3SO6A

Crystal structure of the ldl receptor tail in complex with autosomal recessive hypercholesterolemia ptb domain
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
137
structure length
137
Chain Sequence
b'MEGMVFSLKYLGMTLVERPKGEELSAAAVKRIVATAKASGKKLQKVTLKVSPRGIILTDSLTSQLIENVSIYRISYCTADKMHDKVFAYIAQSQQNESLECHAFLCTKRKVAQAVTLTVAQAFKVAFEFWQVSLVPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LDL receptor adaptor protein
publication title Atomic structure of the autosomal recessive hypercholesterolemia phosphotyrosine-binding domain in complex with the LDL-receptor tail.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Protein binding/protein transport
total genus 39
structure length 137
sequence length 137
ec nomenclature
pdb deposition date 2011-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00640 PID Phosphotyrosine interaction domain (PTB/PID)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3so6A00
4HB0B 1U27A 3TO1A 3AU5A 2DYNA 2L1CA 2D2QA 3AJ4A 2GJYA 3U8ZA 1WG7A 5D27A 5DIFB 4DX8A 2EJ8A 2VKIA 2YF0A 1ZC3B 2AL6A 1X1GA 1W1DA 1OMWA 5D3YA 5JHGA 2AEHA 4B6HA 1BWNA 4NY0A 3QBVB 5JP4A 1LB1A 3CIKA 1XD4A 2RGNB 1N3HA 1SHCA 5DHFB 2W2XC 3KZ1A 4D0NB 5HE2A 4HAYB 2EMSA 2HE7A 4EKUA 1FB8A 4P7IA 4GMXB 5J3TA 1RRPB 4HAXB 2NZ8B 1XODA 2DX1A 4Y94A 3TVVA 3N7CA 4MK0A 3PVUA 3KY9A 2YS1A 1AQCA 5C5BB 1UPRA 2YS3A 4HATB 1MK7B 1U5GA 3BINA 4DXAB 4A6HA 4C0AA 3VIAA 1DBHA 2UVMA 2RNRB 1NTYA 4MY6A 3DXEA 2Z0PA 3UZTA 2K00A 2I5CA 2MDXA 1PFJA 4PQ0A 1MKEA 3TFMA 3AU4A 2RUKB 2GCJA 3HK0A 1XCGA 2YSZA 4K17A 1MAIA 3MPXA 1K5GB 2I1JA 2ZPYA 3PVWA 3PVLA 2VSZA 1FHXA 4HB4B 4DBBA 4XWXA 4Z2MB 1V5MA 1FHWA 1OY2A 4HAUB 2RSGA 3FEHA 1IRSA 1DDWA 1QC6A 4K81A 1B55A 1GG3A 4GMVA 1P5TA 3SV1A 3OANA 2N0YA 3SUZA 1PLSA 3ULBA 1LW3A 2H7EA 2MKRA 2R0DA 1I7AA 1TQZA 1M7RA 3PEGA 2I5FA 4K2PA 2KGXB 1WVHA 2D4QA 2OTXA 5D3VA 3IVFA 5CLQB 3PZDA 1ZVRA 1UNQA 2MFQA 3KRXA 1V61A 4KHOA 5HE3A 2RVBB 1KI1B 4WJ7A 2D9XA 3PSCA 4HB2B 1XKEA 3LJUX 3T06A 1P6SA 2CY5A 2DX5A 3SO6A 3P6AA 1E5WA 2J0JA 3ULCA 1EF1A 2G35A 2W2XD 5KQ4A 1KZ7A 3TCAA 3V5WA 2QKMA 5C6RA 1WGQA 5KQ1A 4GZUA 1MIXA 3M1IB 2D9ZA 5J3YA 2D9YA 1DYNA 2D11A 4A5KA 1W1GA 4K2OA 2BCJA 1W1HA 2M14A 1NI2A 2N23A 3HW2B 1XR0B 2D9WA 2LYDA 2LG1A 1QQGA 1FAOA 1ZM0A 4MT7A 4F7GA 2DHKA 1Q67A 4HDQA 3SYXA 1WJ1A 4F7UP 5JHHA 2P0DA 3KSYA 4YL8A 4EJNA 4Z2NA 2UZRA 4IFSA 4YONA 2DYQA 2P8VA 4L6EA 1DDVA 3QIJA 1X11A 2COCA 3ODOA 3ODXA 2CAYA 1U5DA 1EVHA 2I1KA 3BJIA 2LKOA 5D3WA 2P0HA 2DN6A 2P0FA 1J0WA 3D8EA 2NMBA 2FJLA 2ELAA 5FI1A 3G9WA 2V76A 1WI1A 4ZRJA 4HAZB 1X86A 2ROVA 3GYPA 1UPQA 5DI9B 2LOZA 1XX0A 3X23A 3FM8C 2Y7BA 1OQNA 2KUPA 1FGYA 4GN1A 5LONB 1FGZA 4DX90 1BAKA 2GS0A 5HE1A 1BTKA 4HHVA 4EMOA 3VOQA 4TYZA 3GYOA 1Y5OA 5KCVA 3PG7A 4KVGB 4CHJA 2D9VA 4CYEA 4GPTB 1V5PA 1GC7A 5C5BA 3CXBB 3A98B 2EC1A 3DXDA 3O96A 1TXDA 3NSUA 4IOYX 2R09A 2COFA 1WJMA 2EMTA 2DKPA 1V88A 4KAXB 4KHBB 3F0WA 2DHJA 1X05A 2UZSA 1EAZA 2QKLA 5HE0A 1Y19B 4KHAA 2HTHB 1H10A 