2OTXA

Crystal structure of a n-terminal fragment of skap-hom containing both the helical dimerization domain and the ph domain
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
211
structure length
170
Chain Sequence
GSPEEIRNLLADVETFVADTLKGENLSKKAKEKRESLIKKIKDVKSVYLQEFQFPPIAAQDLPFVIKAGYLEKRRKDHSFLGFEWQKRWCALSKTVFYYYGSDKDKQQKGEFAIDGYDVRMNNTLRKDGKKDCCFEICAPDKRIYQFTAASPKDAEEWVQQLKFILQDLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Src kinase-associated phosphoprotein 2
publication title The Skap-hom dimerization and PH domains comprise a 3'-phosphoinositide-gated molecular switch.
pubmed doi rcsb
source organism Mus musculus
total genus 54
structure length 170
sequence length 211
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2otxA02
1V89A 1WG7A 4KHOA 2GCJA 2LULA 3AJ4A 4PNKA 1DBHA 4EMOA 2YSZA 1EAZA 3SV1A 3WA0A 2CAYA 1Y5OA 5C5BA 2CY5A 2DX1A 1PMSA 5JHGA 5C6RA 3GYPA 5J3YA 1J0WA 4TYZA 1PLSA 1NTYA 4NY0A 4EJNA 1U27A 3D8EA 1SGHA 4ZRIA 4HHVA 2GJYA 2DTCA 1DDWA 4H8SA 2J0JA 2LG1A 2XQNM 4BBKA 2KUPA 1GC6A 3KRWA 4KAXB 2M14A 1MPHA 1B55A 4Z2NA 3PVUA 1P5TA 2COFA 3HQCA 4Z2MB 3OANA 2YS1A 2LKOA 4HAZB 3PG7A 1EGXA 1WGQA 4HDQA 4HAWB 3TCAA 3KY9A 2RUKB 2CRFA 3TFMA 3DXEA 1BTKA 2OQBA 2LOXA 4KHAA 4D0NB 2E2XA 3CIKA 2MDXA 1EF1A 4A6FA 1V88A 2PZ1A 2ROVA 3G9WA 1FOEA 5JLJB 3U8ZA 3WYFB 3SUZA 1I7AA 5KQ1A 1V5UA 4DXAB 1LB1A 1AQCA 4YONA 1RJ2A 2LOZA 3IVFA 1X1GA 5DHFB 2YS5A 1P6SA 1UNRA 5HE1A 2IYBA 2DLWA 2N23A 1WI1A 4DBBA 1I2HA 2DFKA 3UZTA 4ZRKA 1ZC3B 2YRYA 2DKPA 1K5GB 2DN6A 1BWNA 1TXDA 4F7GA 3PSCA 3SO6A 3D8DA 2MFQA 2KCJA 4A6KA 4HB4B 1U29A 2EC1A 4L6EA 3FM8C 1OQNA 2D4QA 4HDOA 1W1GA 2RVBB 2Y8GA 1ZM0A 1H4RA 2YVCA 2RNRB 3AU5A 2NZ8B 4Y94A 5HE3A 1MIXA 3CXBB 4HAVB 1K5DB 2J59M 1FB8A 1QC6A 1Y19B 2COAA 3VOQA 1AWEA 4IFSA 2J0MA 2W2WA 3ULCA 2YF0A 1V5MA 2L2IA 2CODA 1DDVA 2DHIA 2RGNB 5KCVA 2JP2A 1OY2A 3FEHA 3AU4A 3T06A 3ZVRA 2DYQA 4TKNA 2DHKA 1WGUA 2K00A 1XD4A 1KZ7A 3PVLA 2G35A 1UPQA 4P7IA 4F7HA 1UNPA 1XKEA 3U7DA 5DIFB 3P7ZA 2I5CA 5GOWB 4HAYB 2AL6A 1W1DA 2MKRA 2RLOA 3PZDA 1BTNA 3ODOA 2P0DA 1IRSA 3KSYA 5CLLB 5J3QA 1QQGA 3SNHA 3ZDTA 3PP2A 2UZSA 1U5FA 1XR0B 4A6HA 4GPTB 3GYOA 4IOYX 3QIJA 1FHXA 4K2PA 4GMXB 5D27A 3N7CA 3ODXA 3PEGA 4K81A 5DI9B 1DROA 1UPRA 4K2OA 5JP4A 3QBVB 2RSGA 4B6HA 3F0WA 4EKUA 1SHCA 2D9ZA 1NU2A 5KQ4A 2DKQA 2VSZA 2D2QA 3F5RA 1GG3A 2P8VA 2M38A 1W1HA 5C79A 5L81A 3V5WA 3PVWA 1H10A 2Y7BA 4A5KA 2D9VA 5EFXA 3NSUA 3O96A 1WJMA 2D9XA 3TVVA 2EMSA 1J19A 2IFSA 3KRXA 5HE0A 1U2BA 5JHHA 3A8QA 3KZ1A 2W2XD 2I5FA 4HB2B 2HE7A 4HATB 5DH9B 1X05A 2P0FA 3RCPA 2KGXB 1LW3A 2W2XC 2L1CA 3SYXA 1WVHA 5J3TA 1Q67A 1TJ6A 4XWXA 5D3VA 1DDMA 2DX5A 2R0DA 2HTHB 3MPXA 4GZUA 2AEHA 5D3XA 2Z0QA 2R09A 2QKLA 1X86A 4NSWA 3MDBC 3A98B 3ODWA 2X18A 1PFJA 1U5DA 1N3HA 3HK0A 4KVGB 2ELBA 1EVHA 1P3RA 2YT1A 1M7RA 4WJ7A 3A8PA 4HAUB 2QKMA 2Q13A 4HB0B 1ZC4B 4GN1A 4ZRJA 1FGZA 2V76A 2FJLA 3DXCA 4A6FB 5D3WA 4DX8A 2D11A 1ZVRA 1GC7A 2YS3A 2UZRA 2Y8FA 