2OTXA

Crystal structure of a n-terminal fragment of skap-hom containing both the helical dimerization domain and the ph domain
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
211
structure length
170
Chain Sequence
GSPEEIRNLLADVETFVADTLKGENLSKKAKEKRESLIKKIKDVKSVYLQEFQFPPIAAQDLPFVIKAGYLEKRRKDHSFLGFEWQKRWCALSKTVFYYYGSDKDKQQKGEFAIDGYDVRMNNTLRKDGKKDCCFEICAPDKRIYQFTAASPKDAEEWVQQLKFILQDLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Src kinase-associated phosphoprotein 2
publication title The Skap-hom dimerization and PH domains comprise a 3'-phosphoinositide-gated molecular switch.
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
total genus 54
structure length 170
sequence length 211
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2otxA02
3HQCA 2D9XA 2AL6A 3U7DA 1OQNA 2M14A 1P6SA 1X11A 2HE7A 1FOEA 2YT1A 1EVHA 1WGUA 1U5EA 1ZM0A 2X18A 4IOYX 1DDVA 2DYQA 4A6HA 2JP2A 3KY9A 1WJ1A 5DH9B 4HAZB 2ELBA 1FHOA 2VRWB 1TQZA 4PNKA 1BTNA 3AJ4A 2RGNB 5J3YA 3KRXA 2CY4A 4CHMA 4IAPA 4HDOA 3WYFB 2AEHA 4GXBA 2DHJA 5HE3A 2LULA 1DDWA 5D3YA 2UZRA 1RRPB 1TJ6A 2OQBA 3DXDA 2ROZB 5C5BA 3F0WA 3BJIA 2RUKB 5EFXA 4F7GA 1MIZB 1NI2A 1U29A 1W1GA 5JLJB 2RVBB 3MPXA 5C5BB 1FHXA 5D3XA 4CYEA 4KHOA 2D9YA 4HB2B 5GOWB 1FGZA 1U5GA 2Y8FA 3PZDA 3UZTA 1J0WA 5J3QA 1BTKA 3WA0A 5HE2A 5HE0A 1MIXA 2DKPA 1KZGA 4WVFB 3ULCA 4HATB 1WI1A 3NSUA 3QBVB 1U5FA 2J0KA 4ZRIA 1QQGA 1V5MA 3PSCA 1V89A 4P7IA 1ZC3B 5L81A 2M38A 1Y19B 1E5WA 2COCA 3SUZA 3X23A 2DLWA 4DXAB 2QKLA 1PFJA 3KRWA 3ZVRA 1WGQA 1RJ2A 2YVCA 3U8ZA 3TO1A 3AU5A 2DFKA 2I5CA 2DKQA 1UEFA 1DDMA 3G9WA 1H4RA 1UNPA 2RLOA 5LOPB 2YF0A 2COAA 1NU2A 4NY0A 4BBKA 5LONB 1X86A 2CAYA 4EMOA 1SHCA 4WJ7A 1BAKA 2P8VA 1LB1A 4Z2NA 1H10A 4D0NB 2NMBA 3FSSA 2K2JA 2COFA 2P0DA 2V76A 4B6HA 1UPQA 4K17A 2NZ8B 4ZRKA 3PVLA 5DI9B 3FM8C 2EJ8A 2KUPA 5D3VA 3TW1A 5DHAB 1XR0B 2ZPYA 4HDQA 3PVWA 5C16A 1FGYA 1AWEA 1M7EA 1GC6A 1GC7A 4TYZA 2RSGA 5CLLB 3T06A 1DBHA 5KQ1A 2J0MA 4Y94A 2YSZA 3O96A 1WJMA 5KCVA 1U27A 3PEGA 4PQ0A 4GMXB 2Y7BA 2YS5A 3RCPA 3ULBA 2BCJA 4HAYB 1W1DA 1ZC4B 3GYOA 2MKRA 2J0JA 3A8PA 3SO6A 2Y8GA 4F7HA 5C79A 4HB0B 3TCAA 2D9ZA 1X1FA 5KQ4A 4K81A 1X05A 2YRYA 1ZVRA 2EMTA 4HAUB 3CIKA 2YS3A 4C0AA 4HAXB 1FAOA 2D9VA 1I7AA 3QIJA 2XQNM 4L6EA 1WG7A 3HW2B 2W2XC 3PP2A 4YONA 1DYNA 1DROA 2CRFA 1TXDA 4HAVB 1MK9B 2L2IA 3KZ1A 4HHVA 2GCLA 2N23A 4IFSA 1KI1B 4F7UP 2Q13A 2YS1A 3P7ZA 1UPRA 2D9WA 2DHKA 2MFQA 3BINA 3LJUX 2N0YA 4XWXA 3F5RA 1W1HA 2DX1A 1XD4A 2ELAA 2UZSA 2G35A 1IRSA 4DX90 1K5DB 2GJYA 2GCJA 4A6FA 2MWNB 3ODOA 4K2OA 1LW3A 2J59M 3OANA 4HAWB 3ZDTA 2KGXB 1UNQA 4A6FB 1U5DA 1FB8A 3ODXA 1MPHA 3KSYA 4EKUA 1AQCA 2IYBA 3FEHA 2D11A 1FHWA 3ML4A 4DBBA 2ADZA 1NTVA 1BWNA 1NTYA 3DXEA 2D2QA 3SNHA 4H8SA 2VKIA 1ISNA 2MDXA 4MK0A 1MAIA 2PZ1A 3DXCA 2LG1A 2QKMA 4KHAA 3TVVA 3N7CA 1I2HA 3QWMA 3IVFA 5HE1A 4KHBB 2K2UA 2GS0A 1P5TA 1XODA 1UNRA 2IFSA 3SYXA 2W2WA 4EJNA 4CHJA 3GYPA 4WSFA 1B55A 5DIFB 2L1CA 1XKEA 4NSWA 5JHGA 