2IYBA 1GC6A 4TKNA 2Y8FA 4A6FA 3RCPA 1EGXA 3A8PA 2CRFA 2DA0A 1MPHA 5C16A 5FI0A 2CY4A 2X18A 5GOWB 5L81A 1RJ2A 1ZSQA 2J59M 3F5RA 5JLJB 3DXCA 3TW1A 2MWNB 2ADZA 1FHOA 2DHIA 4F7HA 1X1FA 4PNKA 2H7DA 1DROA 1ISNA 3WYFB 1K5DB 1AWEA 2ROZB 2DLWA 3ZDTA 1I2HA 2J0KA 3MDBC 1BTNA 4GXBA 2ELBA 2DFKA 2YT0A 5DHAB 5J3QA 2YS5A 3PP2A 1DDMA 4CHMA 2GCLA 1MIZB 1Z87A 2VRWB 2J0MA 2YVCA 1UEFA 2L2IA 3FSSA 2W2WA 5EFXA 2Z0OA 1H4RA 4A6KA 1UNRA 4HB3B 1V5UA 1WGUA 1KZGA 2Z0QA 2COAA 1V89A 2YRYA 2Q13A 2OQBA 2JP2A 5DH9B 4HAVB 1TJ6A 2KCJA 2LULA 2PZ1A 3QWMA 4H8SA 2RLOA 4NSWA 2D10A 3WA0A 3A8QA 3HQCA 2K2UA 4A6FB 2M38A 5CLLB 2DKQA 1P3RA 5LOPB 2IFSA 1U2BA 1FOEA 3U7DA 3ZVRA 3ODWA 1U5FA 1PMSA 1ZC4B 2K2JA 3P7ZA 4WVFB 4IAPA 5C79A 2XQNM 3D8DA 1M7EA 1J19A 3D8FA 3SNHA 4HAWB 4BBKA 1U29A 2DTCA 1UNPA 1NU2A 1SGHA 2LOXA 2Y8GA 4HDOA 2YT1A 2E2XA 3KRWA 4WSFA 3ML4A 1U5EA 4ZRKA 4ZRIA 2CODA 5D3XA 1MK9B 1NTVA
chains in the Genus database with same CATH superfamily
4HB0B 1U27A 3TO1A 3AU5A 2DYNA 2L1CA 2D2QA 3AJ4A 2GJYA 3U8ZA 1WG7A 5D27A 5DIFB 4DX8A 2EJ8A 4QJ5B 4QJ4B 2VKIA 2YF0A 2YT2A 1ZC3B 2AL6A 1X1GA 1W1DA 1OMWA 5D3YA 5JHGA 2AEHA 4B6HA 2Z14A 1BWNA 4NY0A 3QBVB 5JP4A 1LB1A 3CIKA 1XD4A 2RGNB 1N3HA 1SHCA 5DHFB 2W2XC 3KZ1A 4D0NB 5HE2A 4HAYB 2EMSA 2HE7A 4EKUA 1FB8A 4P7IA 4GMXB 5J3TA 1RRPB 4HAXB 2K8EA 2NZ8B 1XODA 2DX1A 4Y94A 3TVVA 3N7CA 4MK0A 3PVUA 3KY9A 2YS1A 1AQCA 1MI1A 5C5BB 1UPRA 2YS3A 4HATB 1MK7B 1U5GA 2K49A 3BINA 4DXAB 4A6HA 4C0AA 3VIAA 1DBHA 2UVMA 2RNRB 1NTYA 4MY6A 3DXEA 2Z0PA 3UZTA 2K00A 2I5CA 2MDXA 1PFJA 4PQ0A 1MKEA 2R2YA 3TFMA 3AU4A 2RUKB 2GCJA 3HK0A 1XCGA 2YSZA 4K17A 1MAIA 3MPXA 1K5GB 2I1JA 2ZPYA 3PVWA 3PVLA 3DCXA 2VSZA 1FHXA 4HB4B 4DBBA 4XWXA 4Z2MB 1V5MA 1FHWA 1OY2A 4HAUB 5I2SA 2RSGA 3FEHA 1IRSA 1DDWA 1QC6A 2ZKMX 4K81A 1B55A 1GG3A 3OHMB 4GMVA 1P5TA 3SV1A 3OANA 2N0YA 3SUZA 1PLSA 3ULBA 1LW3A 2H7EA 2MKRA 2R0DA 1I7AA 1TQZA 1M7RA 3PEGA 2I5FA 4K2PA 2KGXB 1WVHA 5I2MA 4OSNA 2D4QA 1T77A 2OTXA 5D3VA 3IVFA 5CLQB 3PZDA 1ZVRA 1UNQA 3NWAA 2MFQA 3KRXA 1V61A 4KHOA 5HE3A 2RVBB 1KI1B 4WJ7A 2D9XA 3PSCA 4HB2B 2Z59A 1XKEA 3LJUX 4GOUA 3T06A 1P6SA 2CY5A 2DX5A 3SO6A 3P6AA 1E5WA 2J0JA 3ULCA 1EF1A 2G35A 2W2XD 5KQ4A 1KZ7A 3TCAA 3V5WA 4DIXA 2QKMA 5C6RA 1WGQA 5KQ1A 4GZUA 2GUMA 1MIXA 3M1IB 3A58A 2D9ZA 5J3YA 2D9YA 1DYNA 2D11A 4A5KA 1W1GA 4K2OA 2KR0A 2BCJA 1W1HA 2M14A 1NI2A 2N23A 3HW2B 1XR0B 2D9WA 2LYDA 2LG1A 1QQGA 1FAOA 1ZM0A 4MT7A 4F7GA 5IRSA 2DHKA 3U12A 4KHBA 1Q67A 4HDQA 3SYXA 2KUQA 1WJ1A 4F7UP 5JHHA 2P0DA 3KSYA 4YL8A 4EJNA 4Z2NA 2UZRA 3NW8A 4IFSA 4YONA 2DYQA 2P8VA 4L6EA 1DDVA 3QIJA 4D6WA 1X11A 2COCA 3ODOA 3ODXA 2CAYA 1U5DA 1EVHA 2I1KA 3BJIA 2LKOA 5D3WA 2P0HA 2DN6A 2P0FA 1J0WA 3D8EA 2NMBA 2FJLA 2ELAA 5FI1A 2KIGA 3G9WA 2V76A 1WI1A 4ZRJA 4HAZB 1X86A 2ROVA 3GYPA 1UPQA 2Z13A 5DI9B 2LOZA 2NBVA 1XX0A 3X23A 3FM8C 2Y7BA 1OQNA 2KUPA 4L1RA 1FGYA 4GN1A 5LONB 1FGZA 4DX90 1BAKA 2GS0A 4QXAB 5HE1A 1BTKA 4HHVA 4EMOA 3VOQA 4TYZA 3GYOA 1Y5OA 5KCVA 3PG7A 4KVGB 4CHJA 2D9VA 4CYEA 2RRFA 4GPTB 1V5PA 1GC7A 5C5BA 3CXBB 3A98B 2EC1A 3DXDA 3O96A 1TXDA 3NSUA 4IOYX 2R09A 3FVCA 2COFA 1WJMA 2EMTA 2DKPA 1V88A 4KAXB 4KHBB 3F0WA 2DHJA 4CSQA 1X05A 2UZSA 1EAZA 4QJ3B 2QKLA 5HE0A 1Y19B 4KHAA 2HTHB 1H10A 2IYBA 1GC6A 4TKNA 2Y8FA 4A6FA 4OT1A 3RCPA 1EGXA 3A8PA 2CRFA 2DA0A 1MPHA 2FJUB 5C16A 5FI0A 2CY4A 2X18A 5GOWB 5L81A 1RJ2A 3NWFA 1ZSQA 2J59M 3F5RA 5JLJB 3DXCA 3TW1A 4HSIA 2MWNB 2ADZA 1FHOA 1ZYIA 2DHIA 4F7HA 1X1FA 4PNKA 2H7DA 1DROA 1ISNA 3WYFB 1K5DB 1AWEA 4GNKB 2ROZB 2DLWA 3ZDTA 1I2HA 2J0KA 3MDBC 1BTNA 4GXBA 2ELBA 2DFKA 2YT0A 3HIEA 5DHAB 5J3QA 2YS5A 3PP2A 1DDMA 3NWDA 4CHMA 2GCLA 1MIZB 1Z87A 2VRWB 2J0MA 2YVCA 1UEFA 2L2IA 3FSSA 2W2WA 5EFXA 2Z0OA 1H4RA 4A6KA 1UNRA 4HB3B 1V5UA 1WGUA 1KZGA 2Z0QA 2COAA 3HSAA 1V89A 2YRYA 2Q13A 2OQBA 2JP2A 5DH9B 4HAVB 1TJ6A 2KCJA 2LULA 2PZ1A 3QWMA 4H8SA 2RLOA 4NSWA 2D10A 3WA0A 3A8QA 3HQCA 2K2UA 4A6FB 2M38A 5LG4B 2KIEA 5CLLB 2DKQA 1P3RA 5LOPB 2IFSA 1U2BA 1FOEA 3U7DA 3ZVRA 3ODWA 1U5FA 1PMSA 1ZC4B 2K2JA 3P7ZA 4WVFB 4IAPA 5C79A 2XQNM 3D8DA 1M7EA 1J19A 3D8FA 3SNHA 4HAWB 4BBKA 1U29A 2DTCA 1UNPA 1NU2A 1SGHA 2LOXA 2Y8GA 4HDOA 3B77A 2YT1A 2E2XA 3KRWA 4WSFA 3ML4A 1U5EA 4ZRKA 4ZRIA 5M4YB 2CODA 5D3XA 1MK9B 1NTVA 2Z4DA
chains in the Genus database with same CATH topology
4HB0B 1U27A 3TO1A 3AU5A 2DYNA 2L1CA 2D2QA 3AJ4A 2GJYA 3U8ZA 1WG7A 5D27A 5DIFB 4DX8A 2EJ8A 2VKIA 2YF0A 1ZC3B 2AL6A 1X1GA 1W1DA 1OMWA 5D3YA 5JHGA 2AEHA 4B6HA 1BWNA 4NY0A 3QBVB 5JP4A 1LB1A 3CIKA 1XD4A 2RGNB 1N3HA 1SHCA 5DHFB 2W2XC 3KZ1A 4D0NB 5HE2A 4HAYB 2EMSA 2HE7A 4EKUA 1FB8A 4P7IA 4GMXB 5J3TA 1RRPB 4HAXB 2NZ8B 1XODA 2DX1A 4Y94A 3TVVA 3N7CA 4MK0A 3PVUA 3KY9A 2YS1A 1AQCA 5C5BB 1UPRA 2YS3A 4HATB 1MK7B 1U5GA 3BINA 4DXAB 4A6HA 4C0AA 3VIAA 1DBHA 2UVMA 2RNRB 1NTYA 4MY6A 3DXEA 2Z0PA 3UZTA 2K00A 2I5CA 2MDXA 1PFJA 4PQ0A 1MKEA 3TFMA 3AU4A 2RUKB 2GCJA 3HK0A 1XCGA 2YSZA 4K17A 1MAIA 3MPXA 1K5GB 2I1JA 2ZPYA 3PVWA 3PVLA 2VSZA 1FHXA 4HB4B 4DBBA 4XWXA 4Z2MB 1V5MA 1FHWA 1OY2A 4HAUB 2RSGA 3FEHA 1IRSA 1DDWA 1QC6A 4K81A 1B55A 1GG3A 4GMVA 1P5TA 3SV1A 3OANA 2N0YA 3SUZA 1PLSA 3ULBA 1LW3A 2H7EA 2MKRA 2R0DA 1I7AA 1TQZA 1M7RA 3PEGA 2I5FA 4K2PA 2KGXB 1WVHA 2D4QA 2OTXA 5D3VA 3IVFA 5CLQB 3PZDA 1ZVRA 1UNQA 2MFQA 3KRXA 1V61A 4KHOA 5HE3A 2RVBB 1KI1B 4WJ7A 2D9XA 3PSCA 4HB2B 1XKEA 3LJUX 3T06A 1P6SA 2CY5A 2DX5A 3SO6A 3P6AA 1E5WA 2J0JA 3ULCA 1EF1A 2G35A 2W2XD 5KQ4A 1KZ7A 3TCAA 3V5WA 2QKMA 5C6RA 1WGQA 5KQ1A 4GZUA 1MIXA 3M1IB 2D9ZA 5J3YA 2D9YA 1DYNA 2D11A 4A5KA 1W1GA 4K2OA 2BCJA 1W1HA 2M14A 1NI2A 2N23A 3HW2B 1XR0B 2D9WA 2LYDA 2LG1A 1QQGA 1FAOA 1ZM0A 4MT7A 4F7GA 2DHKA 1Q67A 4HDQA 3SYXA 1WJ1A 4F7UP 5JHHA 2P0DA 3KSYA 4YL8A 4EJNA 4Z2NA 2UZRA 4IFSA 4YONA 2DYQA 2P8VA 4L6EA 1DDVA 3QIJA 1X11A 2COCA 3ODOA 3ODXA 2CAYA 1U5DA 1EVHA 2I1KA 3BJIA 2LKOA 5D3WA 2P0HA 2DN6A 2P0FA 1J0WA 3D8EA 2NMBA 2FJLA 2ELAA 5FI1A 3G9WA 2V76A 1WI1A 4ZRJA 4HAZB 1X86A 2ROVA 3GYPA 1UPQA 5DI9B 2LOZA 1XX0A 3X23A 3FM8C 2Y7BA 1OQNA 2KUPA 1FGYA 4GN1A 5LONB 1FGZA 4DX90 1BAKA 2GS0A 5HE1A 1BTKA 4HHVA 