4MT7A 1KI1B 4CHMA 1FAOA 1MK9B 4HAXB 3P6AA 2ADZA 1TQZA 3TW1A 1MKEA 1ZSQA 3X23A 1X11A 3BJIA 4HB3B 2D10A 1RRPB 2N0YA 1XODA 3ML4A 1UNQA 4GMVA 4YL8A 5LONB 1NTVA 3ULBA 2P0HA 4CYEA 2J0KA 4WVFB 2OTXA 2K2JA 5D3YA 2GCLA 2D9WA 1MIZB 3VIAA 1U5EA 4CHJA 1FHWA 1V5PA 4PQ0A 5FI0A 1M7EA 1E5WA 1U5GA 2H7EA 2K2UA 4GXBA 4DX90 2EJ8A 1Z87A 3D8FA 2ROZB 4K17A 2I1KA 5C5BB 2I1JA 1ISNA 1MAIA 5C16A 2MWNB 5LOPB 2Z0PA 1XX0A 1NI2A 1KZGA 5HE2A 2YT0A 4KHBB 1X1FA 1V61A 2ZPYA 3DXDA 4MK0A 1OMWA 2COCA 2H7DA 2UVMA 2ELAA 4WSFA 1WJ1A 4MY6A 3LJUX 1FGYA 4F7UP 2NMBA 3QWMA 5CLQB 3M1IB 2DA0A 1DYNA 2BCJA 1UEFA 2DYNA 2GS0A 5FI1A 5DHAB 2VKIA 3HW2B 2LYDA 2EMTA 4C0AA 1XCGA 4IAPA 1MK7B 2DHJA 2CY4A 2VRWB 2D9YA 1BAKA 2Z0OA 3TO1A 3BINA 1FHOA 3FSSA
chains in the Genus database with same CATH superfamily
1V89A 1WG7A 4KHOA 2GCJA 2LULA 3AJ4A 4PNKA 1DBHA 3NWDA 4EMOA 2YSZA 1EAZA 3SV1A 3WA0A 2CAYA 2YT2A 1Y5OA 5C5BA 2CY5A 2DX1A 1PMSA 5JHGA 5C6RA 3GYPA 5J3YA 4DIXA 1J0WA 4TYZA 1PLSA 1NTYA 4NY0A 2NBVA 1U27A 3D8EA 4EJNA 1SGHA 4ZRIA 4HHVA 2GJYA 2DTCA 1DDWA 4H8SA 2J0JA 2LG1A 2XQNM 4BBKA 4GNKB 2KUPA 1GC6A 3KRWA 4KAXB 2M14A 1MPHA 1B55A 4Z2NA 3PVUA 1P5TA 2COFA 3HQCA 4Z2MB 3OANA 1MI1A 2YS1A 2LKOA 4HAZB 3PG7A 1EGXA 1WGQA 4HDQA 4HAWB 2Z4DA 4QJ5B 3TCAA 3KY9A 2RUKB 2CRFA 3TFMA 3DXEA 1BTKA 2OQBA 2LOXA 3DCXA 4KHAA 4D0NB 2E2XA 3CIKA 2MDXA 1EF1A 4A6FA 5M4YB 2ZKMX 1V88A 5IRSA 2PZ1A 2ROVA 3G9WA 4D6WA 1FOEA 5JLJB 3U8ZA 3WYFB 3SUZA 1I7AA 5KQ1A 1V5UA 4DXAB 1LB1A 1AQCA 4YONA 1RJ2A 2K8EA 2Z13A 2LOZA 3IVFA 1X1GA 5DHFB 2YS5A 1P6SA 1UNRA 5HE1A 2IYBA 2DLWA 2N23A 1WI1A 4DBBA 1I2HA 2DFKA 3UZTA 4ZRKA 1ZC3B 2YRYA 2DKPA 1K5GB 2DN6A 1BWNA 5I2MA 1TXDA 4F7GA 3PSCA 3SO6A 3D8DA 2MFQA 2KCJA 4A6KA 4HB4B 1U29A 2EC1A 2GUMA 4L6EA 2KUQA 3FM8C 1OQNA 2D4QA 4HDOA 1W1GA 2RVBB 2Y8GA 1ZM0A 1H4RA 2YVCA 2RNRB 3AU5A 2NZ8B 4Y94A 5HE3A 1MIXA 3CXBB 4HAVB 1K5DB 2J59M 1FB8A 1QC6A 1Y19B 2COAA 4KHBA 3VOQA 1AWEA 4IFSA 3HIEA 2J0MA 2W2WA 3ULCA 2YF0A 1V5MA 5LG4B 2L2IA 2CODA 1DDVA 2DHIA 1T77A 2RGNB 5KCVA 2JP2A 1OY2A 3FEHA 3AU4A 3T06A 3ZVRA 2DYQA 4TKNA 2DHKA 1WGUA 2K00A 1XD4A 1KZ7A 3PVLA 2G35A 1UPQA 4P7IA 4OSNA 4F7HA 1UNPA 1XKEA 3U7DA 5DIFB 3P7ZA 5I2SA 2I5CA 5GOWB 4HAYB 2AL6A 1W1DA 2MKRA 2RLOA 3PZDA 1BTNA 3ODOA 2P0DA 1IRSA 3KSYA 5CLLB 5J3QA 2FJUB 1QQGA 3SNHA 3ZDTA 2UZSA 3PP2A 1U5FA 1XR0B 4A6HA 4GPTB 3GYOA 4IOYX 3QIJA 1FHXA 4K2PA 4GMXB 5D27A 3NWAA 3N7CA 3ODXA 4HSIA 3PEGA 4K81A 5DI9B 1DROA 1UPRA 4K2OA 5JP4A 3U12A 3QBVB 2RSGA 4B6HA 3F0WA 4EKUA 1SHCA 2D9ZA 1NU2A 5KQ4A 2DKQA 2KR0A 2VSZA 2D2QA 3F5RA 1GG3A 2P8VA 2M38A 1W1HA 5C79A 5L81A 3V5WA 3PVWA 1ZYIA 1H10A 2Y7BA 4A5KA 2D9VA 5EFXA 3NSUA 3O96A 1WJMA 2D9XA 3NW8A 3TVVA 2EMSA 1J19A 2IFSA 3KRXA 5HE0A 1U2BA 5JHHA 3A8QA 3KZ1A 2W2XD 2I5FA 4HB2B 2HE7A 4QJ3B 4HATB 5DH9B 4QJ4B 1X05A 2P0FA 3RCPA 2KGXB 1LW3A 2W2XC 2L1CA 3SYXA 1WVHA 5J3TA 1Q67A 1TJ6A 4XWXA 5D3VA 1DDMA 2DX5A 2R0DA 2HTHB 3MPXA 4GZUA 2AEHA 5D3XA 2Z0QA 2R09A 2Z59A 2QKLA 4OT1A 1X86A 4NSWA 3MDBC 3A98B 