA 4HB2B 4WSFA 1Q67A 4HAZB 1DROA 3SNHA 2GCLA 2ROZB 1V5UA 4KHBB 1KI1B 1ZC4B 1IRSA 2DYQA 3KY9A 2AL6A 4DXAB 2CY4A 2GS0A 1MK9B 4CHMA 2GCJA 4MK0A 3P6AA 1X1GA 5D3XA 1FHWA 5CLLB 4K2PA 2YSZA 3FEHA 4HAUB 1NI2A 1SHCA 1DDWA 3TFMA 3PG7A 4HAXB 3ZDTA 5GOWB 1KZ7A 1WVHA 1GG3A 2YS5A 3QIJA 5HE1A 1WJ1A 3DXCA 3VIAA 1MK7B 2L1CA 2MWNB 3QWMA 4EJNA 4H8SA 1EVHA 3A98B 1FHOA 5D27A 4Z2MB 5J3TA 4DBBA 1U5GA 4KVGB 4K81A 3ULBA 2YRYA 3UZTA 1V88A 4K17A 4P7IA 1U5DA 3FM8C 4MY6A 1MAIA 2H7EA 1P6SA 2DHJA 5C16A 5JHGA 3PSCA 1LB1A 2ROVA 1AWEA 3PZDA 4KHAA 2DKPA 5C79A 4TKNA 2ELBA 3GYPA 3ODWA 1U29A 1UNQA 1DYNA 3AU4A 3P7ZA 1U27A 4ZRKA 1UPRA 2YT1A 2CRFA 2KCJA 1ZVRA 3PVLA 3PVUA 2LOZA 5FI0A 4HB4B 4NY0A 5HE3A 2IYBA 3ML4A 4C0AA 1DDMA 2K00A
chains in the Genus database with same CATH superfamily
2W2XC 5DHAB 4ZRJA 5I2MA 1NU2A 3HK0A 2IFSA 2YS1A 4WJ7A 1FGYA 2K2JA 1OQNA 2VKIA 2M14A 3AJ4A 2Z0QA 4HB0B 4ZRIA 5CLQB 2P0HA 4DX90 1P5TA 2LKOA 3TO1A 2COAA 4A5KA 1U5FA 2CY5A 3U8ZA 2MKRA 3MPXA 2N0YA 1Z87A 1X05A 4OSNA 5DIFB 2QKLA 1GC6A 4XWXA 5C6RA 2J0JA 1OY2A 2H7DA 3KRWA 1XR0B 2EMTA 2AEHA 1XX0A 4HDOA 3A8PA 1TXDA 5HE0A 2COCA 4IFSA 1QC6A 4EMOA 3PVWA 4IOYX 4K2OA 1WJMA 3GYOA 3VOQA 1RJ2A 3ODOA 2UZSA 5D3VA 5HE2A 2R0DA 5L81A 3M1IB 3KZ1A 2NZ8B 1J19A 3F5RA 4HAYB 4HDQA 2FJLA 2LG1A 2YT0A 1FHXA 2LYDA 2P8VA 3FVCA 1X1FA 3CIKA 3HW2B 1Y19B 4F7UP 1AQCA 4GOUA 3O96A 4PNKA 2XQNM 1BWNA 1V61A 4HSIA 2EC1A 1J0WA 2Y8FA 1T77A 1MPHA 4MT7A 2I5CA 2G35A 4KHOA 2R2YA 1B55A 4HAWB 1EGXA 2YVCA 3DXEA 2W2WA 1XKEA 2I5FA 2JP2A 2V76A 3CXBB 3LJUX 2EMSA 2DX1A 2YS3A 1U5EA 2Z0OA 2Z0PA 3U12A 1K5DB 2HE7A 5LG4B 1V89A 3OHMB 5KCVA 2OQBA 5C5BA 2J0MA 2RSGA 3WA0A 4DIXA 5LOPB 2OTXA 1LW3A 5J3QA 4QJ4B 1H4RA 3QBVB 1I2HA 2LULA 2D11A 1ZSQA 3D8DA 2DN6A 2P0DA 3NW8A 2ELAA 3D8FA 1MIZB 1BTKA 1X86A 4CHJA 4QJ5B 2YF0A 3T06A 3ODXA 1WGUA 1GC7A 4PQ0A 1K5GB 2D4QA 2Y8GA 2J0KA 1NTVA 2UZRA 1UNRA 1DBHA 1FB8A 1X11A 4GNKB 4CSQA 3HQCA 2RVBB 1M7RA 3SO6A 2PZ1A 2X18A 2HTHB 2D9VA 2DYNA 1W1HA 2D2QA 1TJ6A 1OMWA 4F7GA 2ZPYA 1DDVA 3DXDA 4A6HA 1BTNA 2Z4DA 1ZC3B 2RGNB 2DKQA 2DHKA 4HHVA 3B77A 3HSAA 3TCAA 2Z13A 1UPQA 4A6KA 3IVFA 2GUMA 1P3RA 5FI1A 1MKEA 1V5MA 2R09A 1FGZA 4GXBA 1WGQA 4WVFB 2W2XD 3KRXA 2VSZA 1RRPB 2CAYA 2Y7BA 2KIEA 2QKMA 3TW1A 3NWFA 2RUKB 2K49A 5C5BB 1FOEA 1H10A 2D9XA 4GZUA 4L1RA 5D3YA 1ZYIA 1E5WA 1N3HA 2RLOA 1NTYA 1QQGA 5J3YA 1ISNA 2CODA 4A6FA 2EJ8A 4IAPA 4D6WA 1TQZA 5DI9B 3SYXA 2VRWB 4L6EA 2ADZA 4EKUA 1EAZA 3ZVRA 2D10A 3NSUA 1I7AA 3MDBC 2Q13A 1BAKA 2L2IA 1WI1A 5JLJB 2DFKA 4B6HA 1KZGA 4HB3B 1M7EA 5DH9B 2KUPA 3V5WA 3WYFB 3BJIA 2KIGA 1PMSA 2BCJA 2GJYA 1XD4A 