2OTXA

Crystal structure of a n-terminal fragment of skap-hom containing both the helical dimerization domain and the ph domain
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
211
structure length
170
Chain Sequence
b'GSPEEIRNLLADVETFVADTLKGENLSKKAKEKRESLIKKIKDVKSVYLQEFQFPPIAAQDLPFVIKAGYLEKRRKDHSFLGFEWQKRWCALSKTVFYYYGSDKDKQQKGEFAIDGYDVRMNNTLRKDGKKDCCFEICAPDKRIYQFTAASPKDAEEWVQQLKFILQDLG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Src kinase-associated phosphoprotein 2
publication title The Skap-hom dimerization and PH domains comprise a 3'-phosphoinositide-gated molecular switch.
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
total genus 54
structure length 170
sequence length 211
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2otxA02
3N7CA 2DA0A 5DI9B 1U2BA 2MDXA 3TW1A 4CHMA 3IVFA 2J59M 2JP2A 2RLOA 3V5WA 2IYBA 1NTVA 4PQ0A 3CXBB 5D27A 3A98B 1XCGA 4DXAB 1Q67A 4A6FA 1WI1A 5KCVA 3U8ZA 5CLQB 1ISNA 1X05A 4IOYX 1ZM0A 4GXBA 2D9YA 1K5GB 1V5UA 2LULA 1DROA 3SNHA 1MKEA 3ULBA 3HW2B 3QWMA 2M38A 4TKNA 1V88A 5HE1A 3BINA 1W1DA 1PFJA 2OQBA 5JHHA 3CIKA 3HQCA 3ZVRA 3SV1A 1DYNA 2COFA 4P7IA 5D3YA 2J0MA 1RRPB 2GCJA 1K5DB 2L2IA 3SUZA 1UPQA 2DKQA 1NTYA 4A6HA 1ZC3B 2MFQA 1OQNA 4NY0A 4HB4B 1GG3A 3ML4A 1NU2A 1X86A 3FM8C 3M1IB 3ODXA 5D3XA 4K81A 4Y94A 2EMTA 2CY4A 2UZSA 5C79A 1DDWA 2DYQA 1M7RA 3TFMA 5C5BB 3QBVB 3KSYA 3PVUA 1KZ7A 1UEFA 4YONA 4A6KA 2GCLA 1V89A 1PLSA 1ZSQA 3RCPA 1P5TA 2E2XA 5L81A 4HAYB 2Y8FA 5DIFB 1BTNA 4KHOA 3PVLA 4Z2NA 2KGXB 3UZTA 2ZPYA 2I5FA 3QIJA 2N23A 1TJ6A 4B6HA 3LJUX 4IAPA 5GOWB 3HK0A 1H4RA 4CYEA 4HDOA 4EKUA 1W1HA 1U5GA 1WJ1A 2LYDA 1QC6A 2P0DA 2DHKA 3G9WA 2OTXA 4TYZA 1U5DA 2H7DA 4YL8A 3X23A 2NZ8B 1GC7A 2Y8GA 5HE0A 4KHAA 3WA0A 1UNRA 5J3YA 4HAUB 1AWEA 1ZC4B 2D10A 1M7EA 2KUPA 1BTKA 3F5RA 1I2HA 1U5EA 4KVGB 1MAIA 2DYNA 1FOEA 1BAKA 3P6AA 4DX90 5LONB 5J3TA 5D3WA 3MDBC 5DHFB 2YVCA 3TCAA 2G35A 4HAWB 4K2OA 4D0NB 3DXCA 1DDMA 1OMWA 5DH9B 2ADZA 4EMOA 3ULCA 2D9WA 4F7GA 2EJ8A 1UPRA 1KZGA 2MKRA 3T06A 1MPHA 2RGNB 4GMVA 1EAZA 4HHVA 1LW3A 2Q13A 4WJ7A 2LOXA 2W2XD 3P7ZA 2RVBB 1RJ2A 1V61A 2R0DA 2D2QA 2ELBA 5CLLB 3TVVA 3AJ4A 3D8EA 2D11A 1MIXA 2YSZA 2LG1A 2D9XA 1UNPA 4IFSA 2W2XC 2RSGA 2I5CA 2YS1A 4MK0A 1EGXA 2QKLA 2UVMA 4H8SA 3SO6A 4DX8A 1P3RA 2LOZA 2DLWA 4BBKA 5FI1A 1FB8A 3OANA 3MPXA 3FEHA 2CAYA 1U27A 3VIAA 2N0YA 4K2PA 5HE2A 1J0WA 2P0HA 5KQ1A 2I1KA 1P6SA 2KCJA 1WG7A 1LB1A 5C6RA 5C16A 2YT1A 4GN1A 4F7UP 3D8DA 2YF0A 2DHIA 2Y7BA 4L6EA 1Y19B 5DHAB 1X1FA 2Z0PA 5HE3A 3PVWA 1X1GA 3PSCA 2COCA 1E5WA 1IRSA 5JP4A 5EFXA 1SGHA 1WGUA 4WVFB 4F7HA 1TXDA 5KQ4A 5C5BA 3ODWA 4A5KA 1FHXA 2HTHB 2P0FA 2DHJA 2HE7A 1B55A 4Z2MB 1WVHA 3GYPA 2X18A 2VRWB 4A6FB 4NSWA 1U29A 2AL6A 1MK7B 1MIZB 2I1JA 3F0WA 3DXDA 2DX5A 3FSSA 2R09A 3ZDTA 1X11A 2DN6A 2AEHA 4HAZB 3O96A 2K2UA 1V5MA 2V76A 1XR0B 4HAVB 4PNKA 5LOPB 3PZDA 4GZUA 2D9ZA 4HDQA 1U5FA 3NSUA 5JHGA 3TO1A 1DDVA 2J0JA 4HB0B 1NI2A 1WJMA 2L1CA 4CHJA 1ZVRA 