3SO6A

Crystal structure of the ldl receptor tail in complex with autosomal recessive hypercholesterolemia ptb domain
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
137
structure length
137
Chain Sequence
MEGMVFSLKYLGMTLVERPKGEELSAAAVKRIVATAKASGKKLQKVTLKVSPRGIILTDSLTSQLIENVSIYRISYCTADKMHDKVFAYIAQSQQNESLECHAFLCTKRKVAQAVTLTVAQAFKVAFEFWQVSLVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding/protein transport
molecule keywords LDL receptor adaptor protein
publication title Atomic structure of the autosomal recessive hypercholesterolemia phosphotyrosine-binding domain in complex with the LDL-receptor tail.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 39
structure length 137
sequence length 137
ec nomenclature
pdb deposition date 2011-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00640 PID Phosphotyrosine interaction domain (PTB/PID)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3so6A00
2D9YA 1XR0B 4PQ0A 5HE1A 1FHOA 1U2BA 4Y94A 4MT7A 4EJNA 4DXAB 3O96A 1SGHA 2CAYA 4IOYX 2P0DA 2N0YA 1DYNA 3ZDTA 1GC6A 2Y8GA 4MY6A 4Z2MB 5J3QA 4GMVA 4NSWA 1UNRA 3QWMA 3AU5A 2RGNB 3SV1A 1ZVRA 3FEHA 5DHAB 4DX90 3TFMA 5CLQB 3QBVB 4GMXB 3ULBA 1W1GA 2H7EA 4HATB 2KCJA 1Y19B 3PVLA 2Q13A 2J0KA 4NY0A 5EFXA 4KHBB 2ZPYA 3MPXA 3PEGA 4YL8A 1GG3A 1K5GB 2L1CA 1WVHA 1MK9B 2Z0OA 2X18A 2ELAA 1DROA 1U5FA 3F0WA 1MIXA 2P0HA 4L6EA 2QKMA 3SUZA 2OQBA 1XKEA 1V89A 1WGQA 2MWNB 4HDQA 4HB0B 1J19A 4K17A 3QIJA 4ZRIA 3U7DA 1H4RA 1KZGA 5L81A 4WSFA 2MFQA 3PZDA 3VIAA 1X11A 3SNHA 3MDBC 1MKEA 4KHAA 1X1GA 1LW3A 4P7IA 1N3HA 2ELBA 2YSZA 1U5GA 4C0AA 2YVCA 2VSZA 1QC6A 1U27A 2YF0A 3T06A 3A8QA 2CRFA 3LJUX 3CIKA 4HAUB 4EKUA 2ROZB 4DBBA 1MPHA 1FGZA 3DXCA 3PVUA 5C79A 5KQ1A 1J0WA 1WJMA 5JHHA 4BBKA 1GC7A 1BAKA 3A98B 5JHGA 2RLOA 3N7CA 1BTNA 2E2XA 1V5PA 2UVMA 2Y7BA 2V76A 1NU2A 2I1KA 5CLLB 1DDWA 2GS0A 1EF1A 2G35A 1FB8A 2MKRA 1TQZA 2D9WA 1DDMA 1U5EA 4Z2NA 3ODOA 2D10A 3NSUA 3P7ZA 3A8PA 4A6HA 2J0JA 5DIFB 2D9VA 2DX5A 1FHWA 1OY2A 1X1FA 2P0FA 2RNRB 4D0NB 2VRWB 2XQNM 1M7RA 1NTVA 2IYBA 2I5CA 3FM8C 1M7EA 2ROVA 2H7DA 4HB4B 5DHFB 3PP2A 2Y8FA 4K2PA 3TCAA 4K81A 3SO6A 5KQ4A 2DKPA 4CHJA 3KRWA 3AU4A 1W1HA 5C6RA 1UPRA 1MIZB 2DHJA 3AJ4A 4HAYB 2KGXB 1V5UA 3PG7A 1TJ6A 2YS3A 5HE0A 1BTKA 1WJ1A 3TW1A 2PZ1A 1PMSA 1H10A 3DXDA 2DKQA 3OANA 2HTHB 2DTCA 5HE2A 2M14A 4CHMA 1FGYA 1P3RA 4KHOA 5D3VA 1WG7A 2RSGA 2LOXA 3FSSA 2HE7A 4KAXB 2YS5A 1OQNA 4ZRKA 1RJ2A 1XODA 1NI2A 4KVGB 5JP4A 2J59M 3G9WA 2LULA 1XCGA 2UZSA 2AEHA 2LKOA 2EJ8A 5J3YA 2COAA 