4NSWA 1U2BA 3AU5A 1UEFA 2COFA 4TYZA 4YL8A 2D9WA 4KHBA 3SV1A 4YONA 3TVVA 3D8EA 4QXAB 1PFJA 2I1JA 4HATB 1W1DA 5DHFB 5LONB 4Y94A 2M38A 2P0FA 4HAVB 5JHHA 1PLSA 3BINA 2E2XA 2Z59A 4D0NB 2NMBA 4F7HA 4A6FB 1UNPA 2N23A 3F0WA 4GPTB 2NBVA 4GMVA 3ULCA 2FJUB 2D9ZA 3G9WA 2UVMA 2I1KA 3KSYA 3RCPA 2DTCA 2DX5A 2D9YA 3X23A 4GN1A 1WG7A 4DX8A 2KR0A 5KQ1A 5EFXA 3FSSA 1XCGA 2DLWA 5KQ4A 4BBKA 2J59M 2KGXB 5D3WA 3PP2A 5JP4A 4OT1A 2YT2A 3NWAA 1EF1A 2RNRB 2LOXA 3A8QA 1V5PA 4KAXB 1Y5OA 3OANA 2ZKMX 3HIEA 2K2UA 3U7DA 1W1GA 1FAOA 1MIXA 3A58A 3N7CA 1ZM0A 3SUZA 2MDXA 4GMXB 1XODA 1SGHA 4CYEA 2DHIA 2DA0A 3PEGA 2MFQA 4Z2NA 4HB2B 2RRFA 4WSFA 1Q67A 4HAZB 1DROA 3SNHA 2GCLA 2ROZB 1V5UA 4KHBB 1KI1B 1ZC4B 1IRSA 2DYQA 3KY9A 2AL6A 4DXAB 5M4YB 2CY4A 2GS0A 1MK9B 2KUQA 4CHMA 2GCJA 4MK0A 3P6AA 1X1GA 5D3XA 1FHWA 5CLLB 4K2PA 2YSZA 3FEHA 4HAUB 1NI2A 1SHCA 1DDWA 3TFMA 3PG7A 4HAXB 3ZDTA 5GOWB 1KZ7A 1WVHA 1GG3A 2YS5A 3QIJA 2K8EA 5HE1A 1WJ1A 3DXCA 3VIAA 1MK7B 2L1CA 2MWNB 3QWMA 4EJNA 4H8SA 1EVHA 3A98B 3DCXA 5D27A 1FHOA 4Z2MB 5J3TA 4DBBA 1U5GA 4KVGB 4K81A 3ULBA 2YRYA 3UZTA 1V88A 4K17A 4P7IA 1U5DA 3FM8C 4MY6A 1MAIA 2H7EA 1P6SA 2DHJA 5C16A 5JHGA 3PSCA 1LB1A 2ROVA 1AWEA 3PZDA 4KHAA 2DKPA 5C79A 4TKNA 2ELBA 3GYPA 3ODWA 1MI1A 1U29A 5I2SA 1UNQA 1DYNA 3AU4A 1U27A 3NWDA 3P7ZA 1UPRA 4ZRKA 2YT1A 2CRFA 2KCJA 1ZVRA 3PVLA 3PVUA 2LOZA 5IRSA 5FI0A 4HB4B 4NY0A 5HE3A 2IYBA 2Z14A 3ML4A 4C0AA 1DDMA 2K00A 4QJ3B
chains in the Genus database with same CATH topology
2W2XC 5DHAB 4ZRJA 1NU2A 3HK0A 2IFSA 2YS1A 4WJ7A 1FGYA 2K2JA 1OQNA 2VKIA 2M14A 3AJ4A 2Z0QA 4HB0B 4ZRIA 5CLQB 2P0HA 4DX90 1P5TA 2LKOA 3TO1A 2COAA 4A5KA 1U5FA 2CY5A 3U8ZA 2MKRA 3MPXA 2N0YA 1Z87A 1X05A 5DIFB 2QKLA 1GC6A 4XWXA 5C6RA 2J0JA 1OY2A 2H7DA 3KRWA 1XR0B 2EMTA 2AEHA 1XX0A 4HDOA 3A8PA 1TXDA 5HE0A 2COCA 4IFSA 1QC6A 4EMOA 3PVWA 4IOYX 4K2OA 1WJMA 3GYOA 3VOQA 1RJ2A 3ODOA 2UZSA 5D3VA 5HE2A 2R0DA 5L81A 3M1IB 3KZ1A 2NZ8B 1J19A 3F5RA 4HAYB 4HDQA 2FJLA 2LG1A 2YT0A 1FHXA 2LYDA 2P8VA 1X1FA 3CIKA 3HW2B 1Y19B 4F7UP 1AQCA 3O96A 4PNKA 2XQNM 1BWNA 1V61A 2EC1A 1J0WA 2Y8FA 1MPHA 4MT7A 2I5CA 2G35A 4KHOA 1B55A 4HAWB 1EGXA 2YVCA 3DXEA 2W2WA 1XKEA 2I5FA 2JP2A 2V76A 3CXBB 3LJUX 2EMSA 2DX1A 2YS3A 1U5EA 2Z0OA 2Z0PA 1K5DB 2HE7A 1V89A 5KCVA 2OQBA 5C5BA 2J0MA 2RSGA 3WA0A 5LOPB 2OTXA 1LW3A 5J3QA 1H4RA 3QBVB 1I2HA 2LULA 2D11A 1ZSQA 3D8DA 2DN6A 2P0DA 4CHJA 2ELAA 3D8FA 1MIZB 1BTKA 1X86A 2YF0A 3T06A 3ODXA 1WGUA 1GC7A 4PQ0A 1K5GB 2D4QA 2Y8GA 2J0KA 1NTVA 2UZRA 1UNRA 1DBHA 1FB8A 1X11A 3HQCA 2RVBB 1M7RA 3SO6A 2PZ1A 2X18A 2HTHB 2D9VA 2DYNA 1W1HA 2D2QA 1TJ6A 1OMWA 4F7GA 2ZPYA 