2P8VA 2COAA 3KY9A 1AQCA 2IFSA 2VKIA 2QKMA 2MWNB 4ZRIA 2CRFA 2GS0A 3KZ1A 1XD4A 5FI0A 2NMBA 4K17A 4WSFA 3SYXA 2YS5A 4KHBB 1Z87A 2VSZA 4DBBA 2H7EA 1EF1A 4GMXB 1H10A 2RUKB 1WGQA 1FHOA 2Z0QA 4GPTB 2K2JA 2ROVA 2M14A 3BJIA 1XX0A 1I7AA 4ZRJA 4KAXB 1V5PA 4EJNA 1W1GA 2XQNM 2EC1A 2D9VA 2DX1A 2YS3A 2ROZB 1MK9B 3U7DA 2W2WA 2DKPA 2YRYA 2RNRB 2UZRA 4MT7A 2CODA 4ZRKA 4MY6A 1UNQA 3DXEA 4XWXA 1FAOA 2D4QA 3GYOA 1PMSA 4HAXB 2J0KA 4HB3B 2BCJA 3PP2A 2FJLA 2DFKA 2EMSA 2PZ1A 3ODOA 1KI1B 1XODA 1SHCA 2ELAA 1OY2A 5J3QA 3A8PA 1BWNA 3AU4A 2LKOA 2DTCA 1FGYA 1EVHA 1Y5OA 2GJYA 1FHWA 3A8QA 5JLJB 1QQGA 1DBHA 1XKEA 1N3HA 1J19A 2K00A 3D8FA 4HB2B 2CY5A 1GC6A 3AU5A 4HATB 3PEGA 4C0AA 5D3VA 3VOQA 3PG7A 1TQZA 1FGZA 2Z0OA 2YT0A 3KRXA 3WYFB 3KRWA
chains in the Genus database with same CATH superfamily
3N7CA 2DA0A 5DI9B 1U2BA 2MDXA 3TW1A 4CHMA 3IVFA 2J59M 3A58A 2JP2A 2RLOA 3V5WA 2IYBA 1NTVA 3NWFA 4D6WA 4PQ0A 3CXBB 5D27A 2GUMA 3A98B 1XCGA 4DXAB 1Q67A 4A6FA 1WI1A 5KCVA 3NWAA 3U8ZA 5CLQB 1ISNA 1X05A 4IOYX 1ZM0A 4GXBA 2D9YA 1K5GB 1V5UA 2LULA 1DROA 3SNHA 1MKEA 3ULBA 3HW2B 4QXAB 3QWMA 2M38A 4TKNA 1V88A 5HE1A 3BINA 1W1DA 1PFJA 4QJ4B 2OQBA 5JHHA 3CIKA 3HQCA 3ZVRA 3SV1A 1DYNA 2COFA 4P7IA 5D3YA 2J0MA 1RRPB 2ZKMX 2GCJA 1K5DB 2L2IA 3SUZA 1UPQA 2DKQA 1NTYA 4A6HA 1ZC3B 2MFQA 1OQNA 4NY0A 4HB4B 1GG3A 3ML4A 1NU2A 1X86A 3FM8C 3M1IB 3ODXA 4HSIA 5D3XA 4K81A 4Y94A 2EMTA 2CY4A 5IRSA 2UZSA 5C79A 1DDWA 2DYQA 1M7RA 3TFMA 5C5BB 3QBVB 3KSYA 3PVUA 1KZ7A 2YT2A 1UEFA 4YONA 4A6KA 2GCLA 1V89A 1PLSA 1ZSQA 3KRXA 3RCPA 1P5TA 5M4YB 2E2XA 5L81A 4HAYB 3HSAA 2Y8FA 5DIFB 1BTNA 4KHOA 3PVLA 4Z2NA 2KGXB 3UZTA 2ZPYA 2I5FA 3QIJA 2N23A 1TJ6A 4B6HA 3LJUX 4IAPA 5GOWB 3HK0A 1H4RA 4CYEA 4HDOA 4EKUA 1W1HA 1U5GA 1WJ1A 2LYDA 2K8EA 1QC6A 2P0DA 2DHKA 3G9WA 3U12A 2OTXA 3NWDA 4TYZA 1U5DA 2H7DA 4YL8A 3X23A 2NZ8B 1GC7A 2Y8GA 5HE0A 4KHAA 3WA0A 1UNRA 2KIEA 5J3YA 4HAUB 1AWEA 1ZC4B 2D10A 1M7EA 2KUPA 2NBVA 1BTKA 3F5RA 1I2HA 1U5EA 4KVGB 1MAIA 2DYNA 1FOEA 1BAKA 4GOUA 3P6AA 4DX90 5LONB 5J3TA 5D3WA 3MDBC 5DHFB 4CSQA 2YVCA 3TCAA 2G35A 4HAWB 4K2OA 4D0NB 3DXCA 1DDMA 1OMWA 5DH9B 2ADZA 4EMOA 3ULCA 2D9WA 4F7GA 2EJ8A 1UPRA 1KZGA 2MKRA 3T06A 1MPHA 2RGNB 4GMVA 1EAZA 4HHVA 1LW3A 2Q13A 4WJ7A 2LOXA 2W2XD 2R2YA 3P7ZA 2RVBB 1RJ2A 1V61A 2R0DA 2D2QA 2ELBA 5CLLB 3TVVA 3D8EA 2Z4DA 5I2SA 2D11A 1MIXA 2YSZA 2LG1A 2D9XA 1UNPA 4IFSA 2W2XC 2RSGA 2I5CA 2YS1A 4MK0A 1EGXA 2QKLA 2UVMA 4H8SA 3SO6A 4KHBA 4DX8A 2FJUB 1P3RA 2LOZA 2DLWA 4BBKA 5FI1A 1FB8A 3OANA 3MPXA 3FEHA 2CAYA 1U27A 3VIAA 2N0YA 4K2PA 5HE2A 1J0WA 2KIGA 2P0HA 5KQ1A 2I1KA 1P6SA 2KCJA 1WG7A 2Z14A 1LB1A 5C6RA 5C16A 2YT1A 3DCXA 4GN1A 4F7UP 3D8DA 2YF0A 2DHIA 2Y7BA 4L6EA 1Y19B 5DHAB 2Z13A 3FVCA 1X1FA 2Z0PA 5HE3A 3PVWA 1X1GA 3PSCA 2COCA 1E5WA 1IRSA 5JP4A 5EFXA 1SGHA 1WGUA 4WVFB 4F7HA 1TXDA 5KQ4A 5C5BA 3ODWA 4A5KA 1FHXA 2HTHB 2P0FA 2DHJA 2HE7A 1B55A 4Z2MB 1WVHA 3GYPA 2X18A 3B77A 2VRWB 4A6FB 4NSWA 1U29A 4GNKB 2AL6A 1MK7B 1MIZB 2I1JA 1T77A 3F0WA 3DXDA 