5D3YA 3IVFA 4K2OA 4GN1A 2I5FA 4YONA 1IRSA 2NMBA 3ZVRA 2KUPA 2DLWA 1Q67A 1W1DA 2OTXA 2GCLA 2LOZA 2MDXA 1ZC4B 2Z0QA 1XX0A 3HW2B 4GPTB 1OMWA 2DYNA 5HE3A 5D3XA 4TYZA 1EGXA 2K2JA 4HAVB 5LOPB 3D8DA 2CY4A 2FJLA 2Z0PA 1WI1A 2W2XC 2YT0A 3U8ZA 2JP2A 3PSCA 3TVVA 4HAWB 2L2IA 1UEFA 4A6FA 5GOWB 1KZ7A 3M1IB 2ADZA 2BCJA 2EMTA 1Y5OA 2D9XA 1PFJA 2COFA 1ZSQA 1UNPA 1ZM0A 2W2WA 2DYQA 3CXBB 2AL6A 1SHCA 2DFKA 5FI0A 2VKIA 3TO1A 2YS1A 3KSYA 4F7UP 3ML4A 3D8EA 3HK0A 4TKNA 3DXEA 2K00A 2P8VA 2EC1A 1K5DB 4IFSA 4EMOA 4HAZB 3SYXA 1X05A 3GYOA 4HB2B 3KRXA 4DX8A 1LB1A 1U5DA 3WYFB 1UPQA 1FOEA 4WVFB 4GZUA 1V61A 1EVHA 1ZC3B 2DA0A 2QKLA 1TXDA 2D2QA 3RCPA 2IFSA 3ODXA 1FHXA 2DHKA 3V5WA 2GCJA 5D3WA 4F7GA 2EMSA 2CY5A 1X86A 3BINA 3PVWA 5C16A 5DI9B 3BJIA 4GXBA 4IAPA 2LYDA 5D27A 1P6SA 4A6FB 2N23A 1V88A 2YRYA 2W2XD 4A6KA 3KZ1A 3ODWA 1AQCA 5C5BA 2D4QA 3ULCA 4ZRJA 1U29A 4A5KA 2K2UA 2UZRA 2DN6A 2RVBB 1NTYA 4B6HA 3D8FA 1RRPB 3KY9A 1B55A 1XD4A 4MK0A 5LONB 2COCA 3VOQA 2GJYA 5JLJB 1WGUA 1PLSA 4HB3B 1QQGA 1UNQA 1KI1B 1EAZA 4HDOA 4XWXA 4PNKA 3F5RA 3UZTA 2D11A 5DH9B 2DHIA 4F7HA 3GYPA 1DDVA 1I7AA 1Z87A 1I2HA 1AWEA 5FI1A 3X23A 2M38A 4CYEA 1P5TA 3HQCA 5J3TA 1E5WA 2NZ8B 1DBHA 2I1JA 1ISNA 2CODA 5KCVA 1V5MA 2DX1A 4H8SA 4WJ7A 2RUKB 4HAXB 1MK7B 1MAIA 2J0MA 3P6AA 2LG1A 1BWNA 2R09A 2YT1A 5C5BB 2R0DA 2D9ZA 3WA0A 4HHVA 1FAOA
chains in the Genus database with same CATH superfamily
2D9YA 2NBVA 1XR0B 4CSQA 4PQ0A 5HE1A 1FHOA 1U2BA 4Y94A 4MT7A 4EJNA 4DXAB 3O96A 1SGHA 2CAYA 3A58A 4IOYX 2P0DA 2N0YA 1DYNA 3ZDTA 1GC6A 2Y8GA 4MY6A 4Z2MB 5J3QA 4GMVA 4NSWA 1UNRA 3QWMA 3AU5A 2RGNB 3SV1A 2Z59A 1ZVRA 3FEHA 5DHAB 4DX90 3TFMA 5CLQB 3QBVB 4GMXB 3ULBA 1W1GA 2H7EA 4HATB 4DIXA 2KCJA 1Y19B 3PVLA 2Q13A 2J0KA 4NY0A 5EFXA 4KHBB 2ZPYA 3MPXA 3HSAA 3PEGA 4YL8A 1GG3A 1K5GB 2KUQA 2L1CA 1WVHA 1MK9B 2Z0OA 2FJUB 2X18A 2ELAA 2KIEA 1DROA 1U5FA 3F0WA 1MIXA 2Z13A 2P0HA 4L6EA 2QKMA 3SUZA 2OQBA 1XKEA 1V89A 1WGQA 2GUMA 2MWNB 4HDQA 4HB0B 3OHMB 1J19A 3NW8A 4K17A 3QIJA 4ZRIA 3U7DA 1H4RA 1KZGA 5L81A 4WSFA 2MFQA 3PZDA 3VIAA 1X11A 3SNHA 3MDBC 1MKEA 4KHAA 1X1GA 1LW3A 4P7IA 1N3HA 2ELBA 2YSZA 1U5GA 4C0AA 2YVCA 3U12A 2VSZA 1QC6A 1U27A 2YF0A 3T06A 3A8QA 2CRFA 4L1RA 3LJUX 3CIKA 4HAUB 4EKUA 2ROZB 4DBBA 1MPHA 1FGZA 3DXCA 3PVUA 5C79A 5KQ1A 1J0WA 1WJMA 5JHHA 2K49A 4BBKA 5LG4B 1GC7A 1BAKA 3A98B 5JHGA 2RLOA 4QJ5B 3N7CA 1BTNA 2E2XA 1V5PA 2UVMA 2Y7BA 2V76A 1NU2A 2I1KA 5CLLB 1DDWA 2GS0A 1EF1A 2G35A 1FB8A 2MKRA 1TQZA 2D9WA 1DDMA 1U5EA 4Z2NA 3ODOA 2D10A 3NSUA 3P7ZA 3A8PA 4A6HA 2J0JA 5DIFB 2D9VA 