1DDVA 3DXDA 4A6HA 1BTNA 1ZC3B 2RGNB 2DKQA 2DHKA 4HHVA 3TCAA 1UPQA 4A6KA 3IVFA 1P3RA 5FI1A 1MKEA 1V5MA 2R09A 1FGZA 4GXBA 1WGQA 4WVFB 2W2XD 3KRXA 2VSZA 1RRPB 2CAYA 2Y7BA 2QKMA 3TW1A 2RUKB 5C5BB 1FOEA 1H10A 2D9XA 4GZUA 5D3YA 1E5WA 1N3HA 2RLOA 1NTYA 1QQGA 5J3YA 1ISNA 2CODA 4A6FA 2EJ8A 4IAPA 1TQZA 5DI9B 3SYXA 2VRWB 4L6EA 2ADZA 4EKUA 1EAZA 3ZVRA 2D10A 3NSUA 1I7AA 3MDBC 2Q13A 1BAKA 2L2IA 1WI1A 5JLJB 2DFKA 4B6HA 1KZGA 4HB3B 1M7EA 5DH9B 2KUPA 3V5WA 3WYFB 3BJIA 1PMSA 2BCJA 2GJYA 1XD4A 4NSWA 1U2BA 3AU5A 1UEFA 2COFA 4TYZA 4YL8A 2D9WA 3SV1A 4YONA 3TVVA 3D8EA 1PFJA 2I1JA 4HATB 1W1DA 5DHFB 5LONB 4Y94A 2M38A 2P0FA 4HAVB 5JHHA 1PLSA 3BINA 2E2XA 4D0NB 2NMBA 4F7HA 4A6FB 1UNPA 2N23A 3F0WA 4GPTB 4GMVA 3ULCA 2D9ZA 3G9WA 2UVMA 2I1KA 3KSYA 3RCPA 2DTCA 2DX5A 2D9YA 3X23A 4GN1A 1WG7A 4DX8A 5KQ1A 5EFXA 1XCGA 2DLWA 3FSSA 5KQ4A 4BBKA 2J59M 2KGXB 5D3WA 3PP2A 5JP4A 1EF1A 2RNRB 2LOXA 3A8QA 1V5PA 4KAXB 1Y5OA 3OANA 2K2UA 3U7DA 1W1GA 1FAOA 1MIXA 3N7CA 1ZM0A 3SUZA 2MDXA 4GMXB 1XODA 1SGHA 4CYEA 2DHIA 2DA0A 3PEGA 2MFQA 4Z2NA 4HB2B 4WSFA 1Q67A 4HAZB 1DROA 3SNHA 2GCLA 2ROZB 1V5UA 4KHBB 1KI1B 1ZC4B 1IRSA 2DYQA 3KY9A 2AL6A 4DXAB 2CY4A 2GS0A 1MK9B 4CHMA 2GCJA 4MK0A 3P6AA 1X1GA 5D3XA 1FHWA 5CLLB 4K2PA 2YSZA 3FEHA 4HAUB 1NI2A 1SHCA 1DDWA 3TFMA 3PG7A 4HAXB 3ZDTA 5GOWB 1KZ7A 1WVHA 1GG3A 2YS5A 3QIJA 5HE1A 1WJ1A 3DXCA 3VIAA 1MK7B 2L1CA 2MWNB 3QWMA 4EJNA 4H8SA 1EVHA 3A98B 1FHOA 5D27A 4Z2MB 5J3TA 4DBBA 1U5GA 4KVGB 4K81A 3ULBA 2YRYA 3UZTA 1V88A 4K17A 4P7IA 1U5DA 3FM8C 4MY6A 1MAIA 2H7EA 1P6SA 2DHJA 5C16A 5JHGA 3PSCA 1LB1A 2ROVA 1AWEA 3PZDA 4KHAA 2DKPA 5C79A 4TKNA 2ELBA 3GYPA 3ODWA 1U29A 1UNQA 1DYNA 3AU4A 3P7ZA 1U27A 4ZRKA 1UPRA 2YT1A 2CRFA 2KCJA 1ZVRA 3PVLA 3PVUA 2LOZA 5FI0A 4HB4B 4NY0A 5HE3A 2IYBA 3ML4A 4C0AA 1DDMA 2K00A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2W2X C;  5DHA B;  4ZRJ A;  1NU2 A;  3HK0 A;  2IFS A;  2YS1 A;  4WJ7 A;  1FGY A;  2K2J A;  1OQN A;  2VKI A;  2M14 A;  3AJ4 A;  2Z0Q A;  4HB0 B;  4ZRI A;  5CLQ B;  2P0H A;  4DX9 0;  1P5T A;  2LKO A;  3TO1 A;  2COA A;  4A5K A;  1U5F A;  2CY5 A;  3U8Z A;  2MKR A;  3MPX A;  2N0Y A;  1Z87 A;  1X05 A;  5DIF B;  2QKL A;  1GC6 A;  4XWX A;  5C6R A;  2J0J A;  1OY2 A;  2H7D A;  3KRW A;  1XR0 B;  2EMT A;  2AEH A;  1XX0 A;  4HDO A;  3A8P A;  1TXD A;  5HE0 A;  2COC A;  4IFS A;  1QC6 A;  4EMO A;  3PVW A;  4IOY X;  4K2O A;  1WJM A;  3GYO A;  3VOQ A;  1RJ2 A;  3ODO A;  2UZS A;  5D3V A;  5HE2 A;  2R0D A;  5L81 A;  3M1I B;  3KZ1 A;  2NZ8 B;  1J19 A;  3F5R A;  4HAY B;  4HDQ A;  2FJL A;  2LG1 A;  2YT0 A;  1FHX A;  2LYD A;  2P8V A;  1X1F A;  3CIK A;  3HW2 B;  1Y19 B;  4F7U P;  1AQC A;  3O96 A;  4PNK A;  2XQN M;  1BWN A;  1V61 A;  2EC1 A;  1J0W A;  2Y8F A;  1MPH A;  4MT7 A;  2I5C A;  2G35 A;  4KHO A;  1B55 A;  4HAW B;  1EGX A;  2YVC A;  3DXE A;  2W2W A;  1XKE A;  2I5F A;  2JP2 A;  2V76 A;  3CXB B;  3LJU X;  2EMS A;  2DX1 A;  2YS3 A;  1U5E A;  2Z0O A;  2Z0P A;  1K5D B;  2HE7 A;  1V89 A;  5KCV A;  2OQB A;  5C5B A;  2J0M A;  2RSG A;  3WA0 A;  5LOP B;  2OTX A;  1LW3 A;  5J3Q A;  1H4R A;  3QBV B;  1I2H A;  2LUL A;  2D11 A;  1ZSQ A;  3D8D A;  2DN6 A;  2P0D A;  4CHJ A;  2ELA A;  3D8F A;  1MIZ B;  1BTK A;  1X86 A;  2YF0 A;  3T06 A;  3ODX A;  1WGU A;  1GC7 A;  4PQ0 A;  1K5G B;  2D4Q A;  2Y8G A;  2J0K A;  1NTV A;  2UZR A;  1UNR A;  1DBH A;  1FB8 A;  1X11 A;  3HQC A;  2RVB B;  1M7R A;  3SO6 A;  2PZ1 A;  2X18 A;  2HTH B;  2D9V A;  2DYN A;  1W1H A;  2D2Q A;  1TJ6 A;  1OMW A;  4F7G A;  2ZPY A;  1DDV A;  3DXD A;  4A6H A;  1BTN A;  1ZC3 B;  2RGN B;  2DKQ A;  2DHK A;  4HHV A;  3TCA A;  1UPQ A;  4A6K A;  3IVF A;  1P3R A;  5FI1 A;  1MKE A;  1V5M A;  2R09 A;  1FGZ A;  4GXB A;  1WGQ A;  4WVF B;  2W2X D;  3KRX A;  2VSZ A;  1RRP B;  2CAY A;  2Y7B A;  2QKM A;  3TW1 A;  2RUK B;  5C5B B;  1FOE A;  1H10 A;  2D9X A;  4GZU A;  5D3Y A;  1E5W A;  1N3H A;  2RLO A;  1NTY A;  1QQG A;  5J3Y A;  1ISN A;  2COD A;  4A6F A;  2EJ8 A;  4IAP A;  1TQZ A;  5DI9 B;  3SYX A;  2VRW B;  4L6E A;  2ADZ A;  4EKU A;  1EAZ A;  3ZVR A;  2D10 A;  3NSU A;  1I7A A;  3MDB C;  2Q13 A;  1BAK A;  2L2I A;  1WI1 A;  5JLJ B;  2DFK A;  4B6H A;  1KZG A;  4HB3 B;  1M7E A;  5DH9 B;  2KUP A;  3V5W A;  3WYF B;  3BJI A;  1PMS A;  2BCJ A;  2GJY A;  1XD4 A;  4NSW A;  1U2B A;  3AU5 A;  1UEF A;  2COF A;  4TYZ A;  4YL8 A;  2D9W A;  3SV1 A;  4YON A;  3TVV A;  3D8E A;  1PFJ A;  2I1J A;  4HAT B;  1W1D A;  5DHF B;  5LON B;  4Y94 A;  2M38 A;  2P0F A;  4HAV B;  5JHH A;  1PLS A;  3BIN A;  2E2X A;  4D0N B;  2NMB A;  4F7H A;  4A6F B;  1UNP A;  2N23 A;  3F0W A;  4GPT B;  4GMV A;  3ULC A;  2D9Z A;  3G9W A;  2UVM A;  2I1K A;  3KSY A;  3RCP A;  2DTC A;  2DX5 A;  2D9Y A;  3X23 A;  4GN1 A;  1WG7 A;  4DX8 A;  5KQ1 A;  5EFX A;  1XCG A;  2DLW A;  3FSS A;  5KQ4 A;  4BBK A;  2J59 M;  2KGX B;  5D3W A;  3PP2 A;  5JP4 A;  1EF1 A;  2RNR B;  2LOX A;  3A8Q A;  1V5P A;  4KAX B;  1Y5O A;  3OAN A;  2K2U A;  3U7D A;  1W1G A;  1FAO A;  1MIX A;  3N7C A;  1ZM0 A;  3SUZ A;  2MDX A;  4GMX B;  1XOD A;  1SGH A;  4CYE A;  2DHI A;  2DA0 A;  3PEG A;  2MFQ A;  4Z2N A;  4HB2 B;  4WSF A;  1Q67 A;  4HAZ B;  1DRO A;  3SNH A;  2GCL A;  2ROZ B;  1V5U A;  4KHB B;  1KI1 B;  1ZC4 B;  1IRS A;  2DYQ A;  3KY9 A;  2AL6 A;  4DXA B;  2CY4 A;  2GS0 A;  1MK9 B;  4CHM A;  2GCJ A;  4MK0 A;  3P6A A;  1X1G A;  5D3X A;  1FHW A;  5CLL B;  4K2P A;  2YSZ A;  3FEH A;  4HAU B;  1NI2 A;  1SHC A;  1DDW A;  3TFM A;  3PG7 A;  4HAX B;  3ZDT A;  5GOW B;  1KZ7 A;  1WVH A;  1GG3 A;  2YS5 A;  3QIJ A;  5HE1 A;  1WJ1 A;  3DXC A;  3VIA A;  1MK7 B;  2L1C A;  2MWN B;  3QWM A;  4EJN A;  4H8S A;  1EVH A;  3A98 B;  1FHO A;  5D27 A;  4Z2M B;  5J3T A;  4DBB A;  1U5G A;  4KVG B;  4K81 A;  3ULB A;  2YRY A;  3UZT A;  1V88 A;  4K17 A;  4P7I A;  1U5D A;  3FM8 C;  4MY6 A;  1MAI A;  2H7E A;  1P6S A;  2DHJ A;  5C16 A;  5JHG A;  3PSC A;  1LB1 A;  2ROV A;  1AWE A;  3PZD A;  4KHA A;  2DKP A;  5C79 A;  4TKN A;  2ELB A;  3GYP A;  3ODW A;  1U29 A;  1UNQ A;  1DYN A;  3AU4 A;  3P7Z A;  1U27 A;  4ZRK A;  1UPR A;  2YT1 A;  2CRF A;  2KCJ A;  1ZVR A;  3PVL A;  3PVU A;  2LOZ A;  5FI0 A;  4HB4 B;  4NY0 A;  5HE3 A;  2IYB A;  3ML4 A;  4C0A A;  1DDM A;  2K00 A; 
#chains in the Genus database with same CATH topology
 2W2X C;  5DHA B;  4ZRJ A;  5I2M A;  1NU2 A;  3HK0 A;  2IFS A;  2YS1 A;  4WJ7 A;  1FGY A;  2K2J A;  1OQN A;  2VKI A;  2M14 A;  3AJ4 A;  2Z0Q A;  4HB0 B;  4ZRI A;  5CLQ B;  2P0H A;  4DX9 0;  1P5T A;  2LKO A;  3TO1 A;  2COA A;  4A5K A;  1U5F A;  2CY5 A;  3U8Z A;  2MKR A;  3MPX A;  2N0Y A;  1Z87 A;  1X05 A;  4OSN A;  5DIF B;  2QKL A;  1GC6 A;  4XWX A;  5C6R A;  2J0J A;  1OY2 A;  2H7D A;  3KRW A;  1XR0 B;  2EMT A;  2AEH A;  1XX0 A;  4HDO A;  3A8P A;  1TXD A;  5HE0 A;  2COC A;  4IFS A;  1QC6 A;  4EMO A;  3PVW A;  4IOY X;  4K2O A;  1WJM A;  3GYO A;  3VOQ A;  1RJ2 A;  3ODO A;  2UZS A;  5D3V A;  5HE2 A;  2R0D A;  5L81 A;  3M1I B;  3KZ1 A;  2NZ8 B;  1J19 A;  3F5R A;  4HAY B;  4HDQ A;  2FJL A;  2LG1 A;  2YT0 A;  1FHX A;  2LYD A;  2P8V A;  3FVC A;  1X1F A;  3CIK A;  3HW2 B;  1Y19 B;  4F7U P;  1AQC A;  4GOU A;  3O96 A;  4PNK A;  2XQN M;  1BWN A;  1V61 A;  4HSI A;  2EC1 A;  1J0W A;  2Y8F A;  1T77 A;  1MPH A;  4MT7 A;  2I5C A;  2G35 A;  4KHO A;  2R2Y A;  1B55 A;  4HAW B;  1EGX A;  2YVC A;  3DXE A;  2W2W A;  1XKE A;  2I5F A;  2JP2 A;  2V76 A;  3CXB B;  3LJU X;  2EMS A;  2DX1 A;  2YS3 A;  1U5E A;  2Z0O A;  2Z0P A;  3U12 A;  1K5D B;  2HE7 A;  5LG4 B;  1V89 A;  3OHM B;  5KCV A;  2OQB A;  5C5B A;  2J0M A;  2RSG A;  3WA0 A;  4DIX A;  5LOP B;  2OTX A;  1LW3 A;  5J3Q A;  4QJ4 B;  1H4R A;  3QBV B;  1I2H A;  2LUL A;  2D11 A;  1ZSQ A;  3D8D A;  2DN6 A;  2P0D A;  3NW8 A;  2ELA A;  3D8F A;  1MIZ B;  1BTK A;  1X86 A;  4CHJ A;  4QJ5 B;  2YF0 A;  3T06 A;  3ODX A;  1WGU A;  1GC7 A;  4PQ0 A;  1K5G B;  2D4Q A;  2Y8G A;  2J0K A;  1NTV A;  2UZR A;  1UNR A;  1DBH A;  1FB8 A;  1X11 A;  4GNK B;  4CSQ A;  3HQC A;  2RVB B;  1M7R A;  3SO6 A;  2PZ1 A;  2X18 A;  2HTH B;  2D9V A;  2DYN A;  1W1H A;  2D2Q A;  1TJ6 A;  1OMW A;  4F7G A;  2ZPY A;  1DDV A;  3DXD A;  4A6H A;  1BTN A;  2Z4D A;  1ZC3 B;  2RGN B;  2DKQ A;  2DHK A;  4HHV A;  3B77 A;  3HSA A;  3TCA A;  2Z13 A;  1UPQ A;  4A6K A;  3IVF A;  2GUM A;  1P3R A;  5FI1 A;  1MKE A;  1V5M A;  2R09 A;  1FGZ A;  4GXB A;  1WGQ A;  4WVF B;  2W2X D;  3KRX A;  2VSZ A;  1RRP B;  2CAY A;  2Y7B A;  2KIE A;  2QKM A;  3TW1 A;  3NWF A;  2RUK B;  2K49 A;  5C5B B;  1FOE A;  1H10 A;  2D9X A;  4GZU A;  4L1R A;  5D3Y A;  1ZYI A;  1E5W A;  1N3H A;  2RLO A;  1NTY A;  1QQG A;  5J3Y A;  1ISN A;  2COD A;  4A6F A;  2EJ8 A;  4IAP A;  4D6W A;  1TQZ A;  5DI9 B;  3SYX A;  2VRW B;  4L6E A;  2ADZ A;  4EKU A;  1EAZ A;  3ZVR A;  2D10 A;  3NSU A;  1I7A A;  3MDB C;  2Q13 A;  1BAK A;  2L2I A;  1WI1 A;  5JLJ B;  2DFK A;  4B6H A;  1KZG A;  4HB3 B;  1M7E A;  5DH9 B;  2KUP A;  3V5W A;  3WYF B;  3BJI A;  2KIG A;  1PMS A;  2BCJ A;  2GJY A;  1XD4 A;  4NSW A;  1U2B A;  3AU5 A;  1UEF A;  2COF A;  4TYZ A;  4YL8 A;  2D9W A;  4KHB A;  3SV1 A;  4YON A;  3TVV A;  3D8E A;  4QXA B;  1PFJ A;  2I1J A;  4HAT B;  1W1D A;  5DHF B;  5LON B;  4Y94 A;  2M38 A;  2P0F A;  4HAV B;  5JHH A;  1PLS A;  3BIN A;  2E2X A;  2Z59 A;  4D0N B;  2NMB A;  4F7H A;  4A6F B;  1UNP A;  2N23 A;  3F0W A;  4GPT B;  2NBV A;  4GMV A;  3ULC A;  2FJU B;  2D9Z A;  3G9W A;  2UVM A;  2I1K A;  3KSY A;  3RCP A;  2DTC A;  2DX5 A;  2D9Y A;  3X23 A;  4GN1 A;  1WG7 A;  4DX8 A;  2KR0 A;  5KQ1 A;  5EFX A;  3FSS A;  1XCG A;  2DLW A;  5KQ4 A;  4BBK A;  2J59 M;  2KGX B;  5D3W A;  3PP2 A;  5JP4 A;  4OT1 A;  2YT2 A;  3NWA A;  1EF1 A;  2RNR B;  2LOX A;  3A8Q A;  1V5P A;  4KAX B;  1Y5O A;  3OAN A;  2ZKM X;  3HIE A;  2K2U A;  3U7D A;  1W1G A;  1FAO A;  1MIX A;  3A58 A;  3N7C A;  1ZM0 A;  3SUZ A;  2MDX A;  4GMX B;  1XOD A;  1SGH A;  4CYE A;  2DHI A;  2DA0 A;  3PEG A;  2MFQ A;  4Z2N A;  4HB2 B;  2RRF A;  4WSF A;  1Q67 A;  4HAZ B;  1DRO A;  3SNH A;  2GCL A;  2ROZ B;  1V5U A;  4KHB B;  1KI1 B;  1ZC4 B;  1IRS A;  2DYQ A;  3KY9 A;  2AL6 A;  4DXA B;  5M4Y B;  2CY4 A;  2GS0 A;  1MK9 B;  2KUQ A;  4CHM A;  2GCJ A;  4MK0 A;  3P6A A;  1X1G A;  5D3X A;  1FHW A;  5CLL B;  4K2P A;  2YSZ A;  3FEH A;  4HAU B;  1NI2 A;  1SHC A;  1DDW A;  3TFM A;  3PG7 A;  4HAX B;  3ZDT A;  5GOW B;  1KZ7 A;  1WVH A;  1GG3 A;  2YS5 A;  3QIJ A;  2K8E A;  5HE1 A;  1WJ1 A;  