1X1GA 1MKEA 3D8FA 3P6AA 1N3HA 1MK7B 3V5WA 2CODA 2D10A 4GPTB 3AU4A 4ZRJA 2R09A 2H7DA 2EC1A 2CY5A 3PG7A 2I5FA 1V88A 2KCJA 2DHIA 1QC6A 1K5GB 2UVMA 3VOQA 4HB3B 1Z87A 4DX8A 3M1IB 4YL8A 5JHHA 1P3RA 1EGXA 2OTXA 1PMSA 2EMSA 5CLQB 4KAXB 4A5KA 3ODWA 4A6KA 2K00A 4MY6A 2DX5A 2DTCA 1SGHA 1XCGA 3HK0A 1U2BA 3MDBC 2HTHB 2YT0A 4HB4B 1ZSQA 2W2XD 2I1JA 2P0HA 3PVUA 1EAZA 5FI0A 1Y5OA 1Q67A 1OY2A 2D4QA 5D3WA 2P0FA 2DA0A 2RNRB 5JP4A 2Z0OA 2LKOA 5D27A 3CXBB 2LOZA 2E2XA 1GG3A 2I1KA 5DHFB 3D8DA 1V5UA 2DYNA 4GN1A 5J3TA 3VIAA 3SV1A 1PLSA 2Z0QA 4GZUA 4Z2MB 5FI1A 3TFMA 1EF1A 2H7EA 3A8QA 2VSZA 5C6RA 1V61A 2ROVA 1M7RA 4GMVA 2DN6A 4MT7A 1OMWA 1KZ7A 2LYDA 3A98B 1J19A 1V5PA 2LOXA 2FJLA 4K2PA 3D8EA 4TKNA 2R0DA 2Z0PA 1XX0A 4KVGB 1WVHA
chains in the Genus database with same CATH superfamily
3HQCA 2D9XA 2AL6A 3U7DA 1OQNA 3NWDA 2M14A 1P6SA 1X11A 2HE7A 1FOEA 2YT1A 1EVHA 1WGUA 1U5EA 1ZM0A 2X18A 2GUMA 4IOYX 1DDVA 2DYQA 4A6HA 2JP2A 3KY9A 1WJ1A 5DH9B 4HAZB 2ELBA 1FHOA 2VRWB 1TQZA 4PNKA 1BTNA 3AJ4A 1ZYIA 2RGNB 5J3YA 3KRXA 4L1RA 2CY4A 4CHMA 4IAPA 4HDOA 3WYFB 2AEHA 3HSAA 4GXBA 2DHJA 5HE3A 2LULA 1DDWA 5D3YA 2UZRA 1RRPB 1TJ6A 2OQBA 3DXDA 2ROZB 5C5BA 3F0WA 3BJIA 2RUKB 5EFXA 4F7GA 1MIZB 1NI2A 1U29A 1W1GA 5JLJB 2RVBB 3MPXA 5C5BB 1FHXA 5D3XA 4CYEA 4KHOA 2Z13A 2D9YA 4HB2B 5GOWB 1FGZA 1U5GA 2Y8FA 3PZDA 3UZTA 1J0WA 5J3QA 1BTKA 3WA0A 5HE2A 5HE0A 1MIXA 2DKPA 1KZGA 4WVFB 3ULCA 4HATB 1WI1A 3NSUA 3QBVB 3OHMB 1U5FA 2J0KA 4ZRIA 1QQGA 1V5MA 3FVCA 1V89A 3PSCA 4OSNA 4P7IA 1ZC3B 5L81A 2M38A 1Y19B 1E5WA 2COCA 2Z59A 3SUZA 3X23A 2DLWA 4DXAB 2QKLA 1PFJA 3KRWA 3ZVRA 1WGQA 1RJ2A 2YVCA 3U8ZA 3TO1A 3AU5A 2DFKA 2I5CA 5IRSA 2DKQA 1UEFA 1DDMA 3G9WA 1H4RA 1UNPA 2RLOA 5LOPB 2YF0A 2COAA 1NU2A 4NY0A 4BBKA 3U12A 5LONB 1X86A 2CAYA 4EMOA 1SHCA 4WJ7A 1BAKA 2P8VA 1LB1A 4Z2NA 1H10A 4D0NB 2NMBA 3FSSA 2K2JA 2COFA 2P0DA 4DIXA 2V76A 4B6HA 1UPQA 4K17A 2NZ8B 4ZRKA 2KIEA 3PVLA 5DI9B 3FM8C 2EJ8A 2KUPA 5D3VA 3TW1A 5DHAB 1XR0B 2ZPYA 4HDQA 3PVWA 5C16A 1FGYA 1AWEA 2Z4DA 2KUQA 1M7EA 1GC6A 1GC7A 4TYZA 2RSGA 5CLLB 3T06A 1DBHA 5KQ1A 2J0MA 4Y94A 2YSZA 3O96A 1WJMA 5KCVA 4GNKB 1U27A 3PEGA 4PQ0A 1T77A 4QJ3B 4GMXB 2Y7BA 2YS5A 3RCPA 3ULBA 2BCJA 4HAYB 1W1DA 1ZC4B 3GYOA 2MKRA 2J0JA 3A8PA 3SO6A 2Y8GA 5I2MA 4F7HA 5C79A 4HB0B 3TCAA 2D9ZA 1X1FA 5KQ4A 4K81A 1X05A 2YRYA 1ZVRA 2EMTA 4HAUB 3CIKA 2YS3A 4C0AA 4HAXB 1FAOA 2D9VA 1I7AA 3QIJA 2XQNM 4L6EA 1WG7A 3HW2B 2W2XC 2ZKMX 4OT1A 3PP2A 4YONA 1DYNA 3DCXA 1DROA 2CRFA 1TXDA 4HAVB 1MK9B 2L2IA 3KZ1A 4QJ5B 4HHVA 2GCLA 2N23A 4IFSA 1KI1B 4F7UP 2Q13A 2YS1A 3P7ZA 1UPRA 4QJ4B 2D9WA 2DHKA 2MFQA 2K8EA 3BINA 3LJUX 2N0YA 4XWXA 3F5RA 1W1HA 2DX1A 1XD4A 2NBVA 2ELAA 2UZSA 2G35A 1IRSA 4DX90 1K5DB 2GJYA 2GCJA 4A6FA 2MWNB 3ODOA 4K2OA 1LW3A 2J59M 3OANA 4HAWB 3ZDTA 2KGXB 1UNQA 4A6FB 1U5DA 1FB8A 3ODXA 1MPHA 3KSYA 1MI1A 2KIGA 4EKUA 3FEHA 1AQCA 2IYBA 2D11A 1FHWA 3ML4A 5M4YB 4DBBA 2ADZA 1NTVA 1BWNA 1NTYA 3DXEA 2D2QA 3SNHA 4H8SA 2VKIA 4GOUA 1ISNA 2MDXA 4MK0A 1MAIA 2PZ1A 3DXCA 2LG1A 2QKMA 4KHAA 3TVVA 4KHBA 3N7CA 3B77A 1I2HA 3QWMA 3IVFA 5HE1A 4KHBB 4HSIA 2K2UA 2GS0A 1P5TA 1XODA 1UNRA 2IFSA 3NWAA 3SYXA 2W2WA 4EJNA 4CHJA 3GYPA 4WSFA 1B55A 5DIFB 2R2YA 2L1CA 1XKEA 4NSWA 5JHGA 1X1GA 1MKEA 2KR0A 3D8FA 2K49A 3P6AA 1N3HA 1MK7B 3V5WA 2CODA 2D10A 4GPTB 3AU4A 4ZRJA 2R09A 2H7DA 2EC1A 2CY5A 3PG7A 2YT2A 2I5FA 1V88A 2KCJA 2DHIA 1QC6A 1K5GB 2UVMA 3VOQA 4HB3B 1Z87A 4DX8A 5I2SA 3M1IB 4YL8A 5JHHA 1P3RA 1EGXA 2OTXA 1PMSA 2EMSA 5CLQB 4KAXB 4A5KA 3ODWA 4A6KA 2K00A 4MY6A 2DX5A 2DTCA 1SGHA 1XCGA 3HK0A 1U2BA 3MDBC 2HTHB 3NW8A 2YT0A 4HB4B 3NWFA 1ZSQA 2W2XD 2I1JA 2P0HA 3PVUA 1EAZA 5FI0A 1Y5OA 1Q67A 4QXAB 1OY2A 2D4QA 5D3WA 2P0FA 2DA0A 2RNRB 5JP4A 2Z0OA 4CSQA 2LKOA 2RRFA 5D27A 2FJUB 3CXBB 2LOZA 2E2XA 1GG3A 2I1KA 5DHFB 3D8DA 3HIEA 1V5UA 2DYNA 4GN1A 5J3TA 3VIAA 3SV1A 1PLSA 2Z0QA 4GZUA 4Z2MB 5FI1A 4D6WA 3TFMA 1EF1A 2H7EA 3A8QA 2VSZA 5C6RA 1V61A 2ROVA 1M7RA 5LG4B 4GMVA 2DN6A 4MT7A 1OMWA 1KZ7A 2LYDA 3A98B 1J19A 1V5PA 2LOXA 2FJLA 3A58A 4K2PA 2Z14A 3D8EA 4TKNA 2R0DA 2Z0PA 1XX0A 4KVGB 1WVHA
chains in the Genus database with same CATH topology
3HQCA 2D9XA 2AL6A 3U7DA 1OQNA 2M14A 1P6SA 1X11A 2HE7A 1FOEA 2YT1A 1EVHA 1WGUA 1U5EA 1ZM0A 2X18A 4IOYX 1DDVA 2DYQA 4A6HA 2JP2A 3KY9A 1WJ1A 5DH9B 4HAZB 2ELBA 1FHOA 2VRWB 1TQZA 4PNKA 1BTNA 3AJ4A 2RGNB 5J3YA 3KRXA 2CY4A 4CHMA 4IAPA 4HDOA 3WYFB 2AEHA 4GXBA 2DHJA 5HE3A 2LULA 1DDWA 5D3YA 2UZRA 1RRPB 1TJ6A 2OQBA 3DXDA 2ROZB 5C5BA 3F0WA 3BJIA 2RUKB 5EFXA 4F7GA 1MIZB 1NI2A 1U29A 1W1GA 5JLJB 2RVBB 3MPXA 5C5BB 1FHXA 5D3XA 4CYEA 4KHOA 2D9YA 4HB2B 5GOWB 1FGZA 1U5GA 2Y8FA 3PZDA 3UZTA 1J0WA 5J3QA 1BTKA 3WA0A 5HE2A 5HE0A 1MIXA 2DKPA 1KZGA 4WVFB 3ULCA 4HATB 1WI1A 3NSUA 3QBVB 1U5FA 2J0KA 4ZRIA 1QQGA 1V5MA 3PSCA 1V89A 4P7IA 1ZC3B 5L81A 2M38A 1Y19B 1E5WA 2COCA 3SUZA 3X23A 2DLWA 4DXAB 2QKLA 1PFJA 3KRWA 3ZVRA 1WGQA 1RJ2A 2YVCA 3U8ZA 3TO1A 3AU5A 2DFKA 2I5CA 2DKQA 1UEFA 1DDMA 3G9WA 1H4RA 1UNPA 2RLOA 5LOPB 2YF0A 2COAA 1NU2A 4NY0A 4BBKA 5LONB 1X86A 2CAYA 4EMOA 1SHCA 4WJ7A 1BAKA 2P8VA 1LB1A 4Z2NA 1H10A 4D0NB 2NMBA 3FSSA 2K2JA 2COFA 2P0DA 2V76A 4B6HA 1UPQA 4K17A 2NZ8B 4ZRKA 3PVLA 5DI9B 3FM8C 2EJ8A 2KUPA 5D3VA 3TW1A 5DHAB 1XR0B 2ZPYA 4HDQA 3PVWA 5C16A 1FGYA 1AWEA 1M7EA 1GC6A 1GC7A 4TYZA 2RSGA 5CLLB 3T06A 1DBHA 5KQ1A 2J0MA 4Y94A 2YSZA 3O96A 1WJMA 5KCVA 1U27A 3PEGA 4PQ0A 4GMXB 2Y7BA 2YS5A 3RCPA 3ULBA 2BCJA 4HAYB 1W1DA 1ZC4B 3GYOA 2MKRA 2J0JA 3A8PA 3SO6A 2Y8GA 4F7HA 5C79A 4HB0B 3TCAA 2D9ZA 1X1FA 5KQ4A 4K81A 1X05A 2YRYA 1ZVRA 2EMTA 4HAUB 3CIKA 2YS3A 4C0AA 4HAXB 1FAOA 2D9VA 1I7AA 3QIJA 2XQNM 4L6EA 1WG7A 3HW2B 2W2XC 3PP2A 4YONA 1DYNA 1DROA 2CRFA 1TXDA 4HAVB 1MK9B 2L2IA 3KZ1A 4HHVA 2GCLA 2N23A 4IFSA 1KI1B 4F7UP 2Q13A 2YS1A 3P7ZA 1UPRA 2D9WA 2DHKA 2MFQA 3BINA 3LJUX 2N0YA 4XWXA 3F5RA 1W1HA 2DX1A 1XD4A 2ELAA 2UZSA 2G35A 1IRSA 4DX90 1K5DB 2GJYA 2GCJA 4A6FA 2MWNB 3ODOA 4K2OA 1LW3A 2J59M 3OANA 4HAWB 3ZDTA 2KGXB 1UNQA 4A6FB 1U5DA 1FB8A 3ODXA 1MPHA 3KSYA 4EKUA 1AQCA 2IYBA 3FEHA 2D11A 1FHWA 3ML4A 4DBBA 2ADZA 1NTVA 1BWNA 1NTYA 3DXEA 2D2QA 3SNHA 4H8SA 2VKIA 1ISNA 2MDXA 4MK0A 1MAIA 2PZ1A 3DXCA 2LG1A 2QKMA 4KHAA 3TVVA 3N7CA 1I2HA 3QWMA 3IVFA 5HE1A 4KHBB 2K2UA 2GS0A 1P5TA 1XODA 1UNRA 2IFSA 3SYXA 2W2WA 4EJNA 4CHJA 3GYPA 4WSFA 1B55A 5DIFB 2L1CA 1XKEA 4NSWA 5JHGA 1X1GA 1MKEA 3D8FA 3P6AA 1N3HA 1MK7B 3V5WA 2CODA 2D10A 4GPTB 3AU4A 4ZRJA 2R09A 2H7DA 2EC1A 2CY5A 3PG7A 2I5FA 1V88A 2KCJA 2DHIA 1QC6A 1K5GB 2UVMA 3VOQA 4HB3B 1Z87A 4DX8A 3M1IB 4YL8A 5JHHA 1P3RA 1EGXA 2OTXA 1PMSA 2EMSA 5CLQB 4KAXB 4A5KA 3ODWA 4A6KA 2K00A 4MY6A 2DX5A 2DTCA 1SGHA 1XCGA 3HK0A 1U2BA 3MDBC 2HTHB 2YT0A 4HB4B 1ZSQA 2W2XD 2I1JA 2P0HA 3PVUA 1EAZA 5FI0A 1Y5OA 1Q67A 1OY2A 2D4QA 5D3WA 2P0FA 2DA0A 2RNRB 5JP4A 2Z0OA 2LKOA 5D27A 3CXBB 2LOZA 2E2XA 1GG3A 2I1KA 5DHFB 3D8DA 1V5UA 2DYNA 4GN1A 5J3TA 3VIAA 3SV1A 1PLSA 2Z0QA 4GZUA 4Z2MB 5FI1A 3TFMA 1EF1A 2H7EA 3A8QA 2VSZA 5C6RA 1V61A 2ROVA 1M7RA 4GMVA 2DN6A 4MT7A 1OMWA 1KZ7A 2LYDA 3A98B 1J19A 1V5PA 2LOXA 2FJLA 4K2PA 3D8EA 4TKNA 2R0DA 2Z0PA 1XX0A 4KVGB 1WVHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HQC A;  2D9X A;  2AL6 A;  3U7D A;  1OQN A;  2M14 A;  1P6S A;  1X11 A;  2HE7 A;  1FOE A;  2YT1 A;  1EVH A;  1WGU A;  1U5E A;  1ZM0 A;  2X18 A;  4IOY X;  1DDV A;  2DYQ A;  4A6H A;  2JP2 A;  3KY9 A;  1WJ1 A;  5DH9 B;  4HAZ B;  2ELB A;  1FHO A;  2VRW B;  1TQZ A;  4PNK A;  1BTN A;  3AJ4 A;  2RGN B;  5J3Y A;  3KRX A;  2CY4 A;  4CHM A;  4IAP A;  4HDO A;  3WYF B;  2AEH A;  4GXB A;  2DHJ A;  5HE3 A;  2LUL A;  1DDW A;  5D3Y A;  2UZR A;  1RRP B;  1TJ6 A;  2OQB A;  3DXD A;  2ROZ B;  5C5B A;  3F0W A;  3BJI A;  2RUK B;  5EFX A;  4F7G A;  1MIZ B;  1NI2 A;  1U29 A;  1W1G A;  5JLJ B;  2RVB B;  3MPX A;  5C5B B;  1FHX A;  5D3X A;  4CYE A;  4KHO A;  2D9Y A;  4HB2 B;  5GOW B;  1FGZ A;  1U5G A;  2Y8F A;  3PZD A;  3UZT A;  1J0W A;  5J3Q A;  1BTK A;  3WA0 A;  5HE2 A;  5HE0 A;  1MIX A;  2DKP A;  1KZG A;  4WVF B;  3ULC A;  4HAT B;  1WI1 A;  3NSU A;  3QBV B;  1U5F A;  2J0K A;  4ZRI A;  1QQG A;  1V5M A;  3PSC A;  1V89 A;  4P7I A;  1ZC3 B;  5L81 A;  2M38 A;  1Y19 B;  1E5W A;  2COC A;  3SUZ A;  3X23 A;  2DLW A;  4DXA B;  2QKL A;  1PFJ A;  3KRW A;  3ZVR A;  1WGQ A;  1RJ2 A;  2YVC A;  3U8Z A;  3TO1 A;  3AU5 A;  2DFK A;  2I5C A;  2DKQ A;  1UEF A;  1DDM A;  3G9W A;  1H4R A;  1UNP A;  2RLO A;  5LOP B;  2YF0 A;  2COA A;  1NU2 A;  4NY0 A;  4BBK A;  5LON B;  1X86 A;  2CAY A;  4EMO A;  1SHC A;  4WJ7 A;  1BAK A;  2P8V A;  1LB1 A;  4Z2N A;  1H10 A;  4D0N B;  2NMB A;  3FSS A;  2K2J A;  2COF A;  2P0D A;  2V76 A;  4B6H A;  1UPQ A;  4K17 A;  2NZ8 B;  4ZRK A;  3PVL A;  5DI9 B;  3FM8 C;  2EJ8 A;  2KUP A;  5D3V A;  3TW1 A;  5DHA B;  1XR0 B;  2ZPY A;  4HDQ A;  3PVW A;  5C16 A;  1FGY A;  1AWE A;  1M7E A;  1GC6 A;  1GC7 A;  4TYZ A;  2RSG A;  5CLL B;  3T06 A;  1DBH A;  5KQ1 A;  2J0M A;  4Y94 A;  2YSZ A;  3O96 A;  1WJM A;  5KCV A;  1U27 A;  3PEG A;  4PQ0 A;  4GMX B;  2Y7B A;  2YS5 