2DX5A 1FHWA 1OY2A 1X1FA 2P0FA 2Z4DA 2RNRB 4D0NB 2VRWB 2XQNM 1M7RA 1NTVA 2IYBA 2I5CA 3FM8C 1M7EA 2ROVA 5M4YB 2H7DA 4HB4B 5DHFB 3FVCA 3PP2A 2Y8FA 4K2PA 3TCAA 4K81A 3SO6A 4D6WA 2Z14A 5KQ4A 2DKPA 4CHJA 3KRWA 3AU4A 5I2SA 1W1HA 5C6RA 1UPRA 1MIZB 2DHJA 3AJ4A 4HAYB 2KGXB 1V5UA 3PG7A 1TJ6A 2YS3A 5HE0A 1BTKA 1WJ1A 1MI1A 3TW1A 2PZ1A 1PMSA 1H10A 1ZYIA 3DXDA 2DKQA 2YT2A 3OANA 2HTHB 2DTCA 5HE2A 2M14A 4CHMA 1FGYA 1P3RA 4KHOA 5D3VA 1WG7A 2RSGA 2LOXA 3FSSA 2HE7A 4KAXB 2YS5A 1OQNA 4ZRKA 1RJ2A 1XODA 4OSNA 1NI2A 4KVGB 5JP4A 2J59M 3G9WA 2LULA 1XCGA 2UZSA 2AEHA 2LKOA 2EJ8A 5IRSA 5J3YA 2COAA 3NWAA 5D3YA 3IVFA 4K2OA 4GN1A 2I5FA 4YONA 3HIEA 1IRSA 2NMBA 3ZVRA 2KUPA 2DLWA 1Q67A 1W1DA 2OTXA 2GCLA 2LOZA 2MDXA 1ZC4B 2Z0QA 1XX0A 3HW2B 4GPTB 1OMWA 2DYNA 5HE3A 3DCXA 5D3XA 4GNKB 4TYZA 1EGXA 2K2JA 4HAVB 5LOPB 3D8DA 2CY4A 2FJLA 2Z0PA 1WI1A 2W2XC 2YT0A 3U8ZA 2JP2A 3PSCA 3TVVA 4HAWB 2L2IA 4QJ3B 1UEFA 4A6FA 5GOWB 1KZ7A 3NWDA 3M1IB 2ADZA 5I2MA 2BCJA 2EMTA 1Y5OA 2D9XA 3NWFA 1PFJA 2COFA 1ZSQA 1UNPA 1ZM0A 2W2WA 2DYQA 3CXBB 2AL6A 1SHCA 2DFKA 5FI0A 2VKIA 3TO1A 2YS1A 2RRFA 3KSYA 4F7UP 3ML4A 3D8EA 3HK0A 4TKNA 3DXEA 2K00A 2P8VA 2EC1A 2R2YA 1K5DB 4IFSA 4EMOA 4HAZB 3SYXA 1X05A 2ZKMX 3GYOA 4HB2B 3KRXA 4DX8A 1LB1A 1U5DA 1T77A 3WYFB 1UPQA 1FOEA 4WVFB 4GZUA 1V61A 1EVHA 1ZC3B 2DA0A 2QKLA 1TXDA 2D2QA 3RCPA 2IFSA 3ODXA 1FHXA 2DHKA 3V5WA 2GCJA 5D3WA 4F7GA 2EMSA 2CY5A 1X86A 3BINA 3PVWA 5C16A 5DI9B 3BJIA 4GXBA 4IAPA 2LYDA 5D27A 1P6SA 4A6FB 2N23A 1V88A 2YRYA 4OT1A 2KIGA 2W2XD 4A6KA 3B77A 3KZ1A 3ODWA 1AQCA 5C5BA 2D4QA 3ULCA 4ZRJA 1U29A 4A5KA 2K2UA 2UZRA 2DN6A 2RVBB 1NTYA 4B6HA 3D8FA 1RRPB 3KY9A 1B55A 1XD4A 4MK0A 5LONB 2COCA 3VOQA 2GJYA 5JLJB 1WGUA 1PLSA 4HB3B 4HSIA 1QQGA 1UNQA 1KI1B 1EAZA 4HDOA 2K8EA 4XWXA 4PNKA 3F5RA 3UZTA 2D11A 5DH9B 2KR0A 4QXAB 2DHIA 4QJ4B 4F7HA 3GYPA 1DDVA 1I7AA 1Z87A 4GOUA 1I2HA 1AWEA 5FI1A 3X23A 2M38A 4CYEA 1P5TA 3HQCA 5J3TA 1E5WA 2NZ8B 1DBHA 2I1JA 1ISNA 2CODA 5KCVA 1V5MA 2DX1A 4KHBA 4H8SA 4WJ7A 2RUKB 4HAXB 1MK7B 1MAIA 2J0MA 3P6AA 2LG1A 1BWNA 2R09A 2YT1A 5C5BB 2R0DA 2D9ZA 3WA0A 4HHVA 1FAOA
chains in the Genus database with same CATH topology
2D9YA 1XR0B 4PQ0A 5HE1A 1FHOA 1U2BA 4Y94A 4MT7A 4EJNA 4DXAB 3O96A 1SGHA 2CAYA 4IOYX 2P0DA 2N0YA 1DYNA 3ZDTA 1GC6A 2Y8GA 4MY6A 4Z2MB 5J3QA 4GMVA 4NSWA 1UNRA 3QWMA 3AU5A 2RGNB 3SV1A 1ZVRA 3FEHA 5DHAB 4DX90 3TFMA 5CLQB 3QBVB 4GMXB 3ULBA 1W1GA 2H7EA 4HATB 2KCJA 1Y19B 3PVLA 2Q13A 2J0KA 4NY0A 5EFXA 4KHBB 2ZPYA 3MPXA 3PEGA 4YL8A 1GG3A 1K5GB 2L1CA 1WVHA 1MK9B 2Z0OA 2X18A 