4EMOA 3VOQA 4TYZA 3GYOA 1Y5OA 5KCVA 3PG7A 4KVGB 4CHJA 2D9VA 4CYEA 4GPTB 1V5PA 1GC7A 5C5BA 3CXBB 3A98B 2EC1A 3DXDA 3O96A 1TXDA 3NSUA 4IOYX 2R09A 2COFA 1WJMA 2EMTA 2DKPA 1V88A 4KAXB 4KHBB 3F0WA 2DHJA 1X05A 2UZSA 1EAZA 2QKLA 5HE0A 1Y19B 4KHAA 2HTHB 1H10A 2IYBA 1GC6A 4TKNA 2Y8FA 4A6FA 3RCPA 1EGXA 3A8PA 2CRFA 2DA0A 1MPHA 5C16A 5FI0A 2CY4A 2X18A 5GOWB 5L81A 1RJ2A 1ZSQA 2J59M 3F5RA 5JLJB 3DXCA 3TW1A 2MWNB 2ADZA 1FHOA 2DHIA 4F7HA 1X1FA 4PNKA 2H7DA 1DROA 1ISNA 3WYFB 1K5DB 1AWEA 2ROZB 2DLWA 3ZDTA 1I2HA 2J0KA 3MDBC 1BTNA 4GXBA 2ELBA 2DFKA 2YT0A 5DHAB 5J3QA 2YS5A 3PP2A 1DDMA 4CHMA 2GCLA 1MIZB 1Z87A 2VRWB 2J0MA 2YVCA 1UEFA 2L2IA 3FSSA 2W2WA 5EFXA 2Z0OA 1H4RA 4A6KA 1UNRA 4HB3B 1V5UA 1WGUA 1KZGA 2Z0QA 2COAA 1V89A 2YRYA 2Q13A 2OQBA 2JP2A 5DH9B 4HAVB 1TJ6A 2KCJA 2LULA 2PZ1A 3QWMA 4H8SA 2RLOA 4NSWA 2D10A 3WA0A 3A8QA 3HQCA 2K2UA 4A6FB 2M38A 5CLLB 2DKQA 1P3RA 5LOPB 2IFSA 1U2BA 1FOEA 3U7DA 3ZVRA 3ODWA 1U5FA 1PMSA 1ZC4B 2K2JA 3P7ZA 4WVFB 4IAPA 5C79A 2XQNM 3D8DA 1M7EA 1J19A 3D8FA 3SNHA 4HAWB 4BBKA 1U29A 2DTCA 1UNPA 1NU2A 1SGHA 2LOXA 2Y8GA 4HDOA 2YT1A 2E2XA 3KRWA 4WSFA 3ML4A 1U5EA 4ZRKA 4ZRIA 2CODA 5D3XA 1MK9B 1NTVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HB0 B;  1U27 A;  3TO1 A;  3AU5 A;  2DYN A;  2L1C A;  2D2Q A;  3AJ4 A;  2GJY A;  3U8Z A;  1WG7 A;  5D27 A;  5DIF B;  4DX8 A;  2EJ8 A;  2VKI A;  2YF0 A;  1ZC3 B;  2AL6 A;  1X1G A;  1W1D A;  1OMW A;  5D3Y A;  5JHG A;  2AEH A;  4B6H A;  1BWN A;  4NY0 A;  3QBV B;  5JP4 A;  1LB1 A;  3CIK A;  1XD4 A;  2RGN B;  1N3H A;  1SHC A;  5DHF B;  2W2X C;  3KZ1 A;  4D0N B;  5HE2 A;  4HAY B;  2EMS A;  2HE7 A;  4EKU A;  1FB8 A;  4P7I A;  4GMX B;  5J3T A;  1RRP B;  4HAX B;  2NZ8 B;  1XOD A;  2DX1 A;  4Y94 A;  3TVV A;  3N7C A;  4MK0 A;  3PVU A;  3KY9 A;  2YS1 A;  1AQC A;  5C5B B;  1UPR A;  2YS3 A;  4HAT B;  1MK7 B;  1U5G A;  3BIN A;  4DXA B;  4A6H A;  4C0A A;  3VIA A;  1DBH A;  2UVM A;  2RNR B;  1NTY A;  4MY6 A;  3DXE A;  2Z0P A;  3UZT A;  2K00 A;  2I5C A;  2MDX A;  1PFJ A;  4PQ0 A;  1MKE A;  3TFM A;  3AU4 A;  2RUK B;  2GCJ A;  3HK0 A;  1XCG A;  2YSZ A;  4K17 A;  1MAI A;  3MPX A;  1K5G B;  2I1J A;  2ZPY A;  3PVW A;  3PVL A;  2VSZ A;  1FHX A;  4HB4 B;  4DBB A;  4XWX A;  4Z2M B;  1V5M A;  1FHW A;  1OY2 A;  4HAU B;  2RSG A;  3FEH A;  1IRS A;  1DDW A;  1QC6 A;  4K81 A;  1B55 A;  1GG3 A;  4GMV A;  1P5T A;  3SV1 A;  3OAN A;  2N0Y A;  3SUZ A;  1PLS A;  3ULB A;  1LW3 A;  2H7E A;  2MKR A;  2R0D A;  1I7A A;  1TQZ A;  1M7R A;  3PEG A;  2I5F A;  4K2P A;  2KGX B;  1WVH A;  2D4Q A;  2OTX A;  5D3V A;  3IVF A;  5CLQ B;  3PZD A;  1ZVR A;  1UNQ A;  2MFQ A;  3KRX A;  1V61 A;  4KHO A;  5HE3 A;  2RVB B;  1KI1 B;  4WJ7 A;  2D9X A;  3PSC A;  4HB2 B;  1XKE A;  3LJU X;  3T06 A;  1P6S A;  2CY5 A;  2DX5 A;  3SO6 A;  3P6A A;  1E5W A;  2J0J A;  3ULC A;  1EF1 A;  2G35 A;  2W2X D;  5KQ4 A;  1KZ7 A;  3TCA A;  3V5W A;  2QKM A;  5C6R A;  1WGQ A;  5KQ1 A;  4GZU A;  1MIX A;  3M1I B;  2D9Z A;  5J3Y A;  2D9Y A;  1DYN A;  2D11 A;  4A5K A;  1W1G A;  4K2O A;  2BCJ A;  1W1H A;  2M14 A;  1NI2 A;  2N23 A;  3HW2 B;  1XR0 B;  2D9W A;  2LYD A;  2LG1 A;  1QQG A;  1FAO A;  1ZM0 A;  4MT7 A;  4F7G A;  2DHK A;  1Q67 A;  4HDQ A;  3SYX A;  1WJ1 A;  4F7U P;  5JHH A;  2P0D A;  3KSY A;  4YL8 A;  4EJN A;  4Z2N A;  2UZR A;  4IFS A;  4YON A;  2DYQ A;  2P8V A;  4L6E A;  1DDV A;  3QIJ A;  1X11 A;  2COC A;  3ODO A;  3ODX A;  2CAY A;  1U5D A;  1EVH A;  2I1K A;  3BJI A;  2LKO A;  5D3W A;  2P0H A;  2DN6 A;  2P0F A;  1J0W A;  3D8E A;  2NMB A;  2FJL A;  2ELA A;  5FI1 A;  3G9W A;  2V76 A;  1WI1 A;  4ZRJ A;  4HAZ B;  1X86 A;  2ROV A;  3GYP A;  1UPQ A;  5DI9 B;  2LOZ A;  1XX0 A;  3X23 A;  3FM8 C;  2Y7B A;  1OQN A;  2KUP A;  1FGY A;  4GN1 A;  5LON B;  1FGZ A;  4DX9 0;  1BAK A;  2GS0 A;  5HE1 A;  1BTK A;  4HHV A;  4EMO A;  3VOQ A;  4TYZ A;  3GYO A;  1Y5O A;  5KCV A;  3PG7 A;  4KVG B;  4CHJ A;  2D9V A;  4CYE A;  4GPT B;  1V5P A;  1GC7 A;  5C5B A;  3CXB B;  3A98 B;  2EC1 A;  3DXD A;  3O96 A;  1TXD A;  3NSU A;  4IOY X;  2R09 A;  2COF A;  1WJM A;  2EMT A;  2DKP A;  1V88 A;  4KAX B;  4KHB B;  3F0W A;  2DHJ A;  1X05 A;  2UZS A;  1EAZ A;  2QKL A;  5HE0 A;  1Y19 B;  4KHA A;  2HTH B;  1H10 A;  2IYB A;  1GC6 A;  4TKN A;  2Y8F A;  4A6F A;  3RCP A;  1EGX A;  3A8P A;  2CRF A;  2DA0 A;  1MPH A;  5C16 A;  5FI0 A;  2CY4 A;  2X18 A;  5GOW B;  5L81 A;  1RJ2 A;  1ZSQ A;  2J59 M;  3F5R A;  5JLJ B;  3DXC A;  3TW1 A;  2MWN B;  2ADZ A;  1FHO A;  2DHI A;  4F7H A;  1X1F A;  4PNK A;  2H7D A;  1DRO A;  1ISN A;  3WYF B;  1K5D B;  1AWE A;  2ROZ B;  2DLW A;  3ZDT A;  1I2H A;  2J0K A;  3MDB C;  1BTN A;  4GXB A;  2ELB A;  2DFK A;  2YT0 A;  5DHA B;  5J3Q A;  2YS5 A;  3PP2 A;  1DDM A;  4CHM A;  2GCL A;  1MIZ B;  1Z87 A;  2VRW B;  2J0M A;  2YVC A;  1UEF A;  2L2I A;  3FSS A;  2W2W A;  5EFX A;  2Z0O A;  1H4R A;  4A6K A;  1UNR A;  4HB3 B;  1V5U A;  1WGU A;  1KZG A;  2Z0Q A;  2COA A;  1V89 A;  2YRY A;  2Q13 A;  2OQB A;  2JP2 A;  5DH9 B;  4HAV B;  1TJ6 A;  2KCJ A;  2LUL A;  2PZ1 A;  3QWM A;  4H8S A;  2RLO A;  4NSW A;  2D10 A;  3WA0 A;  3A8Q A;  3HQC A;  2K2U A;  4A6F B;  2M38 A;  5CLL B;  2DKQ A;  1P3R A;  5LOP B;  2IFS A;  1U2B A;  1FOE A;  3U7D A;  3ZVR A;  3ODW A;  1U5F A;  1PMS A;  1ZC4 B;  2K2J A;  3P7Z A;  4WVF B;  4IAP A;  5C79 A;  2XQN M;  3D8D A;  1M7E A;  1J19 A;  3D8F A;  3SNH A;  4HAW B;  4BBK A;  1U29 A;  2DTC A;  1UNP A;  1NU2 A;  1SGH A;  2LOX A;  2Y8G A;  4HDO A;  2YT1 A;  2E2X A;  3KRW A;  4WSF A;  3ML4 A;  1U5E A;  4ZRK A;  4ZRI A;  2COD A;  5D3X A;  1MK9 B;  1NTV A; 
#chains in the Genus database with same CATH topology
 4HB0 B;  1U27 A;  3TO1 A;  3AU5 A;  2DYN A;  2L1C A;  2D2Q A;  3AJ4 A;  2GJY A;  3U8Z A;  1WG7 A;  5D27 A;  5DIF B;  4DX8 A;  2EJ8 A;  4QJ5 B;  4QJ4 B;  2VKI A;  2YF0 A;  2YT2 A;  1ZC3 B;  2AL6 A;  1X1G A;  1W1D A;  1OMW A;  5D3Y A;  5JHG A;  2AEH A;  4B6H A;  2Z14 A;  1BWN A;  4NY0 A;  3QBV B;  5JP4 A;  1LB1 A;  3CIK A;  1XD4 A;  2RGN B;  1N3H A;  1SHC A;  5DHF B;  2W2X C;  3KZ1 A;  4D0N B;  5HE2 A;  4HAY B;  2EMS A;  2HE7 A;  4EKU A;  1FB8 A;  4P7I A;  4GMX B;  5J3T A;  1RRP B;  4HAX B;  2K8E A;  2NZ8 B;  1XOD A;  2DX1 A;  4Y94 A;  3TVV A;  3N7C A;  4MK0 A;  3PVU A;  3KY9 A;  2YS1 A;  1AQC A;  1MI1 A;  5C5B B;  1UPR A;  2YS3 A;  4HAT B;  1MK7 B;  1U5G A;  2K49 A;  3BIN A;  4DXA B;  4A6H A;  4C0A A;  3VIA A;  1DBH A;  2UVM A;  2RNR B;  1NTY A;  4MY6 A;  3DXE A;  2Z0P A;  3UZT A;  2K00 A;  2I5C A;  2MDX A;  1PFJ A;  4PQ0 A;  1MKE A;  2R2Y A;  3TFM A;  3AU4 A;  2RUK B;  2GCJ A;  3HK0 A;  1XCG A;  2YSZ A;  4K17 A;  1MAI A;  3MPX A;  1K5G B;  2I1J A;  2ZPY A;  3PVW A;  3PVL A;  3DCX A;  2VSZ A;  1FHX A;  4HB4 B;  4DBB A;  4XWX A;  4Z2M B;  1V5M A;  1FHW A;  1OY2 A;  4HAU B;  5I2S A;  2RSG A;  3FEH A;  1IRS A;  1DDW A;  1QC6 A;  2ZKM X;  4K81 A;  1B55 A;  1GG3 A;  3OHM B;  4GMV A;  1P5T A;  3SV1 A;  3OAN A;  2N0Y A;  3SUZ A;  1PLS A;  3ULB A;  1LW3 A;  2H7E A;  2MKR A;  2R0D A;  1I7A A;  1TQZ A;  1M7R A;  3PEG A;  2I5F A;  4K2P A;  2KGX B;  1WVH A;  5I2M A;  4OSN A;  2D4Q A;  1T77 A;  2OTX A;  5D3V A;  3IVF A;  5CLQ B;  3PZD A;  1ZVR A;  1UNQ A;  3NWA A;  2MFQ A;  3KRX A;  1V61 A;  4KHO A;  5HE3 A;  2RVB B;  1KI1 B;  4WJ7 A;  2D9X A;  3PSC A;  4HB2 B;  2Z59 A;  1XKE A;  3LJU X;  4GOU A;  3T06 A;  1P6S A;  2CY5 A;  2DX5 A;  3SO6 A;  3P6A A;  1E5W A;  2J0J A;  3ULC A;  1EF1 A;  2G35 A;  2W2X D;  5KQ4 A;  1KZ7 A;  3TCA A;  3V5W A;  4DIX A;  2QKM A;  5C6R A;  1WGQ A;  5KQ1 A;  4GZU A;  2GUM A;  1MIX A;  3M1I B;  3A58 A;  2D9Z A;  5J3Y A;  2D9Y A;  1DYN A;  2D11 A;  4A5K A;  1W1G A;  4K2O A;  2KR0 A;  2BCJ A;  1W1H A;  2M14 A;  1NI2 A;  2N23 A;  3HW2 B;  1XR0 B;  2D9W A;  2LYD A;  2LG1 A;  1QQG A;  1FAO A;  1ZM0 A;  4MT7 A;  4F7G A;  5IRS A;  2DHK A;  3U12 A;  4KHB A;  1Q67 A;  4HDQ A;  3SYX A;  2KUQ A;  1WJ1 A;  4F7U P;  5JHH A;  2P0D A;  3KSY A;  4YL8 A;  4EJN A;  4Z2N A;  2UZR A;  3NW8 A;  4IFS A;  4YON A;  2DYQ A;  2P8V A;  4L6E A;  1DDV A;  3QIJ A;  4D6W A;  1X11 A;  2COC A;  3ODO A;  3ODX A;  2CAY A;  1U5D A;  1EVH A;  2I1K A;  3BJI A;  2LKO A;  5D3W A;  2P0H A;  2DN6 A;  2P0F A;  1J0W A;  3D8E A;  2NMB A;  2FJL A;  2ELA A;  5FI1 A;  2KIG A;  3G9W A;  2V76 A;  1WI1 A;  4ZRJ A;  4HAZ B;  1X86 A;  2ROV A;  3GYP A;  1UPQ A;  2Z13 A;  5DI9 B;  2LOZ A;  2NBV A;  1XX0 A;  3X23 A;  3FM8 C;  2Y7B A;  1OQN A;  2KUP A;  4L1R A;  1FGY A;  4GN1 A;  5LON B;  1FGZ A;  4DX9 0;  1BAK A;  2GS0 A;  4QXA B;  5HE1 A;  1BTK A;  4HHV A;  4EMO A;  3VOQ A;  4TYZ A;  3GYO A;  1Y5O A;  5KCV A;  3PG7 A;  4KVG B;  4CHJ A;  2D9V A;  4CYE A;  2RRF A;  4GPT B;  1V5P A;  1GC7 A;  5C5B A;  3CXB B;  3A98 B;  2EC1 A;  3DXD A;  3O96 A;  1TXD A;  3NSU A;  4IOY X;  2R09 A;  3FVC A;  2COF A;  1WJM A;  2EMT A;  2DKP A;  1V88 A;  4KAX B;  4KHB B;  3F0W A;  2DHJ A;  4CSQ A;  1X05 A;  2UZS A;  1EAZ A;  4QJ3 B;  2QKL A;  5HE0 A;  1Y19 B;  4KHA A;  