2X18A 3ODWA 1PFJA 1U5DA 1N3HA 3HK0A 4KVGB 2ELBA 1EVHA 1P3RA 2YT1A 1M7RA 4WJ7A 3A8PA 3FVCA 4HAUB 2QKMA 2Q13A 4HB0B 1ZC4B 4GN1A 4ZRJA 1FGZA 2V76A 2FJLA 4GOUA 3DXCA 4A6FB 5D3WA 4DX8A 2D11A 1ZVRA 3B77A 1GC7A 2YS3A 2UZRA 2Y8FA 2R2YA 4MT7A 1KI1B 4CHMA 1FAOA 1MK9B 2RRFA 4HAXB 3P6AA 2ADZA 2K49A 1TQZA 3TW1A 1MKEA 1ZSQA 3X23A 1X11A 3BJIA 4L1RA 4HB3B 3A58A 2D10A 1RRPB 2N0YA 1XODA 3ML4A 1UNQA 4GMVA 4YL8A 3OHMB 5LONB 1NTVA 3ULBA 2P0HA 4CYEA 2J0KA 4WVFB 2OTXA 2K2JA 5D3YA 2GCLA 2D9WA 1MIZB 3VIAA 1U5EA 4CHJA 1FHWA 1V5PA 4PQ0A 5FI0A 1M7EA 1E5WA 1U5GA 2H7EA 4CSQA 2K2UA 4GXBA 4DX90 2EJ8A 1Z87A 3D8FA 2ROZB 4K17A 2I1KA 5C5BB 2I1JA 1ISNA 1MAIA 5C16A 2MWNB 5LOPB 2Z0PA 1XX0A 3HSAA 1NI2A 1KZGA 5HE2A 2YT0A 4KHBB 2KIGA 1X1FA 1V61A 2ZPYA 3DXDA 4MK0A 1OMWA 2COCA 2H7DA 2UVMA 2ELAA 4WSFA 1WJ1A 4MY6A 3LJUX 1FGYA 2KIEA 4F7UP 2NMBA 3QWMA 5CLQB 3M1IB 2Z14A 2DA0A 1DYNA 2BCJA 1UEFA 2DYNA 2GS0A 5FI1A 4QXAB 5DHAB 2VKIA 3HW2B 2LYDA 2EMTA 4C0AA 1XCGA 4IAPA 1MK7B 2DHJA 2CY4A 2VRWB 2D9YA 1BAKA 2Z0OA 3TO1A 3NWFA 3BINA 1FHOA 3FSSA
chains in the Genus database with same CATH topology
1V89A 1WG7A 4KHOA 2GCJA 2LULA 3AJ4A 4PNKA 1DBHA 4EMOA 2YSZA 1EAZA 3SV1A 3WA0A 2CAYA 1Y5OA 5C5BA 2CY5A 2DX1A 1PMSA 5JHGA 5C6RA 3GYPA 5J3YA 1J0WA 4TYZA 1PLSA 1NTYA 4NY0A 4EJNA 1U27A 3D8EA 1SGHA 4ZRIA 4HHVA 2GJYA 2DTCA 1DDWA 4H8SA 2J0JA 2LG1A 2XQNM 4BBKA 2KUPA 1GC6A 3KRWA 4KAXB 2M14A 1MPHA 1B55A 4Z2NA 3PVUA 1P5TA 2COFA 3HQCA 4Z2MB 3OANA 2YS1A 2LKOA 4HAZB 3PG7A 1EGXA 1WGQA 4HDQA 4HAWB 3TCAA 3KY9A 2RUKB 2CRFA 3TFMA 3DXEA 1BTKA 2OQBA 2LOXA 4KHAA 4D0NB 2E2XA 3CIKA 2MDXA 1EF1A 4A6FA 1V88A 2PZ1A 2ROVA 3G9WA 1FOEA 5JLJB 3U8ZA 3WYFB 3SUZA 1I7AA 5KQ1A 1V5UA 4DXAB 1LB1A 1AQCA 4YONA 1RJ2A 2LOZA 3IVFA 1X1GA 5DHFB 2YS5A 1P6SA 1UNRA 5HE1A 2IYBA 2DLWA 2N23A 1WI1A 4DBBA 1I2HA 2DFKA 3UZTA 4ZRKA 1ZC3B 2YRYA 2DKPA 1K5GB 2DN6A 1BWNA 1TXDA 4F7GA 3PSCA 3SO6A 3D8DA 2MFQA 2KCJA 4A6KA 4HB4B 1U29A 2EC1A 4L6EA 3FM8C 1OQNA 2D4QA 4HDOA 1W1GA 2RVBB 2Y8GA 1ZM0A 1H4RA 2YVCA 2RNRB 3AU5A 2NZ8B 4Y94A 5HE3A 1MIXA 3CXBB 4HAVB 1K5DB 2J59M 1FB8A 1QC6A 1Y19B 2COAA 3VOQA 1AWEA 4IFSA 2J0MA 2W2WA 3ULCA 2YF0A 1V5MA 2L2IA 2CODA 1DDVA 2DHIA 2RGNB 5KCVA 2JP2A 1OY2A 3FEHA 3AU4A 3T06A 3ZVRA 2DYQA 4TKNA 2DHKA 1WGUA 2K00A 1XD4A 1KZ7A 3PVLA 2G35A 1UPQA 4P7IA 4F7HA 1UNPA 1XKEA 3U7DA 5DIFB 3P7ZA 2I5CA 5GOWB 4HAYB 2AL6A 1W1DA 2MKRA 2RLOA 3PZDA 1BTNA 3ODOA 2P0DA 1IRSA 3KSYA 5CLLB 5J3QA 1QQGA 3SNHA 3ZDTA 3PP2A 2UZSA 1U5FA 1XR0B 4A6HA 4GPTB 3GYOA 4IOYX 3QIJA 1FHXA 4K2PA 4GMXB 5D27A 3N7CA 3ODXA 3PEGA 4K81A 5DI9B 1DROA 1UPRA 4K2OA 5JP4A 3QBVB 2RSGA 4B6HA 3F0WA 4EKUA 1SHCA 2D9ZA 1NU2A 5KQ4A 2DKQA 2VSZA 2D2QA 3F5RA 1GG3A 2P8VA 2M38A 1W1HA 5C79A 5L81A 3V5WA 3PVWA 1H10A 2Y7BA 4A5KA 2D9VA 5EFXA 3NSUA 3O96A 1WJMA 2D9XA 3TVVA 2EMSA 1J19A 2IFSA 3KRXA 5HE0A 1U2BA 5JHHA 3A8QA 3KZ1A 2W2XD 2I5FA 4HB2B 2HE7A 4HATB 5DH9B 1X05A 2P0FA 3RCPA 2KGXB 1LW3A 2W2XC 2L1CA 3SYXA 1WVHA 5J3TA 1Q67A 1TJ6A 4XWXA 5D3VA 