2ELAA 1DROA 1U5FA 3F0WA 1MIXA 2P0HA 4L6EA 2QKMA 3SUZA 2OQBA 1XKEA 1V89A 1WGQA 2MWNB 4HDQA 4HB0B 1J19A 4K17A 3QIJA 4ZRIA 3U7DA 1H4RA 1KZGA 5L81A 4WSFA 2MFQA 3PZDA 3VIAA 1X11A 3SNHA 3MDBC 1MKEA 4KHAA 1X1GA 1LW3A 4P7IA 1N3HA 2ELBA 2YSZA 1U5GA 4C0AA 2YVCA 2VSZA 1QC6A 1U27A 2YF0A 3T06A 3A8QA 2CRFA 3LJUX 3CIKA 4HAUB 4EKUA 2ROZB 4DBBA 1MPHA 1FGZA 3DXCA 3PVUA 5C79A 5KQ1A 1J0WA 1WJMA 5JHHA 4BBKA 1GC7A 1BAKA 3A98B 5JHGA 2RLOA 3N7CA 1BTNA 2E2XA 1V5PA 2UVMA 2Y7BA 2V76A 1NU2A 2I1KA 5CLLB 1DDWA 2GS0A 1EF1A 2G35A 1FB8A 2MKRA 1TQZA 2D9WA 1DDMA 1U5EA 4Z2NA 3ODOA 2D10A 3NSUA 3P7ZA 3A8PA 4A6HA 2J0JA 5DIFB 2D9VA 2DX5A 1FHWA 1OY2A 1X1FA 2P0FA 2RNRB 4D0NB 2VRWB 2XQNM 1M7RA 1NTVA 2IYBA 2I5CA 3FM8C 1M7EA 2ROVA 2H7DA 4HB4B 5DHFB 3PP2A 2Y8FA 4K2PA 3TCAA 4K81A 3SO6A 5KQ4A 2DKPA 4CHJA 3KRWA 3AU4A 1W1HA 5C6RA 1UPRA 1MIZB 2DHJA 3AJ4A 4HAYB 2KGXB 1V5UA 3PG7A 1TJ6A 2YS3A 5HE0A 1BTKA 1WJ1A 3TW1A 2PZ1A 1PMSA 1H10A 3DXDA 2DKQA 3OANA 2HTHB 2DTCA 5HE2A 2M14A 4CHMA 1FGYA 1P3RA 4KHOA 5D3VA 1WG7A 2RSGA 2LOXA 3FSSA 2HE7A 4KAXB 2YS5A 1OQNA 4ZRKA 1RJ2A 1XODA 1NI2A 4KVGB 5JP4A 2J59M 3G9WA 2LULA 1XCGA 2UZSA 2AEHA 2LKOA 2EJ8A 5J3YA 2COAA 5D3YA 3IVFA 4K2OA 4GN1A 2I5FA 4YONA 1IRSA 2NMBA 3ZVRA 2KUPA 2DLWA 1Q67A 1W1DA 2OTXA 2GCLA 2LOZA 2MDXA 1ZC4B 2Z0QA 1XX0A 3HW2B 4GPTB 1OMWA 2DYNA 5HE3A 5D3XA 4TYZA 1EGXA 2K2JA 4HAVB 5LOPB 3D8DA 2CY4A 2FJLA 2Z0PA 1WI1A 2W2XC 2YT0A 3U8ZA 2JP2A 3PSCA 3TVVA 4HAWB 2L2IA 1UEFA 4A6FA 5GOWB 1KZ7A 3M1IB 2ADZA 2BCJA 2EMTA 1Y5OA 2D9XA 1PFJA 2COFA 1ZSQA 1UNPA 1ZM0A 2W2WA 2DYQA 3CXBB 2AL6A 1SHCA 2DFKA 5FI0A 2VKIA 3TO1A 2YS1A 3KSYA 4F7UP 3ML4A 3D8EA 3HK0A 4TKNA 3DXEA 2K00A 2P8VA 2EC1A 1K5DB 4IFSA 4EMOA 4HAZB 3SYXA 1X05A 3GYOA 4HB2B 3KRXA 4DX8A 1LB1A 1U5DA 3WYFB 1UPQA 1FOEA 4WVFB 4GZUA 1V61A 1EVHA 1ZC3B 2DA0A 2QKLA 1TXDA 2D2QA 3RCPA 2IFSA 3ODXA 1FHXA 2DHKA 3V5WA 2GCJA 5D3WA 4F7GA 2EMSA 2CY5A 1X86A 3BINA 3PVWA 5C16A 5DI9B 3BJIA 4GXBA 4IAPA 2LYDA 5D27A 1P6SA 4A6FB 2N23A 1V88A 2YRYA 2W2XD 4A6KA 3KZ1A 3ODWA 1AQCA 5C5BA 2D4QA 3ULCA 4ZRJA 1U29A 4A5KA 2K2UA 2UZRA 2DN6A 2RVBB 1NTYA 4B6HA 3D8FA 1RRPB 3KY9A 1B55A 1XD4A 4MK0A 5LONB 2COCA 3VOQA 2GJYA 5JLJB 1WGUA 1PLSA 4HB3B 1QQGA 1UNQA 1KI1B 1EAZA 4HDOA 4XWXA 4PNKA 3F5RA 3UZTA 2D11A 5DH9B 2DHIA 4F7HA 3GYPA 1DDVA 1I7AA 1Z87A 1I2HA 1AWEA 5FI1A 3X23A 2M38A 4CYEA 1P5TA 3HQCA 5J3TA 1E5WA 2NZ8B 1DBHA 2I1JA 1ISNA 2CODA 5KCVA 1V5MA 2DX1A 4H8SA 4WJ7A 2RUKB 4HAXB 1MK7B 1MAIA 2J0MA 3P6AA 2LG1A 1BWNA 2R09A 2YT1A 5C5BB 2R0DA 2D9ZA 3WA0A 4HHVA 1FAOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D9Y A;  1XR0 B;  4PQ0 A;  5HE1 A;  1FHO A;  1U2B A;  4Y94 A;  4MT7 A;  4EJN A;  4DXA B;  3O96 A;  1SGH A;  2CAY A;  4IOY X;  2P0D A;  2N0Y A;  1DYN A;  3ZDT A;  1GC6 A;  2Y8G A;  4MY6 A;  4Z2M B;  5J3Q A;  4GMV A;  4NSW A;  1UNR A;  3QWM A;  3AU5 A;  2RGN B;  3SV1 A;  1ZVR A;  3FEH A;  5DHA B;  4DX9 0;  3TFM A;  5CLQ B;  3QBV B;  4GMX B;  3ULB A;  1W1G A;  2H7E A;  4HAT B;  2KCJ A;  1Y19 B;  3PVL A;  2Q13 A;  2J0K A;  4NY0 A;  5EFX A;  4KHB B;  2ZPY A;  3MPX A;  3PEG A;  4YL8 A;  1GG3 A;  1K5G B;  2L1C A;  1WVH A;  1MK9 B;  2Z0O A;  2X18 A;  2ELA A;  1DRO A;  1U5F A;  3F0W A;  1MIX A;  2P0H A;  4L6E A;  2QKM A;  3SUZ A;  2OQB A;  1XKE A;  1V89 A;  1WGQ A;  2MWN B;  4HDQ A;  4HB0 B;  1J19 A;  4K17 A;  3QIJ A;  4ZRI A;  3U7D A;  1H4R A;  1KZG A;  5L81 A;  4WSF A;  2MFQ A;  3PZD A;  3VIA A;  1X11 A;  3SNH A;  3MDB C;  1MKE A;  4KHA A;  1X1G A;  1LW3 A;  4P7I A;  1N3H A;  2ELB A;  2YSZ A;  1U5G A;  4C0A A;  2YVC A;  2VSZ A;  1QC6 A;  1U27 A;  2YF0 A;  3T06 A;  3A8Q A;  2CRF A;  3LJU X;  3CIK A;  4HAU B;  4EKU A;  2ROZ B;  4DBB A;  1MPH A;  1FGZ A;  3DXC A;  3PVU A;  5C79 A;  5KQ1 A;  1J0W A;  1WJM A;  5JHH A;  4BBK A;  1GC7 A;  1BAK A;  3A98 B;  5JHG A;  2RLO A;  3N7C A;  1BTN A;  2E2X A;  1V5P A;  2UVM A;  2Y7B A;  2V76 A;  1NU2 A;  2I1K A;  5CLL B;  1DDW A;  2GS0 A;  1EF1 A;  2G35 A;  1FB8 A;  2MKR A;  1TQZ A;  2D9W A;  1DDM A;  1U5E A;  4Z2N A;  3ODO A;  2D10 A;  3NSU A;  3P7Z A;  3A8P A;  4A6H A;  2J0J A;  5DIF B;  2D9V A;  2DX5 A;  1FHW A;  1OY2 A;  1X1F A;  2P0F A;  2RNR B;  4D0N B;  2VRW B;  2XQN M;  1M7R A;  1NTV A;  2IYB A;  2I5C A;  3FM8 C;  1M7E A;  2ROV A;  2H7D A;  4HB4 B;  5DHF B;  3PP2 A;  2Y8F A;  4K2P A;  3TCA A;  4K81 A;  3SO6 A;  5KQ4 A;  2DKP A;  4CHJ A;  3KRW A;  3AU4 A;  1W1H A;  5C6R A;  1UPR A;  1MIZ B;  2DHJ A;  3AJ4 A;  4HAY B;  2KGX B;  1V5U A;  3PG7 A;  1TJ6 A;  2YS3 A;  5HE0 A;  1BTK A;  1WJ1 A;  3TW1 A;  2PZ1 A;  1PMS A;  1H10 A;  3DXD A;  2DKQ A;  3OAN A;  2HTH B;  2DTC A;  5HE2 A;  2M14 A;  4CHM A;  1FGY A;  1P3R A;  4KHO A;  5D3V A;  1WG7 A;  2RSG A;  2LOX A;  3FSS A;  2HE7 A;  4KAX B;  2YS5 A;  1OQN A;  4ZRK A;  1RJ2 A;  1XOD A;  1NI2 A;  4KVG B;  5JP4 A;  2J59 M;  3G9W A;  2LUL A;  1XCG A;  2UZS A;  2AEH A;  2LKO A;  2EJ8 A;  5J3Y A;  2COA A;  5D3Y A;  3IVF A;  4K2O A;  4GN1 A;  2I5F A;  4YON A;  1IRS A;  2NMB A;  3ZVR A;  2KUP A;  2DLW A;  1Q67 A;  1W1D A;  2OTX A;  2GCL A;  2LOZ A;  2MDX A;  1ZC4 B;  