3DXC A;  3VIA A;  1MK7 B;  2L1C A;  2MWN B;  3QWM A;  4EJN A;  4H8S A;  1EVH A;  3A98 B;  3DCX A;  5D27 A;  1FHO A;  4Z2M B;  5J3T A;  4DBB A;  1U5G A;  4KVG B;  4K81 A;  3ULB A;  2YRY A;  3UZT A;  1V88 A;  4K17 A;  4P7I A;  1U5D A;  3FM8 C;  4MY6 A;  1MAI A;  2H7E A;  1P6S A;  2DHJ A;  5C16 A;  5JHG A;  3PSC A;  1LB1 A;  2ROV A;  1AWE A;  3PZD A;  4KHA A;  2DKP A;  5C79 A;  4TKN A;  2ELB A;  3GYP A;  3ODW A;  1MI1 A;  1U29 A;  5I2S A;  1UNQ A;  1DYN A;  3AU4 A;  1U27 A;  3NWD A;  3P7Z A;  1UPR A;  4ZRK A;  2YT1 A;  2CRF A;  2KCJ A;  1ZVR A;  3PVL A;  3PVU A;  2LOZ A;  5IRS A;  5FI0 A;  4HB4 B;  4NY0 A;  5HE3 A;  2IYB A;  2Z14 A;  3ML4 A;  4C0A A;  1DDM A;  2K00 A;  4QJ3 B; 
#chains in the Genus database with same CATH homology
 2W2X C;  5DHA B;  4ZRJ A;  1NU2 A;  3HK0 A;  2IFS A;  2YS1 A;  4WJ7 A;  1FGY A;  2K2J A;  1OQN A;  2VKI A;  2M14 A;  3AJ4 A;  2Z0Q A;  4HB0 B;  4ZRI A;  5CLQ B;  2P0H A;  4DX9 0;  1P5T A;  2LKO A;  3TO1 A;  2COA A;  4A5K A;  1U5F A;  2CY5 A;  3U8Z A;  2MKR A;  3MPX A;  2N0Y A;  1Z87 A;  1X05 A;  5DIF B;  2QKL A;  1GC6 A;  4XWX A;  5C6R A;  2J0J A;  1OY2 A;  2H7D A;  3KRW A;  1XR0 B;  2EMT A;  2AEH A;  1XX0 A;  4HDO A;  3A8P A;  1TXD A;  5HE0 A;  2COC A;  4IFS A;  1QC6 A;  4EMO A;  3PVW A;  4IOY X;  4K2O A;  1WJM A;  3GYO A;  3VOQ A;  1RJ2 A;  3ODO A;  2UZS A;  5D3V A;  5HE2 A;  2R0D A;  5L81 A;  3M1I B;  3KZ1 A;  2NZ8 B;  1J19 A;  3F5R A;  4HAY B;  4HDQ A;  2FJL A;  2LG1 A;  2YT0 A;  1FHX A;  2LYD A;  2P8V A;  1X1F A;  3CIK A;  3HW2 B;  1Y19 B;  4F7U P;  1AQC A;  3O96 A;  4PNK A;  2XQN M;  1BWN A;  1V61 A;  2EC1 A;  1J0W A;  2Y8F A;  1MPH A;  4MT7 A;  2I5C A;  2G35 A;  4KHO A;  1B55 A;  4HAW B;  1EGX A;  2YVC A;  3DXE A;  2W2W A;  1XKE A;  2I5F A;  2JP2 A;  2V76 A;  3CXB B;  3LJU X;  2EMS A;  2DX1 A;  2YS3 A;  1U5E A;  2Z0O A;  2Z0P A;  1K5D B;  2HE7 A;  1V89 A;  5KCV A;  2OQB A;  5C5B A;  2J0M A;  2RSG A;  3WA0 A;  5LOP B;  2OTX A;  1LW3 A;  5J3Q A;  1H4R A;  3QBV B;  1I2H A;  2LUL A;  2D11 A;  1ZSQ A;  3D8D A;  2DN6 A;  2P0D A;  4CHJ A;  2ELA A;  3D8F A;  1MIZ B;  1BTK A;  1X86 A;  2YF0 A;  3T06 A;  3ODX A;  1WGU A;  1GC7 A;  4PQ0 A;  1K5G B;  2D4Q A;  2Y8G A;  2J0K A;  1NTV A;  2UZR A;  1UNR A;  1DBH A;  1FB8 A;  1X11 A;  3HQC A;  2RVB B;  1M7R A;  3SO6 A;  2PZ1 A;  2X18 A;  2HTH B;  2D9V A;  2DYN A;  1W1H A;  2D2Q A;  1TJ6 A;  1OMW A;  4F7G A;  2ZPY A;  1DDV A;  3DXD A;  4A6H A;  1BTN A;  1ZC3 B;  2RGN B;  2DKQ A;  2DHK A;  4HHV A;  3TCA A;  1UPQ A;  4A6K A;  3IVF A;  1P3R A;  5FI1 A;  1MKE