2DX5A 3FSSA 2R09A 4QJ3B 3ZDTA 1X11A 2DN6A 2AEHA 4HAZB 3O96A 2K2UA 1V5MA 2V76A 1XR0B 4HAVB 4PNKA 5LOPB 3PZDA 4GZUA 2D9ZA 4HDQA 1U5FA 3NSUA 5JHGA 3TO1A 1DDVA 2J0JA 4HB0B 1NI2A 1WJMA 2L1CA 4CHJA 1ZVRA 2P8VA 2COAA 2KUQA 3KY9A 1AQCA 2IFSA 2VKIA 2QKMA 2MWNB 4ZRIA 3HIEA 2CRFA 2GS0A 3KZ1A 1XD4A 5FI0A 2NMBA 4K17A 4WSFA 3SYXA 2YS5A 4KHBB 1Z87A 2VSZA 4DBBA 2H7EA 4L1RA 1EF1A 5LG4B 1ZYIA 4GMXB 1H10A 2RUKB 1WGQA 3NW8A 1FHOA 2Z0QA 4GPTB 2K2JA 2ROVA 2M14A 3BJIA 2RRFA 1XX0A 4DIXA 1I7AA 4ZRJA 4KAXB 1V5PA 4EJNA 5I2MA 1W1GA 2K49A 2XQNM 2EC1A 2D9VA 2DX1A 2YS3A 2ROZB 1MK9B 3U7DA 2W2WA 2DKPA 2YRYA 2RNRB 3OHMB 2UZRA 4MT7A 2CODA 4ZRKA 4MY6A 1UNQA 3DXEA 4XWXA 1FAOA 2D4QA 3GYOA 1PMSA 4HAXB 2J0KA 4HB3B 2BCJA 3PP2A 2FJLA 2DFKA 2EMSA 2PZ1A 4OT1A 3ODOA 1KI1B 1XODA 1SHCA 2ELAA 1OY2A 2Z59A 4OSNA 5J3QA 3A8PA 1BWNA 3AU4A 2LKOA 2DTCA 1FGYA 1EVHA 1Y5OA 2GJYA 1FHWA 3A8QA 5JLJB 1QQGA 1DBHA 2KR0A 1XKEA 1N3HA 1J19A 2K00A 3D8FA 4HB2B 1MI1A 2CY5A 1GC6A 3AU5A 4HATB 3PEGA 4C0AA 5D3VA 3VOQA 4QJ5B 3PG7A 1TQZA 1FGZA 2Z0OA 2YT0A 3AJ4A 3WYFB 3KRWA
chains in the Genus database with same CATH topology
3N7CA 2DA0A 5DI9B 1U2BA 2MDXA 3TW1A 4CHMA 3IVFA 2J59M 2JP2A 2RLOA 3V5WA 2IYBA 1NTVA 4PQ0A 3CXBB 5D27A 3A98B 1XCGA 4DXAB 1Q67A 4A6FA 1WI1A 5KCVA 3U8ZA 5CLQB 1ISNA 1X05A 4IOYX 1ZM0A 4GXBA 2D9YA 1K5GB 1V5UA 2LULA 1DROA 3SNHA 1MKEA 3ULBA 3HW2B 3QWMA 2M38A 4TKNA 1V88A 5HE1A 3BINA 1W1DA 1PFJA 2OQBA 5JHHA 3CIKA 3HQCA 3ZVRA 3SV1A 1DYNA 2COFA 4P7IA 5D3YA 2J0MA 1RRPB 2GCJA 1K5DB 2L2IA 3SUZA 1UPQA 2DKQA 1NTYA 4A6HA 1ZC3B 2MFQA 1OQNA 4NY0A 4HB4B 1GG3A 3ML4A 1NU2A 1X86A 3FM8C 3M1IB 3ODXA 5D3XA 4K81A 4Y94A 2EMTA 2CY4A 2UZSA 5C79A 1DDWA 2DYQA 1M7RA 3TFMA 5C5BB 3QBVB 3KSYA 3PVUA 1KZ7A 1UEFA 4YONA 4A6KA 2GCLA 1V89A 1PLSA 1ZSQA 3RCPA 1P5TA 2E2XA 5L81A 4HAYB 2Y8FA 5DIFB 1BTNA 4KHOA 3PVLA 4Z2NA 2KGXB 3UZTA 2ZPYA 2I5FA 3QIJA 2N23A 1TJ6A 4B6HA 3LJUX 4IAPA 5GOWB 3HK0A 1H4RA 4CYEA 4HDOA 4EKUA 1W1HA 1U5GA 1WJ1A 2LYDA 1QC6A 2P0DA 2DHKA 3G9WA 2OTXA 4TYZA 1U5DA 2H7DA 4YL8A 3X23A 2NZ8B 1GC7A 2Y8GA 5HE0A 4KHAA 3WA0A 1UNRA 5J3YA 4HAUB 1AWEA 1ZC4B 2D10A 1M7EA 2KUPA 1BTKA 3F5RA 1I2HA 1U5EA 4KVGB 1MAIA 2DYNA 1FOEA 1BAKA 3P6AA 4DX90 5LONB 5J3TA 5D3WA 3MDBC 5DHFB 2YVCA 3TCAA 2G35A 4HAWB 4K2OA 4D0NB 3DXCA 1DDMA 1OMWA 5DH9B 2ADZA 4EMOA 3ULCA 2D9WA 4F7GA 2EJ8A 1UPRA 1KZGA 2MKRA 3T06A 1MPHA 2RGNB 4GMVA 1EAZA 4HHVA 1LW3A 2Q13A 4WJ7A 2LOXA 2W2XD 3P7ZA 2RVBB 1RJ2A 1V61A 2R0DA 2D2QA 2ELBA 5CLLB 3TVVA 3AJ4A 3D8EA 2D11A 1MIXA 2YSZA 2LG1A 2D9XA 1UNPA 4IFSA 2W2XC 2RSGA 2I5CA 2YS1A 4MK0A 1EGXA 2QKLA 2UVMA 4H8SA 3SO6A 4DX8A 1P3RA 2LOZA 2DLWA 4BBKA 5FI1A 1FB8A 3OANA 3MPXA 3FEHA 2CAYA 1U27A 3VIAA 2N0YA 4K2PA 5HE2A 1J0WA 2P0HA 5KQ1A 2I1KA 1P6SA 2KCJA 1WG7A 1LB1A 5C6RA 5C16A 2YT1A 4GN1A 4F7UP 3D8DA 2YF0A 2DHIA 2Y7BA 4L6EA 1Y19B 5DHAB 1X1FA 2Z0PA 5HE3A 3PVWA 1X1GA 3PSCA 2COCA 1E5WA 1IRSA 5JP4A 5EFXA 1SGHA 1WGUA 4WVFB 4F7HA 1TXDA 5KQ4A 5C5BA 3ODWA 4A5KA 1FHXA 2HTHB 2P0FA 