1DDMA 2DX5A 2R0DA 2HTHB 3MPXA 4GZUA 2AEHA 5D3XA 2Z0QA 2R09A 2QKLA 1X86A 4NSWA 3MDBC 3A98B 3ODWA 2X18A 1PFJA 1U5DA 1N3HA 3HK0A 4KVGB 2ELBA 1EVHA 1P3RA 2YT1A 1M7RA 4WJ7A 3A8PA 4HAUB 2QKMA 2Q13A 4HB0B 1ZC4B 4GN1A 4ZRJA 1FGZA 2V76A 2FJLA 3DXCA 4A6FB 5D3WA 4DX8A 2D11A 1ZVRA 1GC7A 2YS3A 2UZRA 2Y8FA 4MT7A 1KI1B 4CHMA 1FAOA 1MK9B 4HAXB 3P6AA 2ADZA 1TQZA 3TW1A 1MKEA 1ZSQA 3X23A 1X11A 3BJIA 4HB3B 2D10A 1RRPB 2N0YA 1XODA 3ML4A 1UNQA 4GMVA 4YL8A 5LONB 1NTVA 3ULBA 2P0HA 4CYEA 2J0KA 4WVFB 2OTXA 2K2JA 5D3YA 2GCLA 2D9WA 1MIZB 3VIAA 1U5EA 4CHJA 1FHWA 1V5PA 4PQ0A 5FI0A 1M7EA 1E5WA 1U5GA 2H7EA 2K2UA 4GXBA 4DX90 2EJ8A 1Z87A 3D8FA 2ROZB 4K17A 2I1KA 5C5BB 2I1JA 1ISNA 1MAIA 5C16A 2MWNB 5LOPB 2Z0PA 1XX0A 1NI2A 1KZGA 5HE2A 2YT0A 4KHBB 1X1FA 1V61A 2ZPYA 3DXDA 4MK0A 1OMWA 2COCA 2H7DA 2UVMA 2ELAA 4WSFA 1WJ1A 4MY6A 3LJUX 1FGYA 4F7UP 2NMBA 3QWMA 5CLQB 3M1IB 2DA0A 1DYNA 2BCJA 1UEFA 2DYNA 2GS0A 5FI1A 5DHAB 2VKIA 3HW2B 2LYDA 2EMTA 4C0AA 1XCGA 4IAPA 1MK7B 2DHJA 2CY4A 2VRWB 2D9YA 1BAKA 2Z0OA 3TO1A 3BINA 1FHOA 3FSSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1V89 A;  1WG7 A;  4KHO A;  2GCJ A;  2LUL A;  3AJ4 A;  4PNK A;  1DBH A;  4EMO A;  2YSZ A;  1EAZ A;  3SV1 A;  3WA0 A;  2CAY A;  1Y5O A;  5C5B A;  2CY5 A;  2DX1 A;  1PMS A;  5JHG A;  5C6R A;  3GYP A;  5J3Y A;  1J0W A;  4TYZ A;  1PLS A;  1NTY A;  4NY0 A;  4EJN A;  1U27 A;  3D8E A;  1SGH A;  4ZRI A;  4HHV A;  2GJY A;  2DTC A;  1DDW A;  4H8S A;  2J0J A;  2LG1 A;  2XQN M;  4BBK A;  2KUP A;  1GC6 A;  3KRW A;  4KAX B;  2M14 A;  1MPH A;  1B55 A;  4Z2N A;  3PVU A;  1P5T A;  2COF A;  3HQC A;  4Z2M B;  3OAN A;  2YS1 A;  2LKO A;  4HAZ B;  3PG7 A;  1EGX A;  1WGQ A;  4HDQ A;  4HAW B;  3TCA A;  3KY9 A;  2RUK B;  2CRF A;  3TFM A;  3DXE A;  1BTK A;  2OQB A;  2LOX A;  4KHA A;  4D0N B;  2E2X A;  3CIK A;  2MDX A;  1EF1 A;  4A6F A;  1V88 A;  2PZ1 A;  2ROV A;  3G9W A;  1FOE A;  5JLJ B;  3U8Z A;  3WYF B;  3SUZ A;  1I7A A;  5KQ1 A;  1V5U A;  4DXA B;  1LB1 A;  1AQC A;  4YON A;  1RJ2 A;  2LOZ A;  3IVF A;  1X1G A;  5DHF B;  2YS5 A;  1P6S A;  1UNR A;  5HE1 A;  2IYB A;  2DLW A;  2N23 A;  1WI1 A;  4DBB A;  1I2H A;  2DFK A;  3UZT A;  4ZRK A;  1ZC3 B;  2YRY A;  2DKP A;  1K5G B;  2DN6 A;  1BWN A;  1TXD A;  4F7G A;  3PSC A;  3SO6 A;  3D8D A;  2MFQ A;  2KCJ A;  4A6K A;  4HB4 B;  1U29 A;  2EC1 A;  4L6E A;  3FM8 C;  1OQN A;  2D4Q A;  4HDO A;  1W1G A;  2RVB B;  2Y8G A;  1ZM0 A;  1H4R A;  2YVC A;  2RNR B;  3AU5 A;  2NZ8 B;  4Y94 A;  5HE3 A;  1MIX A;  3CXB B;  4HAV B;  1K5D B;  2J59 M;  1FB8 A;  1QC6 A;  1Y19 B;  2COA A;  3VOQ A;  1AWE A;  4IFS A;  2J0M A;  2W2W A;  3ULC A;  2YF0 A;  1V5M A;  2L2I A;  2COD A;  1DDV A;  2DHI A;  2RGN B;  5KCV A;  2JP2 A;  1OY2 A;  3FEH A;  3AU4 A;  3T06 A;  3ZVR A;  2DYQ A;  4TKN A;  2DHK A;  1WGU A;  2K00 A;  1XD4 A;  1KZ7 A;  3PVL A;  2G35 A;  1UPQ A;  4P7I A;  4F7H A;  1UNP A;  1XKE A;  3U7D A;  5DIF B;  3P7Z A;  2I5C A;  5GOW B;  4HAY B;  