2Z0Q A;  1XX0 A;  3HW2 B;  4GPT B;  1OMW A;  2DYN A;  5HE3 A;  5D3X A;  4TYZ A;  1EGX A;  2K2J A;  4HAV B;  5LOP B;  3D8D A;  2CY4 A;  2FJL A;  2Z0P A;  1WI1 A;  2W2X C;  2YT0 A;  3U8Z A;  2JP2 A;  3PSC A;  3TVV A;  4HAW B;  2L2I A;  1UEF A;  4A6F A;  5GOW B;  1KZ7 A;  3M1I B;  2ADZ A;  2BCJ A;  2EMT A;  1Y5O A;  2D9X A;  1PFJ A;  2COF A;  1ZSQ A;  1UNP A;  1ZM0 A;  2W2W A;  2DYQ A;  3CXB B;  2AL6 A;  1SHC A;  2DFK A;  5FI0 A;  2VKI A;  3TO1 A;  2YS1 A;  3KSY A;  4F7U P;  3ML4 A;  3D8E A;  3HK0 A;  4TKN A;  3DXE A;  2K00 A;  2P8V A;  2EC1 A;  1K5D B;  4IFS A;  4EMO A;  4HAZ B;  3SYX A;  1X05 A;  3GYO A;  4HB2 B;  3KRX A;  4DX8 A;  1LB1 A;  1U5D A;  3WYF B;  1UPQ A;  1FOE A;  4WVF B;  4GZU A;  1V61 A;  1EVH A;  1ZC3 B;  2DA0 A;  2QKL A;  1TXD A;  2D2Q A;  3RCP A;  2IFS A;  3ODX A;  1FHX A;  2DHK A;  3V5W A;  2GCJ A;  5D3W A;  4F7G A;  2EMS A;  2CY5 A;  1X86 A;  3BIN A;  3PVW A;  5C16 A;  5DI9 B;  3BJI A;  4GXB A;  4IAP A;  2LYD A;  5D27 A;  1P6S A;  4A6F B;  2N23 A;  1V88 A;  2YRY A;  2W2X D;  4A6K A;  3KZ1 A;  3ODW A;  1AQC A;  5C5B A;  2D4Q A;  3ULC A;  4ZRJ A;  1U29 A;  4A5K A;  2K2U A;  2UZR A;  2DN6 A;  2RVB B;  1NTY A;  4B6H A;  3D8F A;  1RRP B;  3KY9 A;  1B55 A;  1XD4 A;  4MK0 A;  5LON B;  2COC A;  3VOQ A;  2GJY A;  5JLJ B;  1WGU A;  1PLS A;  4HB3 B;  1QQG A;  1UNQ A;  1KI1 B;  1EAZ A;  4HDO A;  4XWX A;  4PNK A;  3F5R A;  3UZT A;  2D11 A;  5DH9 B;  2DHI A;  4F7H A;  3GYP A;  1DDV A;  1I7A A;  1Z87 A;  1I2H A;  1AWE A;  5FI1 A;  3X23 A;  2M38 A;  4CYE A;  1P5T A;  3HQC A;  5J3T A;  1E5W A;  2NZ8 B;  1DBH A;  2I1J A;  1ISN A;  2COD A;  5KCV A;  1V5M A;  2DX1 A;  4H8S A;  4WJ7 A;  2RUK B;  4HAX B;  1MK7 B;  1MAI A;  2J0M A;  3P6A A;  2LG1 A;  1BWN A;  2R09 A;  2YT1 A;  5C5B B;  2R0D A;  2D9Z A;  3WA0 A;  4HHV A;  1FAO A; 
#chains in the Genus database with same CATH topology
 2D9Y A;  2NBV A;  1XR0 B;  4CSQ A;  4PQ0 A;  5HE1 A;  1FHO A;  1U2B A;  4Y94 A;  4MT7 A;  4EJN A;  4DXA B;  3O96 A;  1SGH A;  2CAY A;  3A58 A;  4IOY X;  2P0D A;  2N0Y A;  1DYN A;  3ZDT A;  1GC6 A;  2Y8G A;  4MY6 A;  4Z2M B;  5J3Q A;  4GMV A;  4NSW A;  1UNR A;  3QWM A;  3AU5 A;  2RGN B;  3SV1 A;  2Z59 A;  1ZVR A;  3FEH A;  5DHA B;  4DX9 0;  3TFM A;  5CLQ B;  3QBV B;  4GMX B;  3ULB A;  1W1G A;  2H7E A;  4HAT B;  4DIX A;  2KCJ A;  1Y19 B;  3PVL A;  2Q13 A;  2J0K A;  4NY0 A;  5EFX A;  4KHB B;  2ZPY A;  3MPX A;  3HSA A;  3PEG A;  4YL8 A;  1GG3 A;  1K5G B;  2KUQ A;  2L1C A;  1WVH A;  1MK9 B;  2Z0O