2DHJA 2HE7A 1B55A 4Z2MB 1WVHA 3GYPA 2X18A 2VRWB 4A6FB 4NSWA 1U29A 2AL6A 1MK7B 1MIZB 2I1JA 3F0WA 3DXDA 2DX5A 3FSSA 2R09A 3ZDTA 1X11A 2DN6A 2AEHA 4HAZB 3O96A 2K2UA 1V5MA 2V76A 1XR0B 4HAVB 4PNKA 5LOPB 3PZDA 4GZUA 2D9ZA 4HDQA 1U5FA 3NSUA 5JHGA 3TO1A 1DDVA 2J0JA 4HB0B 1NI2A 1WJMA 2L1CA 4CHJA 1ZVRA 2P8VA 2COAA 3KY9A 1AQCA 2IFSA 2VKIA 2QKMA 2MWNB 4ZRIA 2CRFA 2GS0A 3KZ1A 1XD4A 5FI0A 2NMBA 4K17A 4WSFA 3SYXA 2YS5A 4KHBB 1Z87A 2VSZA 4DBBA 2H7EA 1EF1A 4GMXB 1H10A 2RUKB 1WGQA 1FHOA 2Z0QA 4GPTB 2K2JA 2ROVA 2M14A 3BJIA 1XX0A 1I7AA 4ZRJA 4KAXB 1V5PA 4EJNA 1W1GA 2XQNM 2EC1A 2D9VA 2DX1A 2YS3A 2ROZB 1MK9B 3U7DA 2W2WA 2DKPA 2YRYA 2RNRB 2UZRA 4MT7A 2CODA 4ZRKA 4MY6A 1UNQA 3DXEA 4XWXA 1FAOA 2D4QA 3GYOA 1PMSA 4HAXB 2J0KA 4HB3B 2BCJA 3PP2A 2FJLA 2DFKA 2EMSA 2PZ1A 3ODOA 1KI1B 1XODA 1SHCA 2ELAA 1OY2A 5J3QA 3A8PA 1BWNA 3AU4A 2LKOA 2DTCA 1FGYA 1EVHA 1Y5OA 2GJYA 1FHWA 3A8QA 5JLJB 1QQGA 1DBHA 1XKEA 1N3HA 1J19A 2K00A 3D8FA 4HB2B 2CY5A 1GC6A 3AU5A 4HATB 3PEGA 4C0AA 5D3VA 3VOQA 3PG7A 1TQZA 1FGZA 2Z0OA 2YT0A 3KRXA 3WYFB 3KRWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3N7C A;  2DA0 A;  5DI9 B;  1U2B A;  2MDX A;  3TW1 A;  4CHM A;  3IVF A;  2J59 M;  2JP2 A;  2RLO A;  3V5W A;  2IYB A;  1NTV A;  4PQ0 A;  3CXB B;  5D27 A;  3A98 B;  1XCG A;  4DXA B;  1Q67 A;  4A6F A;  1WI1 A;  5KCV A;  3U8Z A;  5CLQ B;  1ISN A;  1X05 A;  4IOY X;  1ZM0 A;  4GXB A;  2D9Y A;  1K5G B;  1V5U A;  2LUL A;  1DRO A;  3SNH A;  1MKE A;  3ULB A;  3HW2 B;  3QWM A;  2M38 A;  4TKN A;  1V88 A;  5HE1 A;  3BIN A;  1W1D A;  1PFJ A;  2OQB A;  5JHH A;  3CIK A;  3HQC A;  3ZVR A;  3SV1 A;  1DYN A;  2COF A;  4P7I A;  5D3Y A;  2J0M A;  1RRP B;  2GCJ A;  1K5D B;  2L2I A;  3SUZ A;  1UPQ A;  2DKQ A;  1NTY A;  4A6H A;  1ZC3 B;  2MFQ A;  1OQN A;  4NY0 A;  4HB4 B;  1GG3 A;  3ML4 A;  1NU2 A;  1X86 A;  3FM8 C;  3M1I B;  3ODX A;  5D3X A;  4K81 A;  4Y94 A;  2EMT A;  2CY4 A;  2UZS A;  5C79 A;  1DDW A;  2DYQ A;  1M7R A;  3TFM A;  5C5B B;  3QBV B;  3KSY A;  3PVU A;  1KZ7 A;  1UEF A;  4YON A;  4A6K A;  2GCL A;  1V89 A;  1PLS A;  1ZSQ A;  3RCP A;  1P5T A;  2E2X A;  5L81 A;  4HAY B;  2Y8F A;  5DIF B;  1BTN A;  4KHO A;  3PVL A;  4Z2N A;  2KGX B;  3UZT A;  2ZPY A;  2I5F A;  3QIJ A;  2N23 A;  1TJ6 A;  4B6H A;  3LJU X;  4IAP A;  5GOW B;  3HK0 A;  1H4R A;  4CYE A;  4HDO A;  4EKU A;  1W1H A;  1U5G A;  1WJ1 A;  2LYD A;  1QC6 A;  2P0D A;  2DHK A;  3G9W A;  2OTX A;  4TYZ A;  1U5D A;  2H7D A;  4YL8 A;  3X23 A;  2NZ8 B;  1GC7 A;  2Y8G A;  5HE0 A;  4KHA A;  3WA0 A;  1UNR A;  5J3Y A;  4HAU B;  1AWE A;  1ZC4 B;  2D10 A;  1M7E A;  2KUP A;  1BTK A;  3F5R A;  1I2H A;  1U5E A;  4KVG B;  1MAI A;  2DYN A;  1FOE A;  1BAK A;  3P6A A;  4DX9 0;  5LON B;  5J3T A;  5D3W A;  3MDB C;  5DHF B;  2YVC A;  3TCA A;  2G35 A;  4HAW B;  4K2O A;  4D0N B;  3DXC A;  1DDM A;  1OMW A;  5DH9 B;  2ADZ A;  4EMO A;  3ULC A;  2D9W A;  4F7G A;  2EJ8 A;  1UPR A;  1KZG A;  2MKR A;  3T06 A;  1MPH A;  