2AL6 A;  1W1D A;  2MKR A;  2RLO A;  3PZD A;  1BTN A;  3ODO A;  2P0D A;  1IRS A;  3KSY A;  5CLL B;  5J3Q A;  1QQG A;  3SNH A;  3ZDT A;  3PP2 A;  2UZS A;  1U5F A;  1XR0 B;  4A6H A;  4GPT B;  3GYO A;  4IOY X;  3QIJ A;  1FHX A;  4K2P A;  4GMX B;  5D27 A;  3N7C A;  3ODX A;  3PEG A;  4K81 A;  5DI9 B;  1DRO A;  1UPR A;  4K2O A;  5JP4 A;  3QBV B;  2RSG A;  4B6H A;  3F0W A;  4EKU A;  1SHC A;  2D9Z A;  1NU2 A;  5KQ4 A;  2DKQ A;  2VSZ A;  2D2Q A;  3F5R A;  1GG3 A;  2P8V A;  2M38 A;  1W1H A;  5C79 A;  5L81 A;  3V5W A;  3PVW A;  1H10 A;  2Y7B A;  4A5K A;  2D9V A;  5EFX A;  3NSU A;  3O96 A;  1WJM A;  2D9X A;  3TVV A;  2EMS A;  1J19 A;  2IFS A;  3KRX A;  5HE0 A;  1U2B A;  5JHH A;  3A8Q A;  3KZ1 A;  2W2X D;  2I5F A;  4HB2 B;  2HE7 A;  4HAT B;  5DH9 B;  1X05 A;  2P0F A;  3RCP A;  2KGX B;  1LW3 A;  2W2X C;  2L1C A;  3SYX A;  1WVH A;  5J3T A;  1Q67 A;  1TJ6 A;  4XWX A;  5D3V A;  1DDM A;  2DX5 A;  2R0D A;  2HTH B;  3MPX A;  4GZU A;  2AEH A;  5D3X A;  2Z0Q A;  2R09 A;  2QKL A;  1X86 A;  4NSW A;  3MDB C;  3A98 B;  3ODW A;  2X18 A;  1PFJ A;  1U5D A;  1N3H A;  3HK0 A;  4KVG B;  2ELB A;  1EVH A;  1P3R A;  2YT1 A;  1M7R A;  4WJ7 A;  3A8P A;  4HAU B;  2QKM A;  2Q13 A;  4HB0 B;  1ZC4 B;  4GN1 A;  4ZRJ A;  1FGZ A;  2V76 A;  2FJL A;  3DXC A;  4A6F B;  5D3W A;  4DX8 A;  2D11 A;  1ZVR A;  1GC7 A;  2YS3 A;  2UZR A;  2Y8F A;  4MT7 A;  1KI1 B;  4CHM A;  1FAO A;  1MK9 B;  4HAX B;  3P6A A;  2ADZ A;  1TQZ A;  3TW1 A;  1MKE A;  1ZSQ A;  3X23 A;  1X11 A;  3BJI A;  4HB3 B;  2D10 A;  1RRP B;  2N0Y A;  1XOD A;  3ML4 A;  1UNQ A;  4GMV A;  4YL8 A;  5LON B;  1NTV A;  3ULB A;  2P0H A;  4CYE A;  2J0K A;  4WVF B;  2OTX A;  2K2J A;  5D3Y A;  2GCL A;  2D9W A;  1MIZ B;  3VIA A;  1U5E A;  4CHJ A;  1FHW A;  1V5P A;  4PQ0 A;  5FI0 A;  1M7E A;  1E5W A;  1U5G A;  2H7E A;  2K2U A;  4GXB A;  4DX9 0;  2EJ8 A;  1Z87 A;  3D8F A;  2ROZ B;  4K17 A;  2I1K A;  5C5B B;  2I1J A;  1ISN A;  1MAI A;  5C16 A;  2MWN B;  5LOP B;  2Z0P A;  1XX0 A;  1NI2 A;  1KZG A;  5HE2 A;  2YT0 A;  4KHB B;  1X1F A;  1V61 A;  2ZPY A;  3DXD A;  4MK0 A;  1OMW A;  2COC A;  2H7D A;  2UVM A;  2ELA A;  4WSF A;  1WJ1 A;  4MY6 A;  3LJU X;  1FGY A;  4F7U P;  2NMB A;  3QWM A;  5CLQ B;  3M1I B;  2DA0 A;  1DYN A;  2BCJ A;  1UEF A;  2DYN A;  2GS0 A;  5FI1 A;  5DHA B;  2VKI A;  3HW2 B;  2LYD A;  2EMT A;  4C0A A;  1XCG A;  4IAP A;  1MK7 B;  2DHJ A;  2CY4 A;  2VRW B;  2D9Y A;  1BAK A;  2Z0O A;  3TO1 A;  3BIN A;  1FHO A;  3FSS A; 
#chains in the Genus database with same CATH topology
 1V89 A;  1WG7 A;  4KHO A;  2GCJ A;  2LUL A;  3AJ4 A;  4PNK A;  1DBH A;  3NWD A;  4EMO A;  2YSZ A;  1EAZ A;  3SV1 A;  3WA0 A;  2CAY A;  2YT2 A;  1Y5O A;  5C5B A;  2CY5 A;  2DX1 A;  1PMS A;  5JHG A;  5C6R A;  3GYP A;  5J3Y A;  4DIX A;  1J0W A;  4TYZ A;  1PLS A;  1NTY A;  4NY0 A;  2NBV A;  1U27 A;  3D8E A;  4EJN A;  1SGH A;  4ZRI A;  4HHV A;  2GJY A;  2DTC A;  1DDW A;  4H8S A;  2J0J A;  2LG1 A;  2XQN M;  4BBK A;  4GNK B;  2KUP A;  1GC6 A;  3KRW A;  4KAX B;  2M14 A;  1MPH A;  1B55 A;  4Z2N A;  3PVU A;  1P5T A;  2COF A;  3HQC A;  4Z2M B;  3OAN A;  1MI1 A;  2YS1 A;  2LKO A;  4HAZ B;  3PG7 A;  1EGX A;  1WGQ A;  4HDQ A;  4HAW B;  2Z4D A;  4QJ5 B;  3TCA A;  3KY9 A;  2RUK B;  2CRF A;  3TFM A;  3DXE A;  1BTK A;  2OQB A;  2LOX A;  3DCX A;  4KHA A;  4D0N B;  2E2X A;  3CIK A;  2MDX A;  1EF1 A;  4A6F A;  5M4Y B;  2ZKM X;  1V88 A;  5IRS A;  2PZ1 A;  2ROV A;  3G9W A;  4D6W A;  1FOE A;  5JLJ B;  3U8Z A;  3WYF B;  3SUZ A;  1I7A A;  5KQ1 A;  1V5U A;  4DXA B;  1LB1 A;  1AQC A;  4YON A;  1RJ2 A;  2K8E A;  2Z13 A;  2LOZ A;  3IVF A;  1X1G A;  5DHF B;  2YS5 A;  1P6S A;  1UNR A;  5HE1 A;  2IYB A;  2DLW A;  2N23 A;  1WI1 A;  4DBB A;  1I2H A;  2DFK A;  3UZT A;  4ZRK A;  1ZC3 B;  2YRY A;  2DKP A;  1K5G B;  2DN6 A;  1BWN A;  5I2M A;  1TXD A;  4F7G A;  3PSC A;  3SO6 A;  3D8D A;  2MFQ A;  2KCJ A;  4A6K A;  4HB4 B;  1U29 A;  2EC1 A;  2GUM A;  4L6E A;  2KUQ A;  3FM8 C;  1OQN A;  2D4Q A;  4HDO A;  1W1G A;  2RVB B;  2Y8G A;  1ZM0 A;  1H4R A;  2YVC A;  2RNR B;  3AU5 A;  2NZ8 B;  4Y94 A;  5HE3 A;  1MIX A;  3CXB B;  4HAV B;  1K5D B;  2J59 M;  1FB8 A;  1QC6 A;  1Y19 B;  2COA A;  4KHB A;  3VOQ A;  1AWE A;  4IFS A;  3HIE A;  2J0M A;  2W2W A;  3ULC A;  2YF0 A;  1V5M A;  5LG4 B;  2L2I A;  2COD A;  1DDV A;  2DHI A;  1T77 A;  2RGN B;  5KCV A;  2JP2 A;  1OY2 A;  3FEH A;  3AU4 A;  3T06 A;  3ZVR A;  2DYQ A;  4TKN A;  2DHK A;  1WGU A;  2K00 A;  1XD4 A;  1KZ7 A;  3PVL A;  2G35 A;  1UPQ A;  4P7I A;  4OSN A;  4F7H A;  1UNP A;  1XKE A;  3U7D A;  5DIF B;  3P7Z A;  5I2S A;  2I5C A;  5GOW B;  4HAY B;  2AL6 A;  1W1D A;  2MKR A;  2RLO A;  3PZD A;  1BTN A;  3ODO A;  2P0D A;  1IRS A;  3KSY A;  5CLL B;  5J3Q A;  2FJU B;  1QQG A;  3SNH A;  3ZDT A;  2UZS A;  3PP2 A;  1U5F A;  1XR0 B;  4A6H A;  4GPT B;  3GYO A;  4IOY X;  3QIJ A;  1FHX A;  4K2P A;  4GMX B;  5D27 A;  3NWA A;  3N7C A;  3ODX A;  4HSI A;  3PEG A;  4K81 A;  5DI9 B;  1DRO A;  1UPR A;  4K2O A;  5JP4 A;  3U12 A;  3QBV B;  2RSG A;  4B6H A;  3F0W A;  4EKU A;  1SHC A;  2D9Z A;  1NU2 A;  5KQ4 A;  2DKQ A;  2KR0 A;  2VSZ A;  2D2Q A;  3F5R A;  1GG3 A;  2P8V A;  2M38 A;  1W1H A;  5C79 A;  5L81 A;  3V5W A;  3PVW A;  1ZYI A;  1H10 A;  2Y7B A;  4A5K A;  2D9V A;  5EFX A;  3NSU A;  3O96 A;  1WJM A;  2D9X A;  3NW8 A;  3TVV A;  2EMS A;  1J19 A;  2IFS A;  3KRX A;  5HE0 A;  1U2B A;  5JHH A;  3A8Q A;  3KZ1 A;  2W2X D;  2I5F A;  4HB2 B;  2HE7 A;  4QJ3 B;  4HAT B;  5DH9 B;  4QJ4 B;  1X05 A;  2P0F A;  3RCP A;  2KGX B;  1LW3 A;  2W2X C;  2L1C A;  3SYX A;  1WVH A;  5J3T A;  1Q67 A;  1TJ6 A;  4XWX A;  5D3V A;  1DDM A;  2DX5 A;  2R0D A;  2HTH B;  3MPX A;  4GZU A;  2AEH A;  5D3X A;  2Z0Q A;  2R09 A;  2Z59 A;  2QKL A;  4OT1 A;  1X86 A;  4NSW A;  3MDB C;  3A98 B;  2X18 A;  3ODW A;  1PFJ A;  1U5D A;  1N3H A;  3HK0 A;  4KVG B;  2ELB A;  1EVH A;  1P3R A;  2YT1 A;  1M7R A;  4WJ7 