A;  1V5M A;  2R09 A;  1FGZ A;  4GXB A;  1WGQ A;  4WVF B;  2W2X D;  3KRX A;  2VSZ A;  1RRP B;  2CAY A;  2Y7B A;  2QKM A;  3TW1 A;  2RUK B;  5C5B B;  1FOE A;  1H10 A;  2D9X A;  4GZU A;  5D3Y A;  1E5W A;  1N3H A;  2RLO A;  1NTY A;  1QQG A;  5J3Y A;  1ISN A;  2COD A;  4A6F A;  2EJ8 A;  4IAP A;  1TQZ A;  5DI9 B;  3SYX A;  2VRW B;  4L6E A;  2ADZ A;  4EKU A;  1EAZ A;  3ZVR A;  2D10 A;  3NSU A;  1I7A A;  3MDB C;  2Q13 A;  1BAK A;  2L2I A;  1WI1 A;  5JLJ B;  2DFK A;  4B6H A;  1KZG A;  4HB3 B;  1M7E A;  5DH9 B;  2KUP A;  3V5W A;  3WYF B;  3BJI A;  1PMS A;  2BCJ A;  2GJY A;  1XD4 A;  4NSW A;  1U2B A;  3AU5 A;  1UEF A;  2COF A;  4TYZ A;  4YL8 A;  2D9W A;  3SV1 A;  4YON A;  3TVV A;  3D8E A;  1PFJ A;  2I1J A;  4HAT B;  1W1D A;  5DHF B;  5LON B;  4Y94 A;  2M38 A;  2P0F A;  4HAV B;  5JHH A;  1PLS A;  3BIN A;  2E2X A;  4D0N B;  2NMB A;  4F7H A;  4A6F B;  1UNP A;  2N23 A;  3F0W A;  4GPT B;  4GMV A;  3ULC A;  2D9Z A;  3G9W A;  2UVM A;  2I1K A;  3KSY A;  3RCP A;  2DTC A;  2DX5 A;  2D9Y A;  3X23 A;  4GN1 A;  1WG7 A;  4DX8 A;  5KQ1 A;  5EFX A;  1XCG A;  2DLW A;  3FSS A;  5KQ4 A;  4BBK A;  2J59 M;  2KGX B;  5D3W A;  3PP2 A;  5JP4 A;  1EF1 A;  2RNR B;  2LOX A;  3A8Q A;  1V5P A;  4KAX B;  1Y5O A;  3OAN A;  2K2U A;  3U7D A;  1W1G A;  1FAO A;  1MIX A;  3N7C A;  1ZM0 A;  3SUZ A;  2MDX A;  4GMX B;  1XOD A;  1SGH A;  4CYE A;  2DHI A;  2DA0 A;  3PEG A;  2MFQ A;  4Z2N A;  4HB2 B;  4WSF A;  1Q67 A;  4HAZ B;  1DRO A;  3SNH A;  2GCL A;  2ROZ B;  1V5U A;  4KHB B;  1KI1 B;  1ZC4 B;  1IRS A;  2DYQ A;  3KY9 A;  2AL6 A;  4DXA B;  2CY4 A;  2GS0 A;  1MK9 B;  4CHM A;  2GCJ A;  4MK0 A;  3P6A A;  1X1G A;  5D3X A;  1FHW A;  5CLL B;  4K2P A;  2YSZ A;  3FEH A;  4HAU B;  1NI2 A;  1SHC A;  1DDW A;  3TFM A;  3PG7 A;  4HAX B;  3ZDT A;  5GOW B;  1KZ7 A;  1WVH A;  1GG3 A;  2YS5 A;  3QIJ A;  5HE1 A;  1WJ1 A;  3DXC A;  3VIA A;  1MK7 B;  2L1C A;  2MWN B;  3QWM A;  4EJN A;  4H8S A;  1EVH A;  3A98 B;  1FHO A;  5D27 A;  4Z2M B;  5J3T A;  4DBB A;  1U5G A;  4KVG B;  4K81 A;  3ULB A;  2YRY A;  3UZT A;  1V88 A;  4K17 A;  4P7I A;  1U5D A;  3FM8 C;  4MY6 A;  1MAI A;  2H7E A;  1P6S A;  2DHJ A;  5C16 A;  5JHG A;  3PSC A;  1LB1 A;  2ROV A;  1AWE A;  3PZD A;  4KHA A;  2DKP A;  5C79 A;  4TKN A;  2ELB A;  3GYP A;  3ODW A;  1U29 A;  1UNQ A;  1DYN A;  3AU4 A;  3P7Z A;  1U27 A;  4ZRK A;  1UPR A;  2YT1 A;  2CRF A;  2KCJ A;  1ZVR A;  3PVL A;  3PVU A;  2LOZ A;  5FI0 A;  4HB4 B;  4NY0 A;  5HE3 A;  2IYB A;  3ML4 A;  4C0A A;  1DDM A;  2K00 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...