1BWNA

Ph domain and btk motif from bruton's tyrosine kinase mutant e41k in complex with ins(1,3,4,5)p4
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
169
structure length
166
Chain Sequence
AAVILESIFLKRSQQKKKTSPLNFKKRLFLLTVHKLSYYKYDFERGRRGSKKGSIDVEKITCVETVVPEKNPPPERQIPRRGSEMEQISIIERFPYPFQVVYDEGPLYVFSPTEELRKRWIHQLKNVIRYNSDLVQKYHPCFWIDGQYLCCSQTAKNAMGCQILEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords BRUTON'S TYROSINE KINASE
publication title Structure of the PH domain from Bruton's tyrosine kinase in complex with inositol 1,3,4,5-tetrakisphosphate.
pubmed doi rcsb
source organism Homo sapiens
total genus 36
structure length 166
sequence length 169
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 1998-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
A PF00779 BTK BTK motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1bwnA00
1LW3A 2Q13A 1AWEA 2P0DA 1SHCA 2RNRB 2DHIA 2YRYA 1P5TA 2LKOA 3ODOA 4HDQA 4K81A 4Y94A 4CHJA 2DHKA 2ZPYA 2GS0A 2AL6A 1U27A 1V5PA 4GMVA 2LYDA 3VOQA 5GOWB 3PSCA 1OMWA 4MK0A 1IRSA 5DI9B 1Q67A 2DKPA 5J3TA 2Z0QA 4GZUA 1FHXA 2AEHA 2DX1A 2D9XA 2K2UA 1TXDA 4A6FA 2KCJA 1XODA 3F5RA 2D9WA 3TO1A 2YT1A 3U7DA 1I2HA 2PZ1A 3KSYA 2LOZA 1MK7B 5JHHA 2DTCA 2DLWA 2GJYA 2N23A 3ODXA 4DX90 1KI1B 1XD4A 4WVFB 3PVWA 1XCGA 2CY4A 1DDVA 1FHWA 1M7RA 3TFMA 3G9WA 4EJNA 2CODA 1E5WA 2ELBA 3GYOA 1QC6A 1U5FA 2CAYA 3GYPA 3CIKA 1OY2A 4F7HA 2YS5A 4NY0A 4HB3B 1ZSQA 3TW1A 1X86A 1W1GA 1DYNA 4A6KA 3PVUA 2DFKA 3WYFB 1H4RA 1J19A 3MDBC 1WG7A 4EKUA 1UNQA 2BCJA 2KUPA 4HAVB 3D8DA 1BTKA 1KZ7A 4HAZB 1ZM0A 1MAIA 1EVHA 3BJIA 3U8ZA 1U5GA 3QBVB 3TVVA 1WVHA 1QQGA 3A98B 2D10A 1ZC4B 1UNRA 1U5EA 1AQCA 1FOEA 1XR0B 5JHGA 1U2BA 2IFSA 2P0HA 2K00A 2P8VA 2D2QA 5LONB 3DXDA 3UZTA 4TKNA 2D9YA 3NSUA 2ADZA 5HE3A 1DROA 1B55A 4HB4B 1LB1A 5D27A 1EGXA 1WGQA 3F0WA 4KHBB 1ZVRA 1EAZA 3SO6A 1Z87A 4KHOA 2L1CA 4GMXB 3HK0A 3PZDA 1PMSA 3HQCA 4HDOA 3IVFA 4HAUB 3BINA 3P7ZA 1GG3A 3KZ1A 5D3YA 2JP2A 1UEFA 2Z0PA 1FB8A 2HTHB 2OTXA 5C16A 3CXBB 1P3RA 3FEHA 2COAA 4CHMA 2MDXA 2D9VA 1FAOA 4HAWB 5HE1A 3SNHA 2J0KA 4DXAB 1V89A 1FHOA 1X05A 4TYZA 2QKLA 2J0JA 2UVMA 1KZGA 2COCA 1WI1A 2ROZB 3LJUX 4HAXB 2LOXA 2W2XC 1WJ1A 2Y8FA 5J3QA 4Z2MB 1RRPB 1V88A 2I5CA 2Z0OA 1DDWA 4Z2NA 4GXBA 4HATB 5L81A 2IYBA 2RLOA 5HE2A 3X23A 4A6FB 3OANA 3O96A 3SUZA 4YONA 1GC7A 1ZC3B 4ZRKA 1PLSA 1W1HA 4HHVA 1NTYA 1X1GA 1K5DB 1TJ6A 2I1KA 5D3VA 1SGHA 1X11A 2RSGA 3PVLA 3DXCA 2RUKB 2FJLA 4IFSA 1BAKA 5DHFB 4GPTB 1H10A 3SV1A 1X1FA 4XWXA 5KCVA 1PFJA 1XKEA 2VKIA 1M7EA 1RJ2A 4EMOA 1GC6A 2DYNA 3RCPA 2N0YA 3QWMA 3M1IB 5C79A 4IAPA 2Y7BA 1N3HA 2QKMA 2RGNB 1EF1A 1K5GB 4WSFA 2UZRA 1NTVA 3VIAA 1MKEA 3DXEA 2MFQA 2DA0A 3AU5A 1DDMA 4CYEA 1UNPA 3ODWA 3WA0A 3FM8C 2L2IA 3ULCA 1OQNA 3KY9A 3ML4A 1MK9B 4L6EA 1V5MA 4A5KA 2EMTA 4IOYX 2MWNB 2NZ8B 2X18A 5DH9B 4ZRIA 2COFA 2W2XD 5LOPB 2GCLA 1XX0A 2EJ8A 2ROVA 5C6RA 2EMSA 5HE0A 3FSSA 2VSZA 2LULA 1W1DA 3T06A 2W2WA 2XQNM 2VRWB 5CLQB 2I1JA 