A;  3RCP A;  3ULB A;  2BCJ A;  4HAY B;  1W1D A;  1ZC4 B;  3GYO A;  2MKR A;  2J0J A;  3A8P A;  3SO6 A;  2Y8G A;  4F7H A;  5C79 A;  4HB0 B;  3TCA A;  2D9Z A;  1X1F A;  5KQ4 A;  4K81 A;  1X05 A;  2YRY A;  1ZVR A;  2EMT A;  4HAU B;  3CIK A;  2YS3 A;  4C0A A;  4HAX B;  1FAO A;  2D9V A;  1I7A A;  3QIJ A;  2XQN M;  4L6E A;  1WG7 A;  3HW2 B;  2W2X C;  3PP2 A;  4YON A;  1DYN A;  1DRO A;  2CRF A;  1TXD A;  4HAV B;  1MK9 B;  2L2I A;  3KZ1 A;  4HHV A;  2GCL A;  2N23 A;  4IFS A;  1KI1 B;  4F7U P;  2Q13 A;  2YS1 A;  3P7Z A;  1UPR A;  2D9W A;  2DHK A;  2MFQ A;  3BIN A;  3LJU X;  2N0Y A;  4XWX A;  3F5R A;  1W1H A;  2DX1 A;  1XD4 A;  2ELA A;  2UZS A;  2G35 A;  1IRS A;  4DX9 0;  1K5D B;  2GJY A;  2GCJ A;  4A6F A;  2MWN B;  3ODO A;  4K2O A;  1LW3 A;  2J59 M;  3OAN A;  4HAW B;  3ZDT A;  2KGX B;  1UNQ A;  4A6F B;  1U5D A;  1FB8 A;  3ODX A;  1MPH A;  3KSY A;  4EKU A;  1AQC A;  2IYB A;  3FEH A;  2D11 A;  1FHW A;  3ML4 A;  4DBB A;  2ADZ A;  1NTV A;  1BWN A;  1NTY A;  3DXE A;  2D2Q A;  3SNH A;  4H8S A;  2VKI A;  1ISN A;  2MDX A;  4MK0 A;  1MAI A;  2PZ1 A;  3DXC A;  2LG1 A;  2QKM A;  4KHA A;  3TVV A;  3N7C A;  1I2H A;  3QWM A;  3IVF A;  5HE1 A;  4KHB B;  2K2U A;  2GS0 A;  1P5T A;  1XOD A;  1UNR A;  2IFS A;  3SYX A;  2W2W A;  4EJN A;  4CHJ A;  3GYP A;  4WSF A;  1B55 A;  5DIF B;  2L1C A;  1XKE A;  4NSW A;  5JHG A;  1X1G A;  1MKE A;  3D8F A;  3P6A A;  1N3H A;  1MK7 B;  3V5W A;  2COD A;  2D10 A;  4GPT B;  3AU4 A;  4ZRJ A;  2R09 A;  2H7D A;  2EC1 A;  2CY5 A;  3PG7 A;  2I5F A;  1V88 A;  2KCJ A;  2DHI A;  1QC6 A;  1K5G B;  2UVM A;  3VOQ A;  4HB3 B;  1Z87 A;  4DX8 A;  3M1I B;  4YL8 A;  5JHH A;  1P3R A;  1EGX A;  2OTX A;  1PMS A;  2EMS A;  5CLQ B;  4KAX B;  4A5K A;  3ODW A;  4A6K A;  2K00 A;  4MY6 A;  2DX5 A;  2DTC A;  1SGH A;  1XCG A;  3HK0 A;  1U2B A;  3MDB C;  2HTH B;  2YT0 A;  4HB4 B;  1ZSQ A;  2W2X D;  2I1J A;  2P0H A;  3PVU A;  1EAZ A;  5FI0 A;  1Y5O A;  1Q67 A;  1OY2 A;  2D4Q A;  5D3W A;  2P0F A;  2DA0 A;  2RNR B;  5JP4 A;  2Z0O A;  2LKO A;  5D27 A;  3CXB B;  2LOZ A;  2E2X A;  1GG3 A;  2I1K A;  5DHF B;  3D8D A;  1V5U A;  2DYN A;  4GN1 A;  5J3T A;  3VIA A;  3SV1 A;  1PLS A;  2Z0Q A;  4GZU A;  4Z2M B;  5FI1 A;  3TFM A;  1EF1 A;  2H7E A;  3A8Q A;  2VSZ A;  5C6R A;  1V61 A;  2ROV A;  1M7R A;  4GMV A;  2DN6 A;  4MT7 A;  1OMW A;  1KZ7 A;  2LYD A;  3A98 B;  1J19 A;  1V5P A;  2LOX A;  2FJL A;  4K2P A;  3D8E A;  4TKN A;  2R0D A;  2Z0P A;  1XX0 A;  4KVG B;  1WVH A; 
#chains in the Genus database with same CATH topology
 3HQC A;  2D9X A;  2AL6 A;  3U7D A;  1OQN A;  3NWD A;  2M14 A;  1P6S A;  1X11 A;  2HE7 A;  1FOE A;  2YT1 A;  1EVH A;  1WGU A;  1U5E A;  1ZM0 A;  2X18 A;  2GUM A;  4IOY X;  1DDV A;  2DYQ A;  4A6H A;  2JP2 A;  3KY9 A;  1WJ1 A;  5DH9 B;  4HAZ B;  2ELB A;  1FHO A;  2VRW B;  1TQZ A;  4PNK A;  1BTN A;  3AJ4 A;  1ZYI A;  2RGN B;  5J3Y A;  3KRX A;  4L1R A;  2CY4 A;  4CHM A;  4IAP A;  4HDO A;  3WYF B;  2AEH A;  3HSA A;  4GXB A;  2DHJ A;  5HE3 A;  2LUL A;  1DDW A;  5D3Y A;  2UZR A;  1RRP B;  1TJ6 A;  2OQB A;  3DXD A;  2ROZ B;  5C5B A;  3F0W A;  3BJI A;  2RUK B;  5EFX A;  4F7G A;  1MIZ B;  1NI2 A;  1U29 A;  1W1G A;  5JLJ B;  2RVB B;  3MPX A;  5C5B B;  1FHX A;  5D3X A;  4CYE A;  4KHO A;  2Z13 A;  2D9Y A;  4HB2 B;  5GOW B;  1FGZ A;  1U5G A;  2Y8F A;  3PZD A;  3UZT A;  1J0W A;  5J3Q A;  1BTK A;  3WA0 A;  5HE2 A;  5HE0 A;  1MIX A;  2DKP A;  1KZG A;  4WVF B;  3ULC A;  4HAT B;  1WI1 A;  3NSU A;  3QBV B;  3OHM B;  1U5F A;  2J0K A;  4ZRI A;  1QQG A;  1V5M A;  3FVC A;  1V89 A;  3PSC A;  4OSN A;  4P7I A;  1ZC3 B;  5L81 A;  2M38 A;  1Y19 B;  1E5W A;  2COC A;  2Z59 A;  3SUZ A;  3X23 A;  2DLW A;  4DXA B;  2QKL A;  1PFJ A;  3KRW A;  3ZVR A;  1WGQ A;  1RJ2 A;  2YVC A;  3U8Z A;  3TO1 A;  3AU5 A;  2DFK A;  2I5C A;  5IRS A;  2DKQ A;  1UEF A;  1DDM A;  3G9W A;  1H4R A;  1UNP A;  2RLO A;  5LOP B;  2YF0 A;  2COA A;  1NU2 A;  4NY0 A;  4BBK A;  3U12 A;  5LON B;  1X86 A;  2CAY A;  4EMO A;  1SHC A;  4WJ7 A;  1BAK A;  2P8V A;  1LB1 A;  4Z2N A;  1H10 A;  4D0N B;  2NMB A;  3FSS A;  2K2J A;  2COF A;  2P0D A;  4DIX A;  2V76 A;  4B6H A;  1UPQ A;  4K17 A;  2NZ8 B;  4ZRK A;  2KIE A;  3PVL A;  5DI9 B;  3FM8 C;  2EJ8 A;  2KUP A;  5D3V A;  3TW1 A;  5DHA B;  1XR0 B;  2ZPY A;  4HDQ A;  3PVW A;  5C16 A;  1FGY A;  1AWE A;  2Z4D A;  2KUQ A;  1M7E A;  1GC6 A;  1GC7 A;  4TYZ A;  2RSG A;  5CLL B;  3T06 A;  1DBH A;  5KQ1 A;  2J0M A;  4Y94 A;  2YSZ A;  3O96 A;  1WJM A;  5KCV A;  4GNK B;  1U27 A;  3PEG A;  4PQ0 A;  1T77 A;  4QJ3 B;  4GMX B;  2Y7B A;  2YS5 A;  3RCP A;  3ULB A;  2BCJ A;  4HAY B;  1W1D A;  1ZC4 B;  3GYO A;  2MKR A;  2J0J A;  3A8P A;  3SO6 A;  2Y8G A;  5I2M A;  4F7H A;  5C79 A;  4HB0 B;  3TCA A;  2D9Z A;  1X1F A;  5KQ4 A;  4K81 A;  1X05 A;  2YRY A;  1ZVR A;  2EMT A;  4HAU B;  3CIK A;  2YS3 A;  4C0A A;  4HAX B;  1FAO A;  2D9V A;  1I7A A;  3QIJ A;  2XQN M;  4L6E A;  1WG7 A;  3HW2 B;  2W2X C;  2ZKM X;  4OT1 A;  3PP2 A;  4YON A;  1DYN A;  3DCX A;  1DRO A;  2CRF A;  1TXD A;  4HAV B;  1MK9 B;  2L2I A;  3KZ1 A;  4QJ5 B;  4HHV A;  2GCL A;  2N23 A;  4IFS A;  1KI1 B;  4F7U P;  2Q13 A;  2YS1 A;  3P7Z A;  1UPR A;  4QJ4 B;  2D9W A;  2DHK A;  2MFQ A;  2K8E A;  3BIN A;  3LJU X;  2N0Y A;  4XWX A;  3F5R A;  1W1H A;  2DX1 A;  1XD4 A;  2NBV A;  2ELA A;  2UZS A;  2G35 A;  1IRS A;  4DX9 0;  1K5D B;  2GJY A;  2GCJ A;  4A6F A;  2MWN B;  3ODO A;  4K2O A;  1LW3 A;  2J59 M;  3OAN A;  4HAW B;  3ZDT A;  2KGX B;  1UNQ A;  4A6F B;  1U5D A;  1FB8 A;  3ODX A;  1MPH A;  3KSY A;  1MI1 A;  2KIG A;  4EKU A;  3FEH A;  1AQC A;  2IYB A;  2D11 A;  1FHW A;  3ML4 A;  5M4Y B;  4DBB A;  2ADZ A;  1NTV A;  1BWN A;  1NTY A;  3DXE A;  2D2Q A;  3SNH A;  4H8S A;  2VKI A;  4GOU A;  1ISN A;  2MDX A;  4MK0 A;  1MAI A;  2PZ1 A;  3DXC A;  2LG1 A;  2QKM A;  4KHA A;  3TVV A;  4KHB A;  3N7C A;  3B77 A;  1I2H A;  3QWM A;  3IVF A;  5HE1 A;  4KHB B;  4HSI A;  2K2U A;  2GS0 A;  1P5T A;  1XOD A;  1UNR A;  2IFS A;  3NWA A;  3SYX A;  2W2W A;  4EJN A;  4CHJ A;  3GYP A;  4WSF A;  1B55 A;  5DIF B;  2R2Y A;  2L1C A;  1XKE A;  4NSW A;  5JHG A;  1X1G A;  1MKE A;  2KR0 A;  3D8F A;  2K49 A;  3P6A A;  1N3H A;  1MK7 B;  3V5W A;  2COD A;  2D10 A;  4GPT B;  3AU4 A;  4ZRJ A;  2R09 A;  2H7D A;  2EC1 A;  2CY5 A;  3PG7 A;  2YT2 A;  2I5F A;  1V88 A;  2KCJ A;  2DHI A;  1QC6 A;  1K5G B;  2UVM A;  3VOQ A;  4HB3 B;  1Z87 A;  4DX8 A;  5I2S A;  3M1I B;  4YL8 A;  5JHH A;  1P3R A;  1EGX A;  2OTX A;  1PMS A;  2EMS A;  5CLQ B;  4KAX B;  4A5K A;  3ODW A;  4A6K A;  2K00 A;  4MY6 A;  2DX5 A;  2DTC A;  1SGH A;  1XCG A;  3HK0 A;  1U2B A;  3MDB C;  2HTH B;  3NW8 A;  2YT0 A;  4HB4 B;  3NWF A;  1ZSQ A;  2W2X D;  2I1J A;  2P0H A;  3PVU A;  1EAZ A;  5FI0 A;  1Y5O A;  1Q67 A;  4QXA B;  1OY2 A;  2D4Q A;  5D3W A;  2P0F A;  2DA0 A;  2RNR B;  5JP4 A;  2Z0O A;  4CSQ A;  2LKO A;  2RRF A;  5D27 A;  2FJU B;  3CXB B;  2LOZ A;  2E2X A;  1GG3 A;  2I1K A;  5DHF B;  3D8D A;  3HIE A;  1V5U A;  2DYN A;  4GN1 A;  5J3T A;  3VIA A;  3SV1 A;  1PLS A;  2Z0Q A;  4GZU A;  4Z2M B;  5FI1 A;  4D6W A;  3TFM A;  1EF1 A;  2H7E A;  3A8Q A;  2VSZ A;  5C6R A;  1V61 A;  2ROV A;  1M7R A;  5LG4 B;  4GMV A;  2DN6 A;  4MT7 A;  1OMW A;  1KZ7 A;  2LYD A;  3A98 B;  1J19 A;  1V5P A;  2LOX A;  2FJL A;  3A58 A;  4K2P A;  2Z14 A;  3D8E A;  4TKN A;  2R0D A;  2Z0P A;  1XX0 A;  4KVG B;  1WVH A; 
#chains in the Genus database with same CATH homology
 3HQC A;  2D9X A;  2AL6 A;  3U7D A;  1OQN A;  2M14 A;  1P6S A;  1X11 A;  2HE7 A;  1FOE A;  2YT1 A;  1EVH A;  1WGU A;  1U5E A;  1ZM0 A;  2X18 A;  4IOY X;  1DDV A;  2DYQ A;  4A6H A;  2JP2 A;  3KY9 A;  1WJ1 A;  5DH9 B;  4HAZ B;  2ELB A;  1FHO A;  2VRW B;  1TQZ A;  4PNK A;  1BTN A;  3AJ4 A;  2RGN B;  5J3Y A;  3KRX A;  2CY4 A;  4CHM A;  4IAP A;  4HDO A;  3WYF B;  2AEH A;  4GXB A;  2DHJ A;  5HE3 A;  2LUL A;  1DDW A;  5D3Y A;  2UZR A;  1RRP B;  1TJ6 A;  2OQB A;  3DXD A;  2ROZ B;  5C5B A;  3F0W A;  3BJI A;  2RUK B;  5EFX A;  4F7G A;  1MIZ B;  1NI2 A;  1U29 A;  1W1G A;  5JLJ B;  2RVB B;  3MPX A;  5C5B B;  1FHX A;  5D3X A;  4CYE A;  4KHO A;  2D9Y A;  4HB2 B;  5GOW B;  1FGZ A;  1U5G A;  2Y8F A;  3PZD A;  3UZT A;  1J0W A;  5J3Q A;  1BTK A;  3WA0 A;  5HE2 A;  5HE0 A;  1MIX A;  2DKP A;  1KZG A;  4WVF B;  3ULC A;  4HAT B;  1WI1 A;  3NSU A;  3QBV B;  1U5F A;  2J0K A;  4ZRI A;  1QQG A;  1V5M A;  3PSC A;  1V89 A;  4P7I A;  1ZC3 B;  5L81 A;  2M38 A;  1Y19 B;  1E5W A;  2COC A;  3SUZ A;  3X23 A;  2DLW A;  4DXA B;  2QKL A;  1PFJ A;  3KRW A;  3ZVR A;  1WGQ A;  1RJ2 A;  2YVC A;  3U8Z A;  3TO1 A;  3AU5 A;  2DFK A;  2I5C A;  2DKQ A;  1UEF A;  1DDM A;  3G9W A;  1H4R A;  1UNP A;  2RLO A;  5LOP B;  2YF0 A;  2COA A;  1NU2 A;  4NY0 A;  4BBK A;  5LON B;  1X86 A;  2CAY A;  4EMO A;  1SHC A;  4WJ7 A;  1BAK A;  2P8V A;  1LB1 A;  4Z2N A;  1H10 A;  4D0N B;  2NMB A;  3FSS A;  2K2J A;  