2HTH B;  1H10 A;  2IYB A;  1GC6 A;  4TKN A;  2Y8F A;  4A6F A;  4OT1 A;  3RCP A;  1EGX A;  3A8P A;  2CRF A;  2DA0 A;  1MPH A;  2FJU B;  5C16 A;  5FI0 A;  2CY4 A;  2X18 A;  5GOW B;  5L81 A;  1RJ2 A;  3NWF A;  1ZSQ A;  2J59 M;  3F5R A;  5JLJ B;  3DXC A;  3TW1 A;  4HSI A;  2MWN B;  2ADZ A;  1FHO A;  1ZYI A;  2DHI A;  4F7H A;  1X1F A;  4PNK A;  2H7D A;  1DRO A;  1ISN A;  3WYF B;  1K5D B;  1AWE A;  4GNK B;  2ROZ B;  2DLW A;  3ZDT A;  1I2H A;  2J0K A;  3MDB C;  1BTN A;  4GXB A;  2ELB A;  2DFK A;  2YT0 A;  3HIE A;  5DHA B;  5J3Q A;  2YS5 A;  3PP2 A;  1DDM A;  3NWD A;  4CHM A;  2GCL A;  1MIZ B;  1Z87 A;  2VRW B;  2J0M A;  2YVC A;  1UEF A;  2L2I A;  3FSS A;  2W2W A;  5EFX A;  2Z0O A;  1H4R A;  4A6K A;  1UNR A;  4HB3 B;  1V5U A;  1WGU A;  1KZG A;  2Z0Q A;  2COA A;  3HSA A;  1V89 A;  2YRY A;  2Q13 A;  2OQB A;  2JP2 A;  5DH9 B;  4HAV B;  1TJ6 A;  2KCJ A;  2LUL A;  2PZ1 A;  3QWM A;  4H8S A;  2RLO A;  4NSW A;  2D10 A;  3WA0 A;  3A8Q A;  3HQC A;  2K2U A;  4A6F B;  2M38 A;  5LG4 B;  2KIE A;  5CLL B;  2DKQ A;  1P3R A;  5LOP B;  2IFS A;  1U2B A;  1FOE A;  3U7D A;  3ZVR A;  3ODW A;  1U5F A;  1PMS A;  1ZC4 B;  2K2J A;  3P7Z A;  4WVF B;  4IAP A;  5C79 A;  2XQN M;  3D8D A;  1M7E A;  1J19 A;  3D8F A;  3SNH A;  4HAW B;  4BBK A;  1U29 A;  2DTC A;  1UNP A;  1NU2 A;  1SGH A;  2LOX A;  2Y8G A;  4HDO A;  3B77 A;  2YT1 A;  2E2X A;  3KRW A;  4WSF A;  3ML4 A;  1U5E A;  4ZRK A;  4ZRI A;  5M4Y B;  2COD A;  5D3X A;  1MK9 B;  1NTV A;  2Z4D A; 
#chains in the Genus database with same CATH homology
 4HB0 B;  1U27 A;  3TO1 A;  3AU5 A;  2DYN A;  2L1C A;  2D2Q A;  3AJ4 A;  2GJY A;  3U8Z A;  1WG7 A;  5D27 A;  5DIF B;  4DX8 A;  2EJ8 A;  2VKI A;  2YF0 A;  1ZC3 B;  2AL6 A;  1X1G A;  1W1D A;  1OMW A;  5D3Y A;  5JHG A;  2AEH A;  4B6H A;  1BWN A;  4NY0 A;  3QBV B;  5JP4 A;  1LB1 A;  3CIK A;  1XD4 A;  2RGN B;  1N3H A;  1SHC A;  5DHF B;  2W2X C;  3KZ1 A;  4D0N B;  5HE2 A;  4HAY B;  2EMS A;  2HE7 A;  4EKU A;  1FB8 A;  4P7I A;  4GMX B;  5J3T A;  1RRP B;  4HAX B;  2NZ8 B;  1XOD A;  2DX1 A;  4Y94 A;  3TVV A;  3N7C A;  4MK0 A;  3PVU A;  3KY9 A;  2YS1 A;  1AQC A;  5C5B B;  1UPR A;  2YS3 A;  4HAT B;  1MK7 B;  1U5G A;  3BIN A;  4DXA B;  4A6H A;  4C0A A;  3VIA A;  1DBH A;  2UVM A;  2RNR B;  1NTY A;  4MY6 A;  3DXE A;  2Z0P A;  3UZT A;  2K00 A;  2I5C A;  2MDX A;  1PFJ A;  4PQ0 A;  1MKE A;  3TFM A;  3AU4 A;  2RUK B;  2GCJ A;  3HK0 A;  1XCG A;  2YSZ A;  4K17 A;  1MAI A;  3MPX A;  1K5G B;  2I1J A;  2ZPY A;  3PVW A;  3PVL A;  2VSZ A;  1FHX A;  4HB4 B;  4DBB A;  4XWX A;  4Z2M B;  1V5M A;  1FHW A;  1OY2 A;  4HAU B;  2RSG A;  3FEH A;  1IRS A;  1DDW A;  1QC6 A;  4K81 A;  1B55 A;  1GG3 A;  4GMV A;  1P5T A;  3SV1 A;  3OAN A;  2N0Y A;  3SUZ A;  1PLS A;  3ULB A;  1LW3 A;  2H7E A;  2MKR A;  2R0D A;  1I7A A;  1TQZ A;  1M7R A;  3PEG A;  2I5F A;  4K2P A;  2KGX B;  1WVH A;  2D4Q A;  2OTX A;  5D3V A;  3IVF A;  5CLQ B;  3PZD A;  1ZVR A;  1UNQ A;  2MFQ A;  3KRX A;  1V61 A;  4KHO A;  5HE3 A;  2RVB B;  1KI1 B;  4WJ7 A;  2D9X A;  3PSC A;  4HB2 B;  1XKE A;  3LJU X;  3T06 A;  1P6S A;  2CY5 A;  2DX5 A;  3SO6 A;  3P6A A;  1E5W A;  2J0J A;  3ULC A;  1EF1 A;  2G35 A;  2W2X D;  5KQ4 A;  1KZ7 A;  3TCA A;  3V5W A;  2QKM A;  5C6R A;  1WGQ A;  5KQ1 A;  4GZU A;  1MIX A;  3M1I B;  2D9Z A;  5J3Y A;  2D9Y A;  1DYN A;  2D11 A;  4A5K A;  1W1G A;  4K2O A;  2BCJ A;  1W1H A;  2M14 A;  1NI2 A;  2N23 A;  3HW2 B;  1XR0 B;  2D9W A;  2LYD A;  2LG1 A;  1QQG A;  1FAO A;  1ZM0 A;  4MT7 A;  4F7G A;  2DHK A;  1Q67 A;  4HDQ A;  3SYX A;  1WJ1 A;  4F7U P;  5JHH A;  2P0D A;  3KSY A;  4YL8 A;  4EJN A;  4Z2N A;  2UZR A;  4IFS A;  4YON A;  2DYQ A;  2P8V A;  4L6E A;  1DDV A;  3QIJ A;  1X11 A;  2COC A;  3ODO A;  3ODX A;  2CAY A;  1U5D A;  1EVH A;  2I1K A;  3BJI A;  2LKO A;  5D3W A;  2P0H A;  2DN6 A;  2P0F A;  1J0W A;  3D8E A;  2NMB A;  2FJL A;  2ELA A;  5FI1 A;  3G9W A;  2V76 A;  1WI1 A;  4ZRJ A;  4HAZ B;  1X86 A;  2ROV A;  3GYP A;  1UPQ A;  5DI9 B;  2LOZ A;  1XX0 A;  3X23 A;  3FM8 C;  2Y7B A;  1OQN A;  2KUP A;  1FGY A;  4GN1 A;  5LON B;  1FGZ A;  4DX9 0;  1BAK A;  2GS0 A;  5HE1 A;  1BTK A;  4HHV A;  4EMO A;  3VOQ A;  4TYZ A;  3GYO A;  1Y5O A;  5KCV A;  3PG7 A;  4KVG B;  4CHJ A;  2D9V A;  4CYE A;  4GPT B;  1V5P A;  1GC7 A;  5C5B A;  3CXB B;  3A98 B;  2EC1 A;  3DXD A;  3O96 A;  1TXD A;  3NSU A;  4IOY X;  2R09 A;  2COF A;  1WJM A;  2EMT A;  2DKP A;  1V88 A;  4KAX B;  4KHB B;  3F0W A;  2DHJ A;  1X05 A;  2UZS A;  1EAZ A;  2QKL A;  5HE0 A;  1Y19 B;  4KHA A;  2HTH B;  1H10 A;  2IYB A;  1GC6 A;  4TKN A;  2Y8F A;  4A6F A;  3RCP A;  1EGX A;  3A8P A;  2CRF A;  2DA0 A;  1MPH A;  5C16 A;  5FI0 A;  2CY4 A;  2X18 A;  5GOW B;  5L81 A;  1RJ2 A;  1ZSQ A;  2J59 M;  3F5R A;  5JLJ B;  3DXC A;  3TW1 A;  2MWN B;  2ADZ A;  1FHO A;  2DHI A;  4F7H A;  1X1F A;  4PNK A;  2H7D A;  1DRO A;  1ISN A;  3WYF B;  1K5D B;  1AWE A;  2ROZ B;  2DLW A;  3ZDT A;  1I2H A;  2J0K A;  3MDB C;  1BTN A;  4GXB A;  2ELB A;  2DFK A;  2YT0 A;  5DHA B;  5J3Q A;  2YS5 A;  3PP2 A;  1DDM A;  4CHM A;  2GCL A;  1MIZ B;  1Z87 A;  2VRW B;  2J0M A;  2YVC A;  1UEF A;  2L2I A;  3FSS A;  2W2W A;  5EFX A;  2Z0O A;  1H4R A;  4A6K A;  1UNR A;  4HB3 B;  1V5U A;  1WGU A;  1KZG A;  2Z0Q A;  2COA A;  1V89 A;  2YRY A;  2Q13 A;  2OQB A;  2JP2 A;  5DH9 B;  4HAV B;  1TJ6 A;  2KCJ A;  2LUL A;  2PZ1 A;  3QWM A;  4H8S A;  2RLO A;  4NSW A;  2D10 A;  3WA0 A;  3A8Q A;  3HQC A;  2K2U A;  4A6F B;  2M38 A;  5CLL B;  2DKQ A;  1P3R A;  5LOP B;  2IFS A;  1U2B A;  1FOE A;  3U7D A;  3ZVR A;  3ODW A;  1U5F A;  1PMS A;  1ZC4 B;  2K2J A;  3P7Z A;  4WVF B;  4IAP A;  5C79 A;  2XQN M;  3D8D A;  1M7E A;  1J19 A;  3D8F A;  3SNH A;  4HAW B;  4BBK A;  1U29 A;  2DTC A;  1UNP A;  1NU2 A;  1SGH A;  2LOX A;  2Y8G A;  4HDO A;  2YT1 A;  2E2X A;  3KRW A;  4WSF A;  3ML4 A;  1U5E A;  4ZRK A;  4ZRI A;  2COD A;  5D3X A;  1MK9 B;  1NTV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...