4WJ7A 1UPQA 2DKQA 2J59M 5D3WA 1P6SA 3N7CA 2V76A 4ZRJA 5C5BA 2R0DA 4DBBA 2HE7A 4MT7A 2YT0A 5FI0A 1TQZA 2YS3A 4P7IA 1MIZB 4H8SA 2YSZA 2LG1A 3D8EA 4GN1A 1U5DA 1NI2A 2R09A 3SYXA 2D4QA 1V5UA 2DHJA 2RVBB 3AJ4A 1FGYA 3AU4A 5JP4A 3MPXA 4HAYB 3ZVRA 4K2OA 1FGZA 1Y19B 1WJMA 5KQ1A 5FI1A 4NSWA 5C5BB 4K2PA 5D3XA 3KRXA 4K17A 2ELAA 2UZSA 4HB2B 4B6HA 2P0FA 5JLJB 5KQ4A 4D0NB 2YS1A 2H7EA 4HB0B 2DYQA 1J0WA 4BBKA 3PP2A 2M14A 4F7GA 2NMBA 4MY6A 1Y5OA 2H7DA 1NU2A 1DBHA 3TCAA 4F7UP 1MPHA 1WGUA 4PNKA 2EC1A 3V5WA 3PEGA 5EFXA 4YL8A 4A6HA 3D8FA 2KGXB 3PG7A 2YVCA 4KVGB 2CY5A 2OQBA 3HW2B 2G35A 2J0MA 1MIXA 1I7AA 4DX8A 2K2JA 4C0AA 2YF0A 2D11A 3A8PA 3A8QA 4KHAA 2I5FA 2M38A 2E2XA 4PQ0A 5DHAB 1BWNA 3QIJA 3KRWA 3ULBA 1V61A 1UPRA 2DN6A 5J3YA 2MKRA 3ZDTA 1U29A 5CLLB 2GCJA 4KAXB 2Y8GA 3P6AA 2CRFA 5DIFB 2D9ZA 1BTNA 1ISNA 2DX5A
chains in the Genus database with same CATH superfamily
1LW3A 2Q13A 1AWEA 2K49A 2P0DA 1ZYIA 1SHCA 2RNRB 2DHIA 2YRYA 1P5TA 2LKOA 3ODOA 4HDQA 4K81A 4Y94A 4CHJA 2DHKA 2ZPYA 2GS0A 2AL6A 1U27A 1V5PA 4CSQA 4GMVA 2LYDA 3VOQA 5GOWB 2YT2A 3PSCA 1OMWA 4MK0A 1IRSA 5DI9B 1Q67A 4GOUA 2DKPA 5J3TA 2Z0QA 4GZUA 1FHXA 2AEHA 2DX1A 2D9XA 2K2UA 1TXDA 3OHMB 4A6FA 2KCJA 1XODA 3F5RA 2D9WA 3TO1A 2YT1A 3U7DA 1I2HA 2PZ1A 3KSYA 2LOZA 1MK7B 5JHHA 2DTCA 2DLWA 2GJYA 2N23A 3ODXA 4DX90 1KI1B 1XD4A 4WVFB 3PVWA 1XCGA 2CY4A 1DDVA 1FHWA 1M7RA 3TFMA 3G9WA 4EJNA 2CODA 1E5WA 2ZKMX 2ELBA 3GYOA 1QC6A 1U5FA 2CAYA 3GYPA 3CIKA 1OY2A 4F7HA 2YS5A 4NY0A 5M4YB 4HB3B 1ZSQA 3TW1A 1X86A 1W1GA 1DYNA 4A6KA 3PVUA 2DFKA 3WYFB 1H4RA 1J19A 3MDBC 1WG7A 4EKUA 4L1RA 1UNQA 2BCJA 2KUPA 4HAVB 3D8DA 4KHBA 1BTKA 1KZ7A 4HAZB 1ZM0A 1MAIA 1EVHA 3BJIA 3U8ZA 1U5GA 3QBVB 3TVVA 1WVHA 1QQGA 3A98B 2D10A 1ZC4B 1UNRA 1U5EA 1AQCA 1FOEA 1XR0B 5JHGA 1U2BA 2IFSA 2P0HA 2K00A 4D6WA 2P8VA 2D2QA 5LONB 3DXDA 3UZTA 4TKNA 2D9YA 3NSUA 5I2SA 2ADZA 5HE3A 1DROA 1B55A 4HB4B 1LB1A 5D27A 1EGXA 1WGQA 3F0WA 4KHBB 1ZVRA 1EAZA 3SO6A 1Z87A 4KHOA 2L1CA 4GMXB 3HK0A 3PZDA 1PMSA 2KUQA 3HQCA 4HDOA 3IVFA 4HAUB 3BINA 3P7ZA 1GG3A 3KZ1A 5D3YA 2JP2A 1UEFA 2Z0PA 1FB8A 2HTHB 2OTXA 5C16A 3CXBB 1P3RA 2Z14A 3FEHA 2COAA 4CHMA 2MDXA 2NBVA 2D9VA 4QJ4B 1FAOA 4HAWB 5HE1A 3SNHA 2J0KA 4DXAB 1V89A 1FHOA 1X05A 4TYZA 2QKLA 2J0JA 2UVMA 4QJ5B 4OSNA 1KZGA 2COCA 1WI1A 2ROZB 3LJUX 4HAXB 2LOXA 2W2XC 1WJ1A 2Y8FA 3NWAA 4OT1A 5J3QA 4Z2MB 1RRPB 1V88A 2I5CA 2Z0OA 1DDWA 4Z2NA 5LG4B 4GXBA 4HATB 5L81A 2IYBA 2RLOA 5HE2A 3X23A 4A6FB 3NWDA 3OANA 3O96A 3SUZA 4YONA 2R2YA 1GC7A 1ZC3B 4ZRKA 1PLSA 1W1HA 4HHVA 1NTYA 1X1GA 1K5DB 1TJ6A 2I1KA 5D3VA 1SGHA 1X11A 2RSGA 3PVLA 3DXCA 2RUKB 2FJLA 4IFSA 1BAKA 5DHFB 4GPTB 1H10A 2GUMA 3SV1A 1X1FA 2Z4DA 3A58A 4XWXA 5KCVA 1PFJA 1XKEA 2VKIA 1M7EA 1RJ2A 4EMOA 1GC6A 2DYNA 3B77A 3RCPA 2N0YA 3QWMA 3M1IB 5C79A 4IAPA 2Y7BA 1N3HA 2QKMA 2RGNB 1EF1A 1K5GB 2RRFA 4WSFA 2UZRA 1NTVA 3FVCA 3VIAA 1MKEA 3DXEA 3DCXA 2MFQA 2DA0A 3AU5A 1DDMA 4CYEA 1UNPA 1T77A 3ODWA 3WA0A 3FM8C 2L2IA 3ULCA 1OQNA 3KY9A 3ML4A 1MK9B 4L6EA 1V5MA 