2RGN B;  4GMV A;  1EAZ A;  4HHV A;  1LW3 A;  2Q13 A;  4WJ7 A;  2LOX A;  2W2X D;  3P7Z A;  2RVB B;  1RJ2 A;  1V61 A;  2R0D A;  2D2Q A;  2ELB A;  5CLL B;  3TVV A;  3AJ4 A;  3D8E A;  2D11 A;  1MIX A;  2YSZ A;  2LG1 A;  2D9X A;  1UNP A;  4IFS A;  2W2X C;  2RSG A;  2I5C A;  2YS1 A;  4MK0 A;  1EGX A;  2QKL A;  2UVM A;  4H8S A;  3SO6 A;  4DX8 A;  1P3R A;  2LOZ A;  2DLW A;  4BBK A;  5FI1 A;  1FB8 A;  3OAN A;  3MPX A;  3FEH A;  2CAY A;  1U27 A;  3VIA A;  2N0Y A;  4K2P A;  5HE2 A;  1J0W A;  2P0H A;  5KQ1 A;  2I1K A;  1P6S A;  2KCJ A;  1WG7 A;  1LB1 A;  5C6R A;  5C16 A;  2YT1 A;  4GN1 A;  4F7U P;  3D8D A;  2YF0 A;  2DHI A;  2Y7B A;  4L6E A;  1Y19 B;  5DHA B;  1X1F A;  2Z0P A;  5HE3 A;  3PVW A;  1X1G A;  3PSC A;  2COC A;  1E5W A;  1IRS A;  5JP4 A;  5EFX A;  1SGH A;  1WGU A;  4WVF B;  4F7H A;  1TXD A;  5KQ4 A;  5C5B A;  3ODW A;  4A5K A;  1FHX A;  2HTH B;  2P0F A;  2DHJ A;  2HE7 A;  1B55 A;  4Z2M B;  1WVH A;  3GYP A;  2X18 A;  2VRW B;  4A6F B;  4NSW A;  1U29 A;  2AL6 A;  1MK7 B;  1MIZ B;  2I1J A;  3F0W A;  3DXD A;  2DX5 A;  3FSS A;  2R09 A;  3ZDT A;  1X11 A;  2DN6 A;  2AEH A;  4HAZ B;  3O96 A;  2K2U A;  1V5M A;  2V76 A;  1XR0 B;  4HAV B;  4PNK A;  5LOP B;  3PZD A;  4GZU A;  2D9Z A;  4HDQ A;  1U5F A;  3NSU A;  5JHG A;  3TO1 A;  1DDV A;  2J0J A;  4HB0 B;  1NI2 A;  1WJM A;  2L1C A;  4CHJ A;  1ZVR A;  2P8V A;  2COA A;  3KY9 A;  1AQC A;  2IFS A;  2VKI A;  2QKM A;  2MWN B;  4ZRI A;  2CRF A;  2GS0 A;  3KZ1 A;  1XD4 A;  5FI0 A;  2NMB A;  4K17 A;  4WSF A;  3SYX A;  2YS5 A;  4KHB B;  1Z87 A;  2VSZ A;  4DBB A;  2H7E A;  1EF1 A;  4GMX B;  1H10 A;  2RUK B;  1WGQ A;  1FHO A;  2Z0Q A;  4GPT B;  2K2J A;  2ROV A;  2M14 A;  3BJI A;  1XX0 A;  1I7A A;  4ZRJ A;  4KAX B;  1V5P A;  4EJN A;  1W1G A;  2XQN M;  2EC1 A;  2D9V A;  2DX1 A;  2YS3 A;  2ROZ B;  1MK9 B;  3U7D A;  2W2W A;  2DKP A;  2YRY A;  2RNR B;  2UZR A;  4MT7 A;  2COD A;  4ZRK A;  4MY6 A;  1UNQ A;  3DXE A;  4XWX A;  1FAO A;  2D4Q A;  3GYO A;  1PMS A;  4HAX B;  2J0K A;  4HB3 B;  2BCJ A;  3PP2 A;  2FJL A;  2DFK A;  2EMS A;  2PZ1 A;  3ODO A;  1KI1 B;  1XOD A;  1SHC A;  2ELA A;  1OY2 A;  5J3Q A;  3A8P A;  1BWN A;  3AU4 A;  2LKO A;  2DTC A;  1FGY A;  1EVH A;  1Y5O A;  2GJY A;  1FHW A;  3A8Q A;  5JLJ B;  1QQG A;  1DBH A;  1XKE A;  1N3H A;  1J19 A;  2K00 A;  3D8F A;  4HB2 B;  2CY5 A;  1GC6 A;  3AU5 A;  4HAT B;  3PEG A;  4C0A A;  5D3V A;  3VOQ A;  3PG7 A;  1TQZ A;  1FGZ A;  2Z0O A;  2YT0 A;  3KRX A;  3WYF B;  3KRW A; 
#chains in the Genus database with same CATH topology
 3N7C A;  2DA0 A;  5DI9 B;  1U2B A;  2MDX A;  3TW1 A;  4CHM A;  3IVF A;  2J59 M;  3A58 A;  2JP2 A;  2RLO A;  3V5W A;  2IYB A;  1NTV A;  3NWF A;  4D6W A;  4PQ0 A;  3CXB B;  5D27 A;  2GUM A;  3A98 B;  1XCG A;  4DXA B;  1Q67 A;  4A6F A;  1WI1 A;  5KCV A;  3NWA A;  3U8Z A;  5CLQ B;  1ISN A;  1X05 A;  4IOY X;  1ZM0 A;  4GXB A;  2D9Y A;  1K5G B;  1V5U A;  2LUL A;  1DRO A;  3SNH A;  1MKE A;  3ULB A;  3HW2 B;  4QXA B;  3QWM A;  2M38 A;  4TKN A;  1V88 A;  5HE1 A;  3BIN A;  1W1D A;  1PFJ A;  4QJ4 B;  2OQB A;  5JHH A;  3CIK A;  3HQC A;  3ZVR A;  3SV1 A;  1DYN A;  2COF A;  4P7I A;  5D3Y A;  2J0M A;  1RRP B;  2ZKM X;  2GCJ A;  1K5D B;  2L2I A;  3SUZ A;  1UPQ A;  2DKQ A;  1NTY A;  4A6H A;  1ZC3 B;  2MFQ A;  1OQN A;  4NY0 A;  4HB4 B;  1GG3 A;  3ML4 A;  1NU2 A;  1X86 A;  3FM8 C;  3M1I B;  3ODX A;  4HSI A;  5D3X A;  4K81 A;  4Y94 A;  2EMT A;  2CY4 A;  5IRS A;  2UZS A;  5C79 A;  1DDW A;  2DYQ A;  1M7R A;  3TFM A;  5C5B B;  3QBV B;  3KSY A;  3PVU A;  1KZ7 A;  2YT2 A;  1UEF A;  4YON A;  4A6K A;  2GCL A;  1V89 A;  1PLS A;  1ZSQ A;  3KRX A;  3RCP A;  1P5T A;  5M4Y B;  2E2X A;  5L81 A;  4HAY B;  3HSA A;  2Y8F A;  5DIF B;  1BTN A;  4KHO A;  3PVL A;  4Z2N A;  2KGX B;  3UZT A;  2ZPY A;  2I5F A;  3QIJ A;  2N23 A;  1TJ6 A;  4B6H A;  3LJU X;  4IAP A;  5GOW B;  3HK0 A;  1H4R A;  4CYE A;  4HDO A;  4EKU A;  1W1H A;  1U5G A;  1WJ1 A;  2LYD A;  2K8E A;  1QC6 A;  2P0D A;  2DHK A;  3G9W A;  3U12 A;  2OTX A;  3NWD A;  4TYZ A;  1U5D A;  2H7D A;  4YL8 A;  3X23 A;  2NZ8 B;  1GC7 A;  2Y8G A;  5HE0 A;  4KHA A;  3WA0 A;  1UNR A;  2KIE A;  5J3Y A;  4HAU B;  1AWE A;  1ZC4 B;  2D10 A;  1M7E A;  2KUP A;  2NBV A;  1BTK A;  3F5R A;  1I2H A;  1U5E A;  4KVG B;  1MAI A;  2DYN A;  1FOE A;  1BAK A;  4GOU A;  3P6A A;  4DX9 0;  5LON B;  5J3T A;  5D3W A;  3MDB C;  5DHF B;  4CSQ A;  2YVC A;  3TCA A;  2G35 A;  4HAW B;  4K2O A;  4D0N B;  3DXC A;  1DDM A;  1OMW A;  5DH9 B;  2ADZ A;  4EMO A;  3ULC A;  2D9W A;  4F7G A;  2EJ8 A;  1UPR A;  1KZG A;  2MKR A;  3T06 A;  1MPH A;  2RGN B;  4GMV A;  1EAZ A;  4HHV A;  1LW3 A;  2Q13 A;  4WJ7 A;  2LOX A;  2W2X D;  2R2Y A;  3P7Z A;  2RVB B;  1RJ2 A;  1V61 A;  2R0D A;  2D2Q A;  2ELB A;  5CLL B;  3TVV A;  3D8E A;  2Z4D A;  5I2S A;  2D11 A;  1MIX A;  2YSZ A;  2LG1 A;  2D9X A;  1UNP A;  4IFS A;  2W2X C;  2RSG A;  2I5C A;  2YS1 A;  4MK0 A;  1EGX A;  2QKL A;  2UVM A;  4H8S A;  3SO6 A;  4KHB A;  4DX8 A;  2FJU B;  1P3R A;  2LOZ A;  2DLW A;  4BBK A;  5FI1 A;  1FB8 A;  3OAN A;  3MPX A;  3FEH A;  2CAY A;  1U27 A;  3VIA A;  2N0Y A;  4K2P A;  5HE2 A;  1J0W A;  2KIG A;  2P0H A;  5KQ1 A;  2I1K A;  1P6S A;  2KCJ A;  1WG7 A;  2Z14 A;  1LB1 A;  5C6R A;  5C16 A;  2YT1 A;  3DCX A;  4GN1 A;  4F7U P;  3D8D A;  2YF0 A;  2DHI A;  2Y7B A;  4L6E A;  1Y19 B;  5DHA B;  2Z13 A;  3FVC A;  1X1F A;  2Z0P A;  5HE3 A;  3PVW A;  1X1G A;  3PSC A;  2COC A;  1E5W A;  1IRS A;  5JP4 A;  5EFX A;  1SGH A;  1WGU A;  4WVF B;  4F7H A;  1TXD A;  5KQ4 A;  5C5B A;  3ODW A;  4A5K A;  1FHX A;  2HTH B;  2P0F A;  2DHJ A;  2HE7 A;  1B55 A;  4Z2M B;  1WVH A;  3GYP A;  2X18 A;  3B77 A;  2VRW B;  4A6F B;  4NSW A;  1U29 A;  4GNK B;  2AL6 A;  1MK7 B;  1MIZ B;  2I1J A;  1T77 A;  3F0W A;  3DXD A;  2DX5 A;  3FSS A;  2R09 A;  4QJ3 B;  3ZDT A;  1X11 A;  2DN6 A;  2AEH A;  4HAZ B;  3O96 A;  2K2U A;  1V5M A;  2V76 A;  1XR0 B;  4HAV