2COF A;  2P0D A;  2V76 A;  4B6H A;  1UPQ A;  4K17 A;  2NZ8 B;  4ZRK A;  3PVL A;  5DI9 B;  3FM8 C;  2EJ8 A;  2KUP A;  5D3V A;  3TW1 A;  5DHA B;  1XR0 B;  2ZPY A;  4HDQ A;  3PVW A;  5C16 A;  1FGY A;  1AWE A;  1M7E A;  1GC6 A;  1GC7 A;  4TYZ A;  2RSG A;  5CLL B;  3T06 A;  1DBH A;  5KQ1 A;  2J0M A;  4Y94 A;  2YSZ A;  3O96 A;  1WJM A;  5KCV A;  1U27 A;  3PEG A;  4PQ0 A;  4GMX B;  2Y7B A;  2YS5 A;  3RCP A;  3ULB A;  2BCJ A;  4HAY B;  1W1D A;  1ZC4 B;  3GYO A;  2MKR A;  2J0J A;  3A8P A;  3SO6 A;  2Y8G A;  4F7H A;  5C79 A;  4HB0 B;  3TCA A;  2D9Z A;  1X1F A;  5KQ4 A;  4K81 A;  1X05 A;  2YRY A;  1ZVR A;  2EMT A;  4HAU B;  3CIK A;  2YS3 A;  4C0A A;  4HAX B;  1FAO A;  2D9V A;  1I7A A;  3QIJ A;  2XQN M;  4L6E A;  1WG7 A;  3HW2 B;  2W2X C;  3PP2 A;  4YON A;  1DYN A;  1DRO A;  2CRF A;  1TXD A;  4HAV B;  1MK9 B;  2L2I A;  3KZ1 A;  4HHV A;  2GCL A;  2N23 A;  4IFS A;  1KI1 B;  4F7U P;  2Q13 A;  2YS1 A;  3P7Z A;  1UPR A;  2D9W A;  2DHK A;  2MFQ A;  3BIN A;  3LJU X;  2N0Y A;  4XWX A;  3F5R A;  1W1H A;  2DX1 A;  1XD4 A;  2ELA A;  2UZS A;  2G35 A;  1IRS A;  4DX9 0;  1K5D B;  2GJY A;  2GCJ A;  4A6F A;  2MWN B;  3ODO A;  4K2O A;  1LW3 A;  2J59 M;  3OAN A;  4HAW B;  3ZDT A;  2KGX B;  1UNQ A;  4A6F B;  1U5D A;  1FB8 A;  3ODX A;  1MPH A;  3KSY A;  4EKU A;  1AQC A;  2IYB A;  3FEH A;  2D11 A;  1FHW A;  3ML4 A;  4DBB A;  2ADZ A;  1NTV A;  1BWN A;  1NTY A;  3DXE A;  2D2Q A;  3SNH A;  4H8S A;  2VKI A;  1ISN A;  2MDX A;  4MK0 A;  1MAI A;  2PZ1 A;  3DXC A;  2LG1 A;  2QKM A;  4KHA A;  3TVV A;  3N7C A;  1I2H A;  3QWM A;  3IVF A;  5HE1 A;  4KHB B;  2K2U A;  2GS0 A;  1P5T A;  1XOD A;  1UNR A;  2IFS A;  3SYX A;  2W2W A;  4EJN A;  4CHJ A;  3GYP A;  4WSF A;  1B55 A;  5DIF B;  2L1C A;  1XKE A;  4NSW A;  5JHG A;  1X1G A;  1MKE A;  3D8F A;  3P6A A;  1N3H A;  1MK7 B;  3V5W A;  2COD A;  2D10 A;  4GPT B;  3AU4 A;  4ZRJ A;  2R09 A;  2H7D A;  2EC1 A;  2CY5 A;  3PG7 A;  2I5F A;  1V88 A;  2KCJ A;  2DHI A;  1QC6 A;  1K5G B;  2UVM A;  3VOQ A;  4HB3 B;  1Z87 A;  4DX8 A;  3M1I B;  4YL8 A;  5JHH A;  1P3R A;  1EGX A;  2OTX A;  1PMS A;  2EMS A;  5CLQ B;  4KAX B;  4A5K A;  3ODW A;  4A6K A;  2K00 A;  4MY6 A;  2DX5 A;  2DTC A;  1SGH A;  1XCG A;  3HK0 A;  1U2B A;  3MDB C;  2HTH B;  2YT0 A;  4HB4 B;  1ZSQ A;  2W2X D;  2I1J A;  2P0H A;  3PVU A;  1EAZ A;  5FI0 A;  1Y5O A;  1Q67 A;  1OY2 A;  2D4Q A;  5D3W A;  2P0F A;  2DA0 A;  2RNR B;  5JP4 A;  2Z0O A;  2LKO A;  5D27 A;  3CXB B;  2LOZ A;  2E2X A;  1GG3 A;  2I1K A;  5DHF B;  3D8D A;  1V5U A;  2DYN A;  4GN1 A;  5J3T A;  3VIA A;  3SV1 A;  1PLS A;  2Z0Q A;  4GZU A;  4Z2M B;  5FI1 A;  3TFM A;  1EF1 A;  2H7E A;  3A8Q A;  2VSZ A;  5C6R A;  1V61 A;  2ROV A;  1M7R A;  4GMV A;  2DN6 A;  4MT7 A;  1OMW A;  1KZ7 A;  2LYD A;  3A98 B;  1J19 A;  1V5P A;  2LOX A;  2FJL A;  4K2P A;  3D8E A;  4TKN A;  2R0D A;  2Z0P A;  1XX0 A;  4KVG B;  1WVH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...