A;  3A8P A;  3FVC A;  4HAU B;  2QKM A;  2Q13 A;  4HB0 B;  1ZC4 B;  4GN1 A;  4ZRJ A;  1FGZ A;  2V76 A;  2FJL A;  4GOU A;  3DXC A;  4A6F B;  5D3W A;  4DX8 A;  2D11 A;  1ZVR A;  3B77 A;  1GC7 A;  2YS3 A;  2UZR A;  2Y8F A;  2R2Y A;  4MT7 A;  1KI1 B;  4CHM A;  1FAO A;  1MK9 B;  2RRF A;  4HAX B;  3P6A A;  2ADZ A;  2K49 A;  1TQZ A;  3TW1 A;  1MKE A;  1ZSQ A;  3X23 A;  1X11 A;  3BJI A;  4L1R A;  4HB3 B;  3A58 A;  2D10 A;  1RRP B;  2N0Y A;  1XOD A;  3ML4 A;  1UNQ A;  4GMV A;  4YL8 A;  3OHM B;  5LON B;  1NTV A;  3ULB A;  2P0H A;  4CYE A;  2J0K A;  4WVF B;  2OTX A;  2K2J A;  5D3Y A;  2GCL A;  2D9W A;  1MIZ B;  3VIA A;  1U5E A;  4CHJ A;  1FHW A;  1V5P A;  4PQ0 A;  5FI0 A;  1M7E A;  1E5W A;  1U5G A;  2H7E A;  4CSQ A;  2K2U A;  4GXB A;  4DX9 0;  2EJ8 A;  1Z87 A;  3D8F A;  2ROZ B;  4K17 A;  2I1K A;  5C5B B;  2I1J A;  1ISN A;  1MAI A;  5C16 A;  2MWN B;  5LOP B;  2Z0P A;  1XX0 A;  3HSA A;  1NI2 A;  1KZG A;  5HE2 A;  2YT0 A;  4KHB B;  2KIG A;  1X1F A;  1V61 A;  2ZPY A;  3DXD A;  4MK0 A;  1OMW A;  2COC A;  2H7D A;  2UVM A;  2ELA A;  4WSF A;  1WJ1 A;  4MY6 A;  3LJU X;  1FGY A;  2KIE A;  4F7U P;  2NMB A;  3QWM A;  5CLQ B;  3M1I B;  2Z14 A;  2DA0 A;  1DYN A;  2BCJ A;  1UEF A;  2DYN A;  2GS0 A;  5FI1 A;  4QXA B;  5DHA B;  2VKI A;  3HW2 B;  2LYD A;  2EMT A;  4C0A A;  1XCG A;  4IAP A;  1MK7 B;  2DHJ A;  2CY4 A;  2VRW B;  2D9Y A;  1BAK A;  2Z0O A;  3TO1 A;  3NWF A;  3BIN A;  1FHO A;  3FSS A; 
#chains in the Genus database with same CATH homology
 1V89 A;  1WG7 A;  4KHO A;  2GCJ A;  2LUL A;  3AJ4 A;  4PNK A;  1DBH A;  4EMO A;  2YSZ A;  1EAZ A;  3SV1 A;  3WA0 A;  2CAY A;  1Y5O A;  5C5B A;  2CY5 A;  2DX1 A;  1PMS A;  5JHG A;  5C6R A;  3GYP A;  5J3Y A;  1J0W A;  4TYZ A;  1PLS A;  1NTY A;  4NY0 A;  4EJN A;  1U27 A;  3D8E A;  1SGH A;  4ZRI A;  4HHV A;  2GJY A;  2DTC A;  1DDW A;  4H8S A;  2J0J A;  2LG1 A;  2XQN M;  4BBK A;  2KUP A;  1GC6 A;  3KRW A;  4KAX B;  2M14 A;  1MPH A;  1B55 A;  4Z2N A;  3PVU A;  1P5T A;  2COF A;  3HQC A;  4Z2M B;  3OAN A;  2YS1 A;  2LKO A;  4HAZ B;  3PG7 A;  1EGX A;  1WGQ A;  4HDQ A;  4HAW B;  3TCA A;  3KY9 A;  2RUK B;  2CRF A;  3TFM A;  3DXE A;  1BTK A;  2OQB A;  2LOX A;  4KHA A;  4D0N B;  2E2X A;  3CIK A;  2MDX A;  1EF1 A;  4A6F A;  1V88 A;  2PZ1 A;  2ROV A;  3G9W A;  1FOE A;  5JLJ B;  3U8Z A;  3WYF B;  3SUZ A;  1I7A A;  5KQ1 A;  1V5U A;  4DXA B;  1LB1 A;  1AQC A;  4YON A;  1RJ2 A;  2LOZ A;  3IVF A;  1X1G A;  5DHF B;  2YS5 A;  1P6S A;  1UNR A;  5HE1 A;  2IYB A;  2DLW A;  2N23 A;  1WI1 A;  4DBB A;  1I2H A;  2DFK A;  3UZT A;  4ZRK A;  1ZC3 B;  2YRY A;  2DKP A;  1K5G B;  2DN6 A;  1BWN A;  1TXD A;  4F7G A;  3PSC A;  3SO6 A;  3D8D A;  2MFQ A;  2KCJ A;  4A6K A;  4HB4 B;  1U29 A;  2EC1 A;  4L6E A;  3FM8 C;  1OQN A;  2D4Q A;  4HDO A;  1W1G A;  2RVB B;  2Y8G A;  1ZM0 A;  1H4R A;  2YVC A;  2RNR B;  3AU5 A;  2NZ8 B;  4Y94 A;  5HE3 A;  1MIX A;  3CXB B;  4HAV B;  1K5D B;  2J59 M;  1FB8 A;  1QC6 A;  1Y19 B;  2COA A;  3VOQ A;  1AWE A;  4IFS A;  2J0M A;  2W2W A;  3ULC A;  2YF0 A;  1V5M A;  2L2I A;  2COD A;  1DDV A;  2DHI A;  2RGN B;  5KCV A;  2JP2 A;  1OY2 A;  3FEH A;  3AU4 A;  3T06 A;  3ZVR A;  2DYQ A;  4TKN A;  2DHK A;  1WGU A;  2K00 A;  1XD4 A;  1KZ7 A;  3PVL A;  2G35 A;  1UPQ A;  4P7I A;  4F7H A;  1UNP A;  1XKE A;  3U7D A;  5DIF B;  3P7Z A;  2I5C A;  5GOW B;  4HAY B;  2AL6 A;  1W1D A;  2MKR A;  2RLO A;  3PZD A;  1BTN A;  3ODO A;  2P0D A;  1IRS A;  3KSY A;  5CLL B;  5J3Q A;  1QQG A;  3SNH A;  3ZDT A;  3PP2 A;  2UZS A;  1U5F A;  1XR0 B;  4A6H A;  4GPT B;  3GYO A;  4IOY X;  3QIJ A;  1FHX A;  4K2P A;  4GMX B;  5D27 A;  3N7C A;  3ODX A;  3PEG A;  4K81 A;  5DI9 B;  1DRO A;  1UPR A;  4K2O A;  5JP4 A;  3QBV B;  2RSG A;  4B6H A;  3F0W A;  4EKU A;  1SHC A;  2D9Z A;  1NU2 A;  5KQ4 A;  2DKQ A;  2VSZ A;  2D2Q A;  3F5R A;  1GG3 A;  2P8V A;  2M38 A;  1W1H A;  5C79 A;  5L81 A;  3V5W A;  3PVW A;  1H10 A;  2Y7B A;  4A5K A;  2D9V A;  5EFX A;  3NSU A;  3O96 A;  1WJM A;  2D9X A;  3TVV A;  2EMS A;  1J19 A;  2IFS A;  3KRX A;  5HE0 A;  1U2B A;  5JHH A;  3A8Q A;  3KZ1 A;  2W2X D;  2I5F A;  4HB2 B;  2HE7 A;  4HAT B;  5DH9 B;  1X05 A;  2P0F A;  3RCP A;  2KGX B;  1LW3 A;  2W2X C;  2L1C A;  3SYX A;  1WVH A;  5J3T A;  1Q67 A;  1TJ6 A;  4XWX A;  5D3V A;  1DDM A;  2DX5 A;  2R0D A;  2HTH B;  3MPX A;  4GZU A;  2AEH A;  5D3X A;  2Z0Q A;  2R09 A;  2QKL A;  1X86 A;  4NSW A;  3MDB C;  3A98 B;  3ODW A;  2X18 A;  1PFJ A;  1U5D A;  1N3H A;  3HK0 A;  4KVG B;  2ELB A;  1EVH A;  1P3R A;  2YT1 A;  1M7R A;  4WJ7 A;  3A8P A;  4HAU B;  2QKM A;  2Q13 A;  4HB0 B;  1ZC4 B;  4GN1 A;  4ZRJ A;  1FGZ A;  2V76 A;  2FJL A;  3DXC A;  4A6F B;  5D3W A;  4DX8 A;  2D11 A;  1ZVR A;  1GC7 A;  2YS3 A;  2UZR A;  2Y8F A;  4MT7 A;  1KI1 B;  4CHM A;  1FAO A;  1MK9 B;  4HAX B;  3P6A A;  2ADZ A;  1TQZ A;  3TW1 A;  1MKE A;  1ZSQ A;  3X23 A;  1X11 A;  3BJI A;  4HB3 B;  2D10 A;  1RRP B;  2N0Y A;  1XOD A;  3ML4 A;  1UNQ A;  4GMV A;  4YL8 A;  5LON B;  1NTV A;  3ULB A;  2P0H A;  4CYE A;  2J0K A;  4WVF B;  2OTX A;  2K2J A;  5D3Y A;  2GCL A;  2D9W A;  1MIZ B;  3VIA A;  1U5E A;  4CHJ A;  1FHW A;  1V5P A;  4PQ0 A;  5FI0 A;  1M7E A;  1E5W A;  1U5G A;  2H7E A;  2K2U A;  4GXB A;  4DX9 0;  2EJ8 A;  1Z87 A;  3D8F A;  2ROZ B;  4K17 A;  2I1K A;  5C5B B;  2I1J A;  1ISN A;  1MAI A;  5C16 A;  2MWN B;  5LOP B;  2Z0P A;  1XX0 A;  1NI2 A;  1KZG A;  5HE2 A;  2YT0 A;  4KHB B;  1X1F A;  1V61 A;  2ZPY A;  3DXD A;  4MK0 A;  1OMW A;  2COC A;  2H7D A;  2UVM A;  2ELA A;  4WSF A;  1WJ1 A;  4MY6 A;  3LJU X;  1FGY A;  4F7U P;  2NMB A;  3QWM A;  5CLQ B;  3M1I B;  2DA0 A;  1DYN A;  2BCJ A;  1UEF A;  2DYN A;  2GS0 A;  5FI1 A;  5DHA B;  2VKI A;  3HW2 B;  2LYD A;  2EMT A;  4C0A A;  1XCG A;  4IAP A;  1MK7 B;  2DHJ A;  2CY4 A;  2VRW B;  2D9Y A;  1BAK A;  2Z0O A;  3TO1 A;  3BIN A;  1FHO A;  3FSS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...