A;  2FJU B;  2X18 A;  2ELA A;  2KIE A;  1DRO A;  1U5F A;  3F0W A;  1MIX A;  2Z13 A;  2P0H A;  4L6E A;  2QKM A;  3SUZ A;  2OQB A;  1XKE A;  1V89 A;  1WGQ A;  2GUM A;  2MWN B;  4HDQ A;  4HB0 B;  3OHM B;  1J19 A;  3NW8 A;  4K17 A;  3QIJ A;  4ZRI A;  3U7D A;  1H4R A;  1KZG A;  5L81 A;  4WSF A;  2MFQ A;  3PZD A;  3VIA A;  1X11 A;  3SNH A;  3MDB C;  1MKE A;  4KHA A;  1X1G A;  1LW3 A;  4P7I A;  1N3H A;  2ELB A;  2YSZ A;  1U5G A;  4C0A A;  2YVC A;  3U12 A;  2VSZ A;  1QC6 A;  1U27 A;  2YF0 A;  3T06 A;  3A8Q A;  2CRF A;  4L1R A;  3LJU X;  3CIK A;  4HAU B;  4EKU A;  2ROZ B;  4DBB A;  1MPH A;  1FGZ A;  3DXC A;  3PVU A;  5C79 A;  5KQ1 A;  1J0W A;  1WJM A;  5JHH A;  2K49 A;  4BBK A;  5LG4 B;  1GC7 A;  1BAK A;  3A98 B;  5JHG A;  2RLO A;  4QJ5 B;  3N7C A;  1BTN A;  2E2X A;  1V5P A;  2UVM A;  2Y7B A;  2V76 A;  1NU2 A;  2I1K A;  5CLL B;  1DDW A;  2GS0 A;  1EF1 A;  2G35 A;  1FB8 A;  2MKR A;  1TQZ A;  2D9W A;  1DDM A;  1U5E A;  4Z2N A;  3ODO A;  2D10 A;  3NSU A;  3P7Z A;  3A8P A;  4A6H A;  2J0J A;  5DIF B;  2D9V A;  2DX5 A;  1FHW A;  1OY2 A;  1X1F A;  2P0F A;  2Z4D A;  2RNR B;  4D0N B;  2VRW B;  2XQN M;  1M7R A;  1NTV A;  2IYB A;  2I5C A;  3FM8 C;  1M7E A;  2ROV A;  5M4Y B;  2H7D A;  4HB4 B;  5DHF B;  3FVC A;  3PP2 A;  2Y8F A;  4K2P A;  3TCA A;  4K81 A;  3SO6 A;  4D6W A;  2Z14 A;  5KQ4 A;  2DKP A;  4CHJ A;  3KRW A;  3AU4 A;  5I2S A;  1W1H A;  5C6R A;  1UPR A;  1MIZ B;  2DHJ A;  3AJ4 A;  4HAY B;  2KGX B;  1V5U A;  3PG7 A;  1TJ6 A;  2YS3 A;  5HE0 A;  1BTK A;  1WJ1 A;  1MI1 A;  3TW1 A;  2PZ1 A;  1PMS A;  1H10 A;  1ZYI A;  3DXD A;  2DKQ A;  2YT2 A;  3OAN A;  2HTH B;  2DTC A;  5HE2 A;  2M14 A;  4CHM A;  1FGY A;  1P3R A;  4KHO A;  5D3V A;  1WG7 A;  2RSG A;  2LOX A;  3FSS A;  2HE7 A;  4KAX B;  2YS5 A;  1OQN A;  4ZRK A;  1RJ2 A;  1XOD A;  4OSN A;  1NI2 A;  4KVG B;  5JP4 A;  2J59 M;  3G9W A;  2LUL A;  1XCG A;  2UZS A;  2AEH A;  2LKO A;  2EJ8 A;  5IRS A;  5J3Y A;  2COA A;  3NWA A;  5D3Y A;  3IVF A;  4K2O A;  4GN1 A;  2I5F A;  4YON A;  3HIE A;  1IRS A;  2NMB A;  3ZVR A;  2KUP A;  2DLW A;  1Q67 A;  1W1D A;  2OTX A;  2GCL A;  2LOZ A;  2MDX A;  1ZC4 B;  2Z0Q A;  1XX0 A;  3HW2 B;  4GPT B;  1OMW A;  2DYN A;  5HE3 A;  3DCX A;  5D3X A;  4GNK B;  4TYZ A;  1EGX A;  2K2J A;  4HAV B;  5LOP B;  3D8D A;  2CY4 A;  2FJL A;  2Z0P A;  1WI1 A;  2W2X C;  2YT0 A;  3U8Z A;  2JP2 A;  3PSC A;  3TVV A;  4HAW B;  2L2I A;  4QJ3 B;  1UEF A;  4A6F A;  5GOW B;  1KZ7 A;  3NWD A;  3M1I B;  2ADZ A;  5I2M A;  2BCJ A;  2EMT A;  