4A5KA 2EMTA 3NWFA 4IOYX 2MWNB 2NZ8B 2X18A 5DH9B 4ZRIA 2COFA 2W2XD 5LOPB 2GCLA 1XX0A 2EJ8A 2ROVA 5C6RA 2EMSA 5HE0A 3FSSA 2VSZA 2K8EA 1W1DA 2LULA 3T06A 2W2WA 2XQNM 2VRWB 5CLQB 2I1JA 4WJ7A 1UPQA 2DKQA 2J59M 5D3WA 2KIGA 1P6SA 3N7CA 2V76A 4ZRJA 5C5BA 4QJ3B 2R0DA 5I2MA 5IRSA 4DBBA 2HE7A 3HSAA 4MT7A 2YT0A 5FI0A 1TQZA 2YS3A 4P7IA 1MIZB 4H8SA 4QXAB 2Z13A 2YSZA 2LG1A 3D8EA 4GN1A 1U5DA 1NI2A 2R09A 3SYXA 2D4QA 1V5UA 2DHJA 2RVBB 3AJ4A 1FGYA 3AU4A 5JP4A 3MPXA 4HAYB 3ZVRA 4K2OA 1FGZA 1Y19B 1WJMA 5KQ1A 5FI1A 4NSWA 5C5BB 4K2PA 5D3XA 3KRXA 4GNKB 4K17A 2ELAA 2Z59A 2UZSA 4HB2B 4B6HA 2P0FA 5JLJB 5KQ4A 4D0NB 2YS1A 2KR0A 2H7EA 4HB0B 2DYQA 1J0WA 4BBKA 3PP2A 1MI1A 2M14A 4F7GA 2NMBA 2FJUB 4MY6A 1Y5OA 2H7DA 1NU2A 4DIXA 3NW8A 1DBHA 3TCAA 4F7UP 1MPHA 1WGUA 4PNKA 2EC1A 3V5WA 3PEGA 3U12A 5EFXA 4YL8A 4A6HA 3D8FA 2KGXB 3PG7A 4HSIA 2YVCA 4KVGB 2CY5A 2OQBA 3HW2B 2G35A 2J0MA 1MIXA 1I7AA 4DX8A 2K2JA 4C0AA 2YF0A 2D11A 3A8PA 3A8QA 4KHAA 2I5FA 2M38A 2E2XA 4PQ0A 5DHAB 3HIEA 1BWNA 3QIJA 3KRWA 3ULBA 1V61A 1UPRA 2DN6A 5J3YA 2MKRA 3ZDTA 1U29A 5CLLB 2GCJA 4KAXB 2Y8GA 3P6AA 2KIEA 2CRFA 5DIFB 2D9ZA 1BTNA 1ISNA 2DX5A
chains in the Genus database with same CATH topology
1LW3A 2Q13A 1AWEA 2P0DA 1SHCA 2RNRB 2DHIA 2YRYA 1P5TA 2LKOA 3ODOA 4HDQA 4K81A 4Y94A 4CHJA 2DHKA 2ZPYA 2GS0A 2AL6A 1U27A 1V5PA 4GMVA 2LYDA 3VOQA 5GOWB 3PSCA 1OMWA 4MK0A 1IRSA 5DI9B 1Q67A 2DKPA 5J3TA 2Z0QA 4GZUA 1FHXA 2AEHA 2DX1A 2D9XA 2K2UA 1TXDA 4A6FA 2KCJA 1XODA 3F5RA 2D9WA 3TO1A 2YT1A 3U7DA 1I2HA 2PZ1A 3KSYA 2LOZA 1MK7B 5JHHA 2DTCA 2DLWA 2GJYA 2N23A 3ODXA 4DX90 1KI1B 1XD4A 4WVFB 3PVWA 1XCGA 2CY4A 1DDVA 1FHWA 1M7RA 3TFMA 3G9WA 4EJNA 2CODA 1E5WA 2ELBA 3GYOA 1QC6A 1U5FA 2CAYA 3GYPA 3CIKA 1OY2A 4F7HA 2YS5A 4NY0A 4HB3B 1ZSQA 3TW1A 1X86A 1W1GA 1DYNA 4A6KA 3PVUA 2DFKA 3WYFB 1H4RA 1J19A 3MDBC 1WG7A 4EKUA 1UNQA 2BCJA 2KUPA 4HAVB 3D8DA 1BTKA 1KZ7A 4HAZB 1ZM0A 1MAIA 1EVHA 3BJIA 3U8ZA 1U5GA 3QBVB 3TVVA 1WVHA 1QQGA 3A98B 2D10A 1ZC4B 1UNRA 1U5EA 1AQCA 1FOEA 1XR0B 5JHGA 1U2BA 2IFSA 2P0HA 2K00A 2P8VA 2D2QA 5LONB 3DXDA 3UZTA 4TKNA 2D9YA 3NSUA 2ADZA 5HE3A 1DROA 1B55A 4HB4B 1LB1A 5D27A 1EGXA 1WGQA 3F0WA 4KHBB 1ZVRA 1EAZA 3SO6A 1Z87A 4KHOA 2L1CA 4GMXB 3HK0A 3PZDA 1PMSA 3HQCA 4HDOA 3IVFA 4HAUB 3BINA 3P7ZA 1GG3A 3KZ1A 5D3YA 2JP2A 1UEFA 2Z0PA 1FB8A 2HTHB 2OTXA 5C16A 3CXBB 1P3RA 3FEHA 2COAA 4CHMA 2MDXA 2D9VA 1FAOA 4HAWB 5HE1A 3SNHA 2J0KA 4DXAB 1V89A 1FHOA 1X05A 4TYZA 2QKLA 2J0JA 2UVMA 1KZGA 2COCA 1WI1A 2ROZB 3LJUX 4HAXB 2LOXA 2W2XC 1WJ1A 2Y8FA 5J3QA 4Z2MB 1RRPB 1V88A 2I5CA 2Z0OA 1DDWA 4Z2NA 4GXBA 4HATB 5L81A 2IYBA 2RLOA 5HE2A 3X23A 4A6FB 3OANA 3O96A 3SUZA 4YONA 1GC7A 1ZC3B 4ZRKA 1PLSA 1W1HA 4HHVA 1NTYA 1X1GA 1K5DB 1TJ6A 2I1KA 5D3VA 1SGHA 1X11A 2RSGA 3PVLA 3DXCA 2RUKB 2FJLA 4IFSA 1BAKA 5DHFB 4GPTB 1H10A 3SV1A 1X1FA 4XWXA 5KCVA 1PFJA 1XKEA 2VKIA 1M7EA 1RJ2A 4EMOA 1GC6A 2DYNA 3RCPA 2N0YA 3QWMA 3M1IB 5C79A 4IAPA 2Y7BA 1N3HA 2QKMA 2RGNB 1EF1A 1K5GB 4WSFA 2UZRA 1NTVA 3VIAA 1MKEA 3DXEA 2MFQA 2DA0A 3AU5A 1DDMA 4CYEA 1UNPA 3ODWA 3WA0A 3FM8C 2L2IA 3ULCA 1OQNA 3KY9A 3ML4A 1MK9B 4L6EA 1V5MA 4A5KA 2EMTA 4IOYX 2MWNB 2NZ8B 2X18A 5DH9B 4ZRIA 2COFA 2W2XD 5LOPB 2GCLA 1XX0A 2EJ8A 2ROVA 5C6RA 2EMSA 5HE0A 3FSSA 2VSZA 2LULA 1W1DA 3T06A 2W2WA 2XQNM 2VRWB 5CLQB 2I1JA 4WJ7A 1UPQA 2DKQA 2J59M 5D3WA 1P6SA 3N7CA 2V76A 4ZRJA 5C5BA 2R0DA 4DBBA 2HE7A 4MT7A 2YT0A 5FI0A 1TQZA 2YS3A 4P7IA 1MIZB 4H8SA 2YSZA 2LG1A 3D8EA 4GN1A 1U5DA 1NI2A 2R09A 3SYXA 2D4QA 1V5UA 2DHJA 2RVBB 3AJ4A 1FGYA 3AU4A 5JP4A 3MPXA 4HAYB 3ZVRA 4K2OA 1FGZA 1Y19B 1WJMA 5KQ1A 5FI1A 4NSWA 5C5BB 4K2PA 5D3XA 3KRXA 4K17A 2ELAA 2UZSA 4HB2B 4B6HA 2P0FA 5JLJB 5KQ4A 4D0NB 2YS1A 2H7EA 4HB0B 2DYQA 1J0WA 4BBKA 3PP2A 2M14A 4F7GA 2NMBA 4MY6A 1Y5OA 2H7DA 1NU2A 1DBHA 3TCAA 4F7UP 1MPHA 1WGUA 4PNKA 2EC1A 3V5WA 3PEGA 5EFXA 4YL8A 4A6HA 3D8FA 2KGXB 3PG7A 2YVCA 4KVGB 2CY5A 2OQBA 3HW2B 2G35A 2J0MA 1MIXA 1I7AA 4DX8A 2K2JA 4C0AA 2YF0A 2D11A 3A8PA 3A8QA 4KHAA 2I5FA 2M38A 2E2XA 4PQ0A 5DHAB 1BWNA 3QIJA 3KRWA 3ULBA 1V61A 1UPRA 2DN6A 5J3YA 2MKRA 3ZDTA 1U29A 5CLLB 2GCJA 4KAXB 2Y8GA 3P6AA 2CRFA 5DIFB 2D9ZA 1BTNA 1ISNA 2DX5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LW3 A;  2Q13 A;  1AWE A;  2P0D A;  1SHC A;  2RNR B;  2DHI A;  2YRY A;  1P5T A;  2LKO A;  3ODO A;  4HDQ A;  4K81 A;  4Y94 A;  4CHJ A;  2DHK A;  2ZPY A;  2GS0 A;  2AL6 A;  1U27 A;  1V5P A;  4GMV A;  2LYD A;  3VOQ A;  5GOW B;  3PSC A;  1OMW A;  4MK0 A;  1IRS A;  5DI9 B;  1Q67 A;  2DKP A;  5J3T A;  2Z0Q A;  4GZU A;  1FHX A;  2AEH A;  2DX1 A;  2D9X A;  2K2U A;  1TXD A;  4A6F A;  2KCJ A;  1XOD A;  3F5R A;  2D9W A;  3TO1 A;  2YT1 A;  3U7D A;  1I2H A;  2PZ1 A;  3KSY A;  2LOZ A;  1MK7 B;  5JHH A;  2DTC A;  2DLW A;  2GJY A;  2N23 A;  3ODX A;  4DX9 0;  1KI1 B;  1XD4 A;  4WVF B;  3PVW A;  1XCG A;  2CY4 A;  1DDV A;  1FHW A;  1M7R A;  3TFM A;  3G9W A;  4EJN A;  2COD A;  1E5W A;  2ELB A;  3GYO A;  1QC6 A;  1U5F A;  2CAY A;  3GYP A;  3CIK A;  1OY2 A;  4F7H A;  2YS5 A;  4NY0 A;  4HB3 B;  1ZSQ A;  3TW1 A;  1X86 A;  1W1G A;  1DYN A;  4A6K A;  3PVU A;  2DFK A;  3WYF B;  1H4R A;  1J19 A;  3MDB C;  1WG7 A;  4EKU A;  1UNQ A;  2BCJ A;  2KUP A;  4HAV B;  3D8D A;  1BTK A;  1KZ7 A;  4HAZ B;  1ZM0 A;  1MAI A;  1EVH A;  3BJI A;  3U8Z A;  1U5G A;  3QBV B;  3TVV A;  1WVH A;  1QQG A;  3A98 B;  2D10 A;  1ZC4 B;  1UNR A;  1U5E A;  1AQC A;  1FOE A;  1XR0 B;  5JHG A;  1U2B A;  2IFS A;  2P0H A;  2K00 A;  2P8V A;  2D2Q A;  5LON B;  3DXD A;  3UZT A;  4TKN A;  2D9Y A;  3NSU A;  2ADZ A;  5HE3 A;  1DRO A;  1B55 A;  4HB4 B;  1LB1 A;  5D27 A;  1EGX A;  1WGQ A;  3F0W A;  4KHB B;  1ZVR A;  1EAZ A;  3SO6 A;  1Z87 A;  4KHO A;  2L1C A;  4GMX B;  3HK0 A;  3PZD A;  1PMS A;  3HQC A;  4HDO A;  3IVF A;  4HAU B;  3BIN A;  3P7Z A;  1GG3 A;  3KZ1 A;  5D3Y A;  2JP2 A;  1UEF A;  2Z0P A;  1FB8 A;  2HTH B;  2OTX A;  5C16 A;  3CXB B;  1P3R A;  3FEH A;  2COA A;  4CHM A;  2MDX A;  2D9V A;  1FAO A;  4HAW B;  5HE1 A;  3SNH A;  2J0K A;  4DXA B;  1V89 A;  1FHO A;  1X05 A;  4TYZ A;  2QKL A;  2J0J A;  2UVM A;  1KZG A;  2COC A;  1WI1 A;  2ROZ B;  3LJU X;  4HAX B;  2LOX A;  2W2X C;  1WJ1 A;  2Y8F A;  5J3Q A;  4Z2M B;  1RRP B;  1V88 A;  2I5C A;  2Z0O A;  1DDW A;  4Z2N A;  4GXB A;  4HAT B;  5L81 A;  2IYB A;  2RLO A;  5HE2 A;  3X23 A;  4A6F B;  3OAN A;  3O96 A;  3SUZ A;  4YON A;  1GC7 A;  1ZC3 B;  4ZRK A;  1PLS A;  1W1H A;  4HHV A;  1NTY A;  1X1G A;  1K5D B;  1TJ6 A;  2I1K A;  5D3V A;  1SGH A;  1X11 A;  2RSG A;  3PVL A;  3DXC A;  2RUK B;  2FJL A;  4IFS A;  1BAK A;  5DHF B;  4GPT B;  1H10 A;  3SV1 A;  1X1F A;  4XWX A;  5KCV A;  1PFJ A;  1XKE A;  2VKI A;  1M7E A;  1RJ2 A;  4EMO A;  1GC6 A;  2DYN A;  3RCP A;  2N0Y A;  3QWM A;  3M1I B;  5C79 A;  4IAP A;  2Y7B A;  1N3H A;  2QKM A;  2RGN B;  1EF1 A;  1K5G B;  4WSF A;  2UZR A;  1NTV A;  3VIA A;  1MKE A;  3DXE A;  2MFQ A;  2DA0 A;  3AU5 A;  1DDM A;  4CYE A;  1UNP A;  3ODW A;  3WA0 A;  3FM8 C;  2L2I A;  3ULC A;  1OQN A;  3KY9 A;  3ML4 A;  1MK9 B;  4L6E A;  1V5M A;  4A5K A;  2EMT A;  4IOY X;  2MWN B;  2NZ8 B;  2X18 A;  5DH9 B;  4ZRI A;  2COF A;  2W2X D;  5LOP B;  2GCL A;  1XX0 A;  2EJ8 A;  2ROV A;  5C6R A;  2EMS A;  5HE0 A;  3FSS A;  2VSZ A;  2LUL A;  1W1D A;  3T06 A;  2W2W A;  2XQN M;  2VRW B;  5CLQ B;  2I1J A;  4WJ7 A;  1UPQ A;  2DKQ A;  2J59 M;  5D3W A;  1P6S A;  3N7C A;  2V76 A;  4ZRJ A;  5C5B A;  2R0D A;  4DBB A;  2HE7 A;  4MT7 A;  2YT0 A;  5FI0 A;  1TQZ A;  2YS3 A;  4P7I A;  1MIZ B;  4H8S A;  2YSZ A;  2LG1 A;  3D8E A;  4GN1 A;  1U5D A;  1NI2 A;  2R09 A;  3SYX A;  2D4Q A;  1V5U A;  2DHJ A;  2RVB B;  3AJ4 A;  1FGY A;  3AU4 A;  5JP4 A;  3MPX A;  4HAY B;  3ZVR A;  4K2O A;  1FGZ A;  1Y19 B;  1WJM A;  5KQ1 A;  5FI1 A;  4NSW A;  5C5B B;  4K2P A;  5D3X A;  3KRX A;  4K17 A;  2ELA A;  2UZS A;  4HB2 B;  4B6H A;  2P0F A;  5JLJ B;  5KQ4 A;  4D0N B;  2YS1 A;  2H7E A;  4HB0 B;  2DYQ A;  1J0W A;  4BBK A;  3PP2 A;  2M14 A;  4F7G A;  2NMB A;  4MY6 A;  1Y5O A;  2H7D A;  1NU2 A;  1DBH A;  3TCA A;  4F7U P;  1MPH A;  1WGU A;  4PNK A;  2EC1 A;  3V5W A;  3PEG A;  5EFX A;  4YL8 A;  4A6H A;  3D8F A;  2KGX B;  3PG7 A;  2YVC A;  4KVG B;  2CY5 A;  2OQB A;  3HW2 B;  2G35 A;  2J0M A;  1MIX A;  1I7A A;  4DX8 A;  2K2J A;  4C0A A;  2YF0 A;  2D11 A;  3A8P A;  3A8Q A;  4KHA A;  2I5F A;  2M38 A;  2E2X A;  4PQ0 A;  5DHA B;  1BWN A;  3QIJ A;  3KRW A;  3ULB A;  1V61 A;  1UPR A;  2DN6 A;  5J3Y A;  2MKR A;  3ZDT A;  1U29 A;  5CLL B;  2GCJ A;  4KAX B;  2Y8G A;  3P6A A;  2CRF A;  5DIF B;  2D9Z A;  1BTN A;  1ISN A;  2DX5 A; 
#chains in the Genus database with same CATH topology
 1LW3 A;  2Q13 A;  1AWE A;  2K49 A;  2P0D A;  1ZYI A;  1SHC A;  2RNR B;  2DHI A;  2YRY A;  1P5T A;  2LKO A;  3ODO A;  4HDQ A;  4K81 A;  4Y94 A;  4CHJ A;  2DHK A;  2ZPY A;  2GS0 A;  2AL6 A;  1U27 A;  1V5P A;  4CSQ A;  4GMV A;  2LYD A;  3VOQ A;  5GOW B;  2YT2 A;  3PSC A;  1OMW A;  4MK0 A;  1IRS A;  5DI9 B;  1Q67 A;  4GOU A;  2DKP A;  5J3T A;  2Z0Q A;  4GZU A;  1FHX A;  2AEH A;  2DX1 A;  2D9X A;  2K2U A;  1TXD A;  3OHM B;  4A6F A;  2KCJ A;  1XOD A;  3F5R A;  2D9W A;  3TO1 A;  2YT1 A;  3U7D A;  1I2H A;  2PZ1 A;  3KSY A;  2LOZ A;  1MK7 B;  5JHH A;  2DTC A;  2DLW A;  2GJY A;  2N23 A;  3ODX A;  4DX9 0;  1KI1 B;  1XD4 A;  4WVF B;  3PVW A;  1XCG A;  2CY4 A;  1DDV A;  1FHW A;  1M7R A;  3TFM A;  3G9W A;  4EJN A;  2COD A;  1E5W A;  2ZKM X;  2ELB A;  3GYO A;  1QC6 A;  1U5F A;  2CAY A;  3GYP A;  3CIK A;  1OY2 A;  4F7H A;  2YS5 A;  4NY0 A;  5M4Y B;  4HB3 B;  1ZSQ A;  3TW1 A;  1X86 A;  1W1G A;  1DYN A;  4A6K A;  3PVU A;  2DFK A;  3WYF B;  1H4R A;  1J19 A;  3MDB C;  1WG7 A;  4EKU A;  4L1R A;  1UNQ A;  2BCJ A;  2KUP A;  4HAV B;  3D8D A;  4KHB A;  1BTK A;  1KZ7 A;  4HAZ B;  1ZM0 A;  1MAI A;  1EVH A;  3BJI A;  3U8Z A;  1U5G A;  3QBV B;  3TVV A;  1WVH A;  1QQG A;  3A98 B;  2D10 A;  1ZC4 B;  1UNR A;  1U5E A;  1AQC A;  1FOE A;  1XR0 B;  5JHG A;  1U2B A;  2IFS A;  2P0H A;  2K00 A;  4D6W A;  2P8V A;  2D2Q A;  5LON B;  3DXD A;  3UZT A;  4TKN A;  2D9Y A;  3NSU A;  5I2S A;  2ADZ A;  5HE3 A;  1DRO A;  1B55 A;  4HB4 B;  1LB1 A;  5D27 A;  1EGX A;  1WGQ A;  3F0W A;  4KHB B;  1ZVR A;  1EAZ A;  3SO6 A;  1Z87 A;  4KHO A;  2L1C A;  4GMX B;  3HK0 A;  3PZD A;  1PMS A;  2KUQ A;  3HQC A;  4HDO A;  3IVF A;  4HAU B;  3BIN A;  3P7Z A;  1GG3 A;  3KZ1 A;  5D3Y A;  2JP2 A;  1UEF A;  2Z0P A;  1FB8 A;  2HTH B;  2OTX A;  5C16 A;  3CXB B;  1P3R A;  2Z14 A;  3FEH A;  2COA A;  4CHM A;  2MDX A;  2NBV A;  2D9V A;  4QJ4 B;  1FAO A;  4HAW B;  5HE1 A;  3SNH A;  2J0K A;  4DXA B;  1V89 A;  1FHO A;  1X05 A;  4TYZ A;  2QKL A;  2J0J A;  2UVM A;  4QJ5 B;  4OSN A;  1KZG A;  2COC A;  1WI1 A;  2ROZ B;  3LJU X;  4HAX B;  2LOX A;  2W2X C;  1WJ1 A;  2Y8F A;  3NWA A;  4OT1 A;  5J3Q A;  4Z2M B;  1RRP B;  1V88 A;  2I5C A;  2Z0O A;  1DDW A;  4Z2N A;  5LG4 B;  4GXB A;  4HAT B;  5L81 A;  2IYB A;  2RLO A;  5HE2 A;  3X23 A;  4A6F B;  3NWD A;  3OAN A;  3O96 A;  3SUZ A;  4YON A;  2R2Y A;  1GC7 A;  1ZC3 B;  4ZRK A;  1PLS A;  1W1H A;  4HHV A;  1NTY A;  1X1G A;  1K5D B;  1TJ6 A;  2I1K A;  5D3V A;  1SGH A;  1X11 A;  2RSG A;  3PVL A;  3DXC A;  2RUK B;  2FJL A;  4IFS A;  1BAK A;  5DHF B;  4GPT B;  1H10 A;  2GUM A;  3SV1 A;  1X1F A;  2Z4D A;  3A58 A;  4XWX A;  5KCV A;  1PFJ A;  1XKE A;  2VKI A;  1M7E A;  1RJ2 A;  4EMO A;  1GC6 A;  2DYN A;  3B77 A;  3RCP A;  2N0Y A;  3QWM A;  3M1I B;  5C79 A;  4IAP A;  2Y7B A;  1N3H A;  2QKM A;  2RGN B;  1EF1 A;  1K5G B;  2RRF A;  4WSF A;  2UZR A;  1NTV A;  3FVC A;  3VIA A;  1MKE A;  3DXE A;  3DCX A;  2MFQ A;  2DA0 A;  3AU5 A;  1DDM A;  4CYE A;  1UNP A;  1T77 A;  3ODW A;  3WA0 A;  3FM8 C;  2L2I A;  3ULC A;  1OQN A;  3KY9 A;  3ML4 A;  1MK9 B;  4L6E A;  1V5M A;  4A5K A;  2EMT A;  3NWF A;  4IOY X;  2MWN B;  2NZ8 B;  2X18 A;  5DH9 B;  4ZRI A;  2COF A;  2W2X D;  5LOP B;  2GCL A;  1XX0 A;  2EJ8 A;  2ROV A;  5C6R A;  2EMS A;  5HE0 A;  3FSS A;  2VSZ A;  2K8E A;  1W1D A;  2LUL A;  3T06 A;  2W2W A;  2XQN M;  2VRW B;  5CLQ B;  2I1J A;  4WJ7 A;  1UPQ A;  2DKQ A;  2J59 M;  5D3W A;  2KIG A;  1P6S A;  3N7C A;  2V76 A;  4ZRJ A;  5C5B A;  4QJ3 B;  2R0D A;  5I2M A;  5IRS A;  4DBB A;  2HE7 A;  3HSA A;  4MT7 A;  2YT0 A;  5FI0 A;  1TQZ A;  2YS3 A;  4P7I A;  1MIZ B;  4H8S A;  4QXA B;  2Z13 A;  2YSZ A;  2LG1 A;  3D8E A;  4GN1 A;  1U5D A;  1NI2 A;  2R09 A;  3SYX A;  2D4Q A;  1V5U A;  2DHJ A;  2RVB B;  3AJ4 A;  1FGY A;  3AU4 A;  5JP4 A;  3MPX A;  4HAY B;  3ZVR A;  4K2O A;  1FGZ A;  1Y19 B;  1WJM A;  5KQ1 A;  5FI1 A;  4NSW A;  5C5B B;  4K2P A;  5D3X A;  3KRX A;  4GNK B;  4K17 A;  2ELA A;  2Z59 A;  2UZS A;  4HB2 B;  4B6H A;  2P0F A;  5JLJ B;  5KQ4 A;  4D0N B;  2YS1 A;  2KR0 A;  2H7E A;  4HB0 B;  2DYQ A;  1J0W A;  4BBK A;  3PP2 A;  1MI1 A;  2M14 A;  4F7G A;  2NMB A;  2FJU B;  4MY6 A;  1Y5O A;  2H7D A;  1NU2 A;  4DIX A;  3NW8 A;  1DBH A;  3TCA A;  4F7U P;  1MPH A;  1WGU A;  4PNK A;  2EC1 A;  3V5W A;  3PEG A;  3U12 A;  5EFX A;  4YL8 A;  4A6H A;  3D8F A;  2KGX B;  3PG7 A;  4HSI A;  2YVC A;  4KVG B;  2CY5 A;  2OQB A;  3HW2 B;  2G35 A;  2J0M A;  1MIX A;  1I7A A;  4DX8 A;  2K2J A;  4C0A A;  2YF0 A;  2D11 A;  3A8P A;  3A8Q A;  4KHA A;  2I5F A;  2M38 A;  2E2X A;  4PQ0 A;  5DHA B;  3HIE A;  1BWN A;  3QIJ A;  3KRW A;  3ULB A;  1V61 A;  1UPR A;  2DN6 A;  5J3Y A;  2MKR A;  3ZDT A;  1U29 A;  5CLL B;  2GCJ A;  4KAX B;  2Y8G A;  3P6A A;  2KIE A;  2CRF A;  5DIF B;  2D9Z A;  1BTN A;  1ISN A;  2DX5 A; 
#chains in the Genus database with same CATH homology
 1LW3 A;  2Q13 A;  1AWE A;  2P0D A;  1SHC A;  2RNR B;  2DHI A;  2YRY A;  1P5T A;  2LKO A;  3ODO A;  4HDQ A;  4K81 A;  4Y94 A;  4CHJ A;  2DHK A;  2ZPY A;  2GS0 A;  2AL6 A;  1U27 A;  1V5P A;  4GMV A;  2LYD A;  3VOQ A;  5GOW B;  3PSC A;  1OMW A;  4MK0 A;  1IRS A;  5DI9 B;  1Q67 A;  2DKP A;  5J3T A;  2Z0Q A;  4GZU A;  1FHX A;  2AEH A;  2DX1 A;  2D9X A;  2K2U A;  1TXD A;  4A6F A;  2KCJ A;  1XOD A;  3F5R A;  2D9W A;  3TO1 A;  2YT1 A;  3U7D A;  1I2H A;  2PZ1 A;  3KSY A;  2LOZ A;  1MK7 B;  5JHH A;  2DTC A;  2DLW A;  2GJY A;  2N23 A;  3ODX A;  4DX9 0;  1KI1 B;  1XD4 A;  4WVF B;  3PVW A;  1XCG A;  2CY4 A;  1DDV A;  1FHW A;  1M7R A;  3TFM A;  3G9W A;  4EJN A;  2COD A;  1E5W A;  2ELB A;  3GYO A;  1QC6 A;  1U5F A;  2CAY A;  3GYP A;  3CIK A;  1OY2 A;  4F7H A;  2YS5 A;  4NY0 A;  4HB3 B;  1ZSQ A;  3TW1 A;  1X86 A;  1W1G A;  1DYN A;  4A6K A;  3PVU A;  2DFK A;  3WYF B;  1H4R A;  1J19 A;  3MDB C;  1WG7 A;  4EKU A;  1UNQ A;  2BCJ A;  2KUP A;  4HAV B;  3D8D A;  1BTK A;  1KZ7 A;  4HAZ B;  1ZM0 A;  1MAI A;  1EVH A;  3BJI A;  3U8Z A;  1U5G A;  3QBV B;  3TVV A;  1WVH A;  1QQG A;  3A98 B;  2D10 A;  1ZC4 B;  1UNR A;  1U5E A;  1AQC A;  1FOE A;  1XR0 B;  5JHG A;  1U2B A;  2IFS A;  2P0H A;  2K00 A;  2P8V A;  2D2Q A;  5LON B;  3DXD A;  3UZT A;  4TKN A;  2D9Y A;  3NSU A;  2ADZ A;  5HE3 A;  1DRO A;  1B55 A;  4HB4 B;  1LB1 A;  5D27 A;  1EGX A;  1WGQ A;  3F0W A;  4KHB B;  1ZVR A;  1EAZ A;  3SO6 A;  1Z87 A;  4KHO A;  2L1C A;  4GMX B;  3HK0 A;  3PZD A;  1PMS A;  3HQC A;  4HDO A;  3IVF A;  4HAU B;  3BIN A;  3P7Z A;  1GG3 A;  3KZ1 A;  5D3Y A;  2JP2 A;  1UEF A;  2Z0P A;  1FB8 A;  2HTH B;  2OTX A;  5C16 A;  3CXB B;  1P3R A;  3FEH A;  2COA A;  4CHM A;  2MDX A;  2D9V A;  1FAO A;  4HAW B;  5HE1 A;  3SNH A;  2J0K A;  4DXA B;  1V89 A;  1FHO A;  1X05 A;  4TYZ A;  2QKL A;  2J0J A;  2UVM A;  1KZG A;  2COC A;  1WI1 A;  2ROZ B;  3LJU X;  4HAX B;  2LOX A;  2W2X C;  1WJ1 A;  2Y8F A;  5J3Q A;  4Z2M B;  1RRP B;  1V88 A;  2I5C A;  2Z0O A;  1DDW A;  4Z2N A;  4GXB A;  4HAT B;  5L81 A;  2IYB A;  2RLO A;  5HE2 A;  3X23 A;  4A6F B;  3OAN A;  3O96 A;  3SUZ A;  4YON A;  1GC7 A;  1ZC3 B;  4ZRK A;  1PLS A;  1W1H A;  4HHV A;  1NTY A;  1X1G A;  1K5D B;  1TJ6 A;  2I1K A;  5D3V A;  1SGH A;  1X11 A;  2RSG A;  3PVL A;  3DXC A;  2RUK B;  2FJL A;  4IFS A;  1BAK A;  5DHF B;  4GPT B;  1H10 A;  3SV1 A;  1X1F A;  4XWX A;  5KCV A;  1PFJ A;  1XKE A;  2VKI A;  1M7E A;  1RJ2 A;  4EMO A;  1GC6 A;  2DYN A;  3RCP A;  2N0Y A;  3QWM A;  3M1I B;  5C79 A;  4IAP A;  2Y7B A;  1N3H A;  2QKM A;  2RGN B;  1EF1 A;  1K5G B;  4WSF A;  2UZR A;  1NTV A;  3VIA A;  1MKE A;  3DXE A;  2MFQ A;  2DA0 A;  3AU5 A;  1DDM A;  4CYE A;  1UNP A;  3ODW A;  3WA0 A;  3FM8 C;  2L2I A;  3ULC A;  1OQN A;  3KY9 A;  3ML4 A;  1MK9 B;  4L6E A;  1V5M A;  4A5K A;  2EMT A;  4IOY X;  2MWN B;  2NZ8 B;  2X18 A;  5DH9 B;  4ZRI A;  2COF A;  2W2X D;  5LOP B;  2GCL A;  1XX0 A;  2EJ8 A;  2ROV A;  5C6R A;  2EMS A;  5HE0 A;  3FSS A;  2VSZ A;  2LUL A;  1W1D A;  3T06 A;  2W2W A;  2XQN M;  2VRW B;  5CLQ B;  2I1J A;  4WJ7 A;  1UPQ A;  2DKQ A;  2J59 M;  5D3W A;  1P6S A;  3N7C A;  2V76 A;  4ZRJ A;  5C5B A;  2R0D A;  4DBB A;  2HE7 A;  4MT7 A;  2YT0 A;  5FI0 A;  1TQZ A;  2YS3 A;  4P7I A;  1MIZ B;  4H8S A;  2YSZ A;  2LG1 A;  3D8E A;  4GN1 A;  1U5D A;  1NI2 A;  2R09 A;  3SYX A;  2D4Q A;  1V5U A;  2DHJ A;  2RVB B;  3AJ4 A;  1FGY A;  3AU4 A;  5JP4 A;  3MPX A;  4HAY B;  3ZVR A;  4K2O A;  1FGZ A;  1Y19 B;  1WJM A;  5KQ1 A;  5FI1 A;  4NSW A;  5C5B B;  4K2P A;  5D3X A;  3KRX A;  4K17 A;  2ELA A;  2UZS A;  4HB2 B;  4B6H A;  2P0F A;  5JLJ B;  5KQ4 A;  4D0N B;  2YS1 A;  2H7E A;  4HB0 B;  2DYQ A;  1J0W A;  4BBK A;  3PP2 A;  2M14 A;  4F7G A;  2NMB A;  4MY6 A;  1Y5O A;  2H7D A;  1NU2 A;  1DBH A;  3TCA A;  4F7U P;  1MPH A;  1WGU A;  4PNK A;  2EC1 A;  3V5W A;  3PEG A;  5EFX A;  4YL8 A;  4A6H A;  3D8F A;  2KGX B;  3PG7 A;  2YVC A;  4KVG B;  2CY5 A;  2OQB A;  3HW2 B;  2G35 A;  2J0M A;  1MIX A;  1I7A A;  4DX8 A;  2K2J A;  4C0A A;  2YF0 A;  2D11 A;  3A8P A;  3A8Q A;  4KHA A;  2I5F A;  2M38 A;  2E2X A;  4PQ0 A;  5DHA B;  1BWN A;  3QIJ A;  3KRW A;  3ULB A;  1V61 A;  1UPR A;  2DN6 A;  5J3Y A;  2MKR A;  3ZDT A;  1U29 A;  5CLL B;  2GCJ A;  4KAX B;  2Y8G A;  3P6A A;  2CRF A;  5DIF B;  2D9Z A;  1BTN A;  1ISN A;  2DX5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...