B;  4PNK A;  5LOP B;  3PZD A;  4GZU A;  2D9Z A;  4HDQ A;  1U5F A;  3NSU A;  5JHG A;  3TO1 A;  1DDV A;  2J0J A;  4HB0 B;  1NI2 A;  1WJM A;  2L1C A;  4CHJ A;  1ZVR A;  2P8V A;  2COA A;  2KUQ A;  3KY9 A;  1AQC A;  2IFS A;  2VKI A;  2QKM A;  2MWN B;  4ZRI A;  3HIE A;  2CRF A;  2GS0 A;  3KZ1 A;  1XD4 A;  5FI0 A;  2NMB A;  4K17 A;  4WSF A;  3SYX A;  2YS5 A;  4KHB B;  1Z87 A;  2VSZ A;  4DBB A;  2H7E A;  4L1R A;  1EF1 A;  5LG4 B;  1ZYI A;  4GMX B;  1H10 A;  2RUK B;  1WGQ A;  3NW8 A;  1FHO A;  2Z0Q A;  4GPT B;  2K2J A;  2ROV A;  2M14 A;  3BJI A;  2RRF A;  1XX0 A;  4DIX A;  1I7A A;  4ZRJ A;  4KAX B;  1V5P A;  4EJN A;  5I2M A;  1W1G A;  2K49 A;  2XQN M;  2EC1 A;  2D9V A;  2DX1 A;  2YS3 A;  2ROZ B;  1MK9 B;  3U7D A;  2W2W A;  2DKP A;  2YRY A;  2RNR B;  3OHM B;  2UZR A;  4MT7 A;  2COD A;  4ZRK A;  4MY6 A;  1UNQ A;  3DXE A;  4XWX A;  1FAO A;  2D4Q A;  3GYO A;  1PMS A;  4HAX B;  2J0K A;  4HB3 B;  2BCJ A;  3PP2 A;  2FJL A;  2DFK A;  2EMS A;  2PZ1 A;  4OT1 A;  3ODO A;  1KI1 B;  1XOD A;  1SHC A;  2ELA A;  1OY2 A;  2Z59 A;  4OSN A;  5J3Q A;  3A8P A;  1BWN A;  3AU4 A;  2LKO A;  2DTC A;  1FGY A;  1EVH A;  1Y5O A;  2GJY A;  1FHW A;  3A8Q A;  5JLJ B;  1QQG A;  1DBH A;  2KR0 A;  1XKE A;  1N3H A;  1J19 A;  2K00 A;  3D8F A;  4HB2 B;  1MI1 A;  2CY5 A;  1GC6 A;  3AU5 A;  4HAT B;  3PEG A;  4C0A A;  5D3V A;  3VOQ A;  4QJ5 B;  3PG7 A;  1TQZ A;  1FGZ A;  2Z0O A;  2YT0 A;  3AJ4 A;  3WYF B;  3KRW A; 
#chains in the Genus database with same CATH homology
 3N7C A;  2DA0 A;  5DI9 B;  1U2B A;  2MDX A;  3TW1 A;  4CHM A;  3IVF A;  2J59 M;  2JP2 A;  2RLO A;  3V5W A;  2IYB A;  1NTV A;  4PQ0 A;  3CXB B;  5D27 A;  3A98 B;  1XCG A;  4DXA B;  1Q67 A;  4A6F A;  1WI1 A;  5KCV A;  3U8Z A;  5CLQ B;  1ISN A;  1X05 A;  4IOY X;  1ZM0 A;  4GXB A;  2D9Y A;  1K5G B;  1V5U A;  2LUL A;  1DRO A;  3SNH A;  1MKE A;  3ULB A;  3HW2 B;  3QWM A;  2M38 A;  4TKN A;  1V88 A;  5HE1 A;  3BIN A;  1W1D A;  1PFJ A;  2OQB A;  5JHH A;  3CIK A;  3HQC A;  3ZVR A;  3SV1 A;  1DYN A;  2COF A;  4P7I A;  5D3Y A;  2J0M A;  1RRP B;  2GCJ A;  1K5D B;  2L2I A;  3SUZ A;  1UPQ A;  2DKQ A;  1NTY A;  4A6H A;  1ZC3 B;  2MFQ A;  1OQN A;  4NY0 A;  4HB4 B;  1GG3 A;  3ML4 A;  1NU2 A;  1X86 A;  3FM8 C;  3M1I B;  3ODX A;  5D3X A;  4K81 A;  4Y94 A;  2EMT A;  2CY4 A;  2UZS A;  5C79 A;  1DDW A;  2DYQ A;  1M7R A;  3TFM A;  5C5B B;  3QBV B;  3KSY A;  3PVU A;  1KZ7 A;  1UEF A;  4YON A;  4A6K A;  2GCL A;  1V89 A;  1PLS A;  1ZSQ A;  3RCP A;  1P5T A;  2E2X A;  5L81 A;  4HAY B;  2Y8F A;  5DIF B;  1BTN A;  4KHO A;  3PVL A;  4Z2N A;  2KGX B;  3UZT A;  2ZPY A;  2I5F A;  3QIJ A;  2N23 A;  1TJ6 A;  4B6H A;  3LJU X;  4IAP A;  5GOW B;  3HK0 A;  1H4R A;  4CYE A;  4HDO A;  4EKU A;  1W1H A;  1U5G A;  1WJ1 A;  2LYD A;  1QC6 A;  2P0D A;  2DHK A;  3G9W A;  2OTX A;  4TYZ A;  1U5D A;  2H7D A;  4YL8 A;  3X23 A;  2NZ8 B;  1GC7 A;  2Y8G A;  5HE0 A;  4KHA A;  3WA0 A;  1UNR A;  5J3Y A;  4HAU B;  1AWE A;  1ZC4 B;  2D10 A;  1M7E A;  2KUP A;  1BTK A;  3F5R A;  1I2H A;  1U5E A;  4KVG B;  1MAI A;  2DYN A;  1FOE A;  1BAK A;  3P6A A;  4DX9 0;  5LON B;  5J3T A;  5D3W A;  3MDB C;  5DHF B;  2YVC A;  3TCA A;  2G35 A;  4HAW B;  4K2O A;  4D0N B;  3DXC A;  1DDM A;  1OMW A;  5DH9 B;  2ADZ A;  4EMO A;  3ULC A;  2D9W A;  4F7G A;  2EJ8 A;  1UPR A;  1KZG A;  2MKR A;  3T06 A;  1MPH A;  2RGN B;  4GMV A;  1EAZ A;  4HHV A;  1LW3 A;  2Q13 A;  4WJ7 A;  2LOX A;  2W2X D;  3P7Z A;  2RVB B;  1RJ2 A;  1V61 A;  2R0D A;  2D2Q A;  2ELB A;  5CLL B;  3TVV A;  3AJ4 A;  3D8E A;  2D11 A;  1MIX A;  2YSZ A;  2LG1 A;  2D9X A;  1UNP A;  4IFS A;  2W2X C;  2RSG A;  2I5C A;  2YS1 A;  4MK0 A;  1EGX A;  2QKL A;  2UVM A;  4H8S A;  3SO6 A;  4DX8 A;  1P3R A;  2LOZ A;  2DLW A;  4BBK A;  5FI1 A;  1FB8 A;  3OAN A;  3MPX A;  3FEH A;  2CAY A;  1U27 A;  3VIA A;  2N0Y A;  4K2P A;  5HE2 A;  1J0W A;  2P0H A;  5KQ1 A;  2I1K A;  1P6S A;  2KCJ A;  1WG7 A;  1LB1 A;  5C6R A;  5C16 A;  2YT1 A;  4GN1 A;  4F7U P;  3D8D A;  2YF0 A;  2DHI A;  2Y7B A;  4L6E A;  1Y19 B;  5DHA B;  1X1F A;  2Z0P A;  5HE3 A;  3PVW A;  1X1G A;  3PSC A;  2COC A;  1E5W A;  1IRS A;  5JP4 A;  5EFX A;  1SGH A;  1WGU A;  4WVF B;  4F7H A;  1TXD A;  5KQ4 A;  5C5B A;  3ODW A;  4A5K A;  1FHX A;  2HTH B;  2P0F A;  2DHJ A;  2HE7 A;  1B55 A;  4Z2M B;  1WVH A;  3GYP A;  2X18 A;  2VRW B;  4A6F B;  4NSW A;  1U29 A;  2AL6 A;  1MK7 B;  1MIZ B;  2I1J A;  3F0W A;  3DXD A;  2DX5 A;  3FSS A;  2R09 A;  3ZDT A;  1X11 A;  2DN6 A;  2AEH A;  4HAZ B;  3O96 A;  2K2U A;  1V5M A;  2V76 A;  1XR0 B;  4HAV B;  4PNK A;  5LOP B;  3PZD A;  4GZU A;  2D9Z A;  4HDQ A;  1U5F A;  3NSU A;  5JHG A;  3TO1 A;  1DDV A;  2J0J A;  4HB0 B;  1NI2 A;  1WJM A;  2L1C A;  4CHJ A;  1ZVR A;  2P8V A;  2COA A;  3KY9 A;  1AQC A;  2IFS A;  2VKI A;  2QKM A;  2MWN B;  4ZRI A;  2CRF A;  2GS0 A;  3KZ1 A;  1XD4 A;  5FI0 A;  2NMB A;  4K17 A;  4WSF A;  3SYX A;  2YS5 A;  4KHB B;  1Z87 A;  2VSZ A;  4DBB A;  2H7E A;  1EF1 A;  4GMX B;  1H10 A;  2RUK B;  1WGQ A;  1FHO A;  2Z0Q A;  4GPT B;  2K2J A;  2ROV A;  2M14 A;  3BJI A;  1XX0 A;  1I7A A;  4ZRJ A;  4KAX B;  1V5P A;  4EJN A;  1W1G A;  2XQN M;  2EC1 A;  2D9V A;  2DX1 A;  2YS3 A;  2ROZ B;  1MK9 B;  3U7D A;  2W2W A;  2DKP A;  2YRY A;  2RNR B;  2UZR A;  4MT7 A;  2COD A;  4ZRK A;  4MY6 A;  1UNQ A;  3DXE A;  4XWX A;  1FAO A;  2D4Q A;  3GYO A;  1PMS A;  4HAX B;  2J0K A;  4HB3 B;  2BCJ A;  3PP2 A;  2FJL A;  2DFK A;  2EMS A;  2PZ1 A;  3ODO A;  1KI1 B;  1XOD A;  1SHC A;  2ELA A;  1OY2 A;  5J3Q A;  3A8P A;  1BWN A;  3AU4 A;  2LKO A;  2DTC A;  1FGY A;  1EVH A;  1Y5O A;  2GJY A;  1FHW A;  3A8Q A;  5JLJ B;  1QQG A;  1DBH A;  1XKE A;  1N3H A;  1J19 A;  2K00 A;  3D8F A;  4HB2 B;  2CY5 A;  1GC6 A;  3AU5 A;  4HAT B;  3PEG A;  4C0A A;  5D3V A;  3VOQ A;  3PG7 A;  1TQZ A;  1FGZ A;  2Z0O A;  2YT0 A;  3KRX A;  3WYF B;  3KRW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...