1Y5O A;  2D9X A;  3NWF A;  1PFJ A;  2COF A;  1ZSQ A;  1UNP A;  1ZM0 A;  2W2W A;  2DYQ A;  3CXB B;  2AL6 A;  1SHC A;  2DFK A;  5FI0 A;  2VKI A;  3TO1 A;  2YS1 A;  2RRF A;  3KSY A;  4F7U P;  3ML4 A;  3D8E A;  3HK0 A;  4TKN A;  3DXE A;  2K00 A;  2P8V A;  2EC1 A;  2R2Y A;  1K5D B;  4IFS A;  4EMO A;  4HAZ B;  3SYX A;  1X05 A;  2ZKM X;  3GYO A;  4HB2 B;  3KRX A;  4DX8 A;  1LB1 A;  1U5D A;  1T77 A;  3WYF B;  1UPQ A;  1FOE A;  4WVF B;  4GZU A;  1V61 A;  1EVH A;  1ZC3 B;  2DA0 A;  2QKL A;  1TXD A;  2D2Q A;  3RCP A;  2IFS A;  3ODX A;  1FHX A;  2DHK A;  3V5W A;  2GCJ A;  5D3W A;  4F7G A;  2EMS A;  2CY5 A;  1X86 A;  3BIN A;  3PVW A;  5C16 A;  5DI9 B;  3BJI A;  4GXB A;  4IAP A;  2LYD A;  5D27 A;  1P6S A;  4A6F B;  2N23 A;  1V88 A;  2YRY A;  4OT1 A;  2KIG A;  2W2X D;  4A6K A;  3B77 A;  3KZ1 A;  3ODW A;  1AQC A;  5C5B A;  2D4Q A;  3ULC A;  4ZRJ A;  1U29 A;  4A5K A;  2K2U A;  2UZR A;  2DN6 A;  2RVB B;  1NTY A;  4B6H A;  3D8F A;  1RRP B;  3KY9 A;  1B55 A;  1XD4 A;  4MK0 A;  5LON B;  2COC A;  3VOQ A;  2GJY A;  5JLJ B;  1WGU A;  1PLS A;  4HB3 B;  4HSI A;  1QQG A;  1UNQ A;  1KI1 B;  1EAZ A;  4HDO A;  2K8E A;  4XWX A;  4PNK A;  3F5R A;  3UZT A;  2D11 A;  5DH9 B;  2KR0 A;  4QXA B;  2DHI A;  4QJ4 B;  4F7H A;  3GYP A;  1DDV A;  1I7A A;  1Z87 A;  4GOU A;  1I2H A;  1AWE A;  5FI1 A;  3X23 A;  2M38 A;  4CYE A;  1P5T A;  3HQC A;  5J3T A;  1E5W A;  2NZ8 B;  1DBH A;  2I1J A;  1ISN A;  2COD A;  5KCV A;  1V5M A;  2DX1 A;  4KHB A;  4H8S A;  4WJ7 A;  2RUK B;  4HAX B;  1MK7 B;  1MAI A;  2J0M A;  3P6A A;  2LG1 A;  1BWN A;  2R09 A;  2YT1 A;  5C5B B;  2R0D A;  2D9Z A;  3WA0 A;  4HHV A;  1FAO A; 
#chains in the Genus database with same CATH homology
 2D9Y A;  1XR0 B;  4PQ0 A;  5HE1 A;  1FHO A;  1U2B A;  4Y94 A;  4MT7 A;  4EJN A;  4DXA B;  3O96 A;  1SGH A;  2CAY A;  4IOY X;  2P0D A;  2N0Y A;  1DYN A;  3ZDT A;  1GC6 A;  2Y8G A;  4MY6 A;  4Z2M B;  5J3Q A;  4GMV A;  4NSW A;  1UNR A;  3QWM A;  3AU5 A;  2RGN B;  3SV1 A;  1ZVR A;  3FEH A;  5DHA B;  4DX9 0;  3TFM A;  5CLQ B;  3QBV B;  4GMX B;  3ULB A;  1W1G A;  2H7E A;  4HAT B;  2KCJ A;  1Y19 B;  3PVL A;  2Q13 A;  2J0K A;  4NY0 A;  5EFX A;  4KHB B;  2ZPY A;  3MPX A;  3PEG A;  4YL8 A;  1GG3 A;  1K5G B;  2L1C A;  1WVH A;  1MK9 B;  2Z0O A;  2X18 A;  2ELA A;  1DRO A;  1U5F A;  3F0W A;  1MIX A;  2P0H A;  4L6E A;  2QKM A;  3SUZ A;  2OQB A;  1XKE A;  1V89 A;  1WGQ A;  2MWN B;  4HDQ A;  4HB0 B;  1J19 A;  4K17 A;  3QIJ A;  4ZRI A;  3U7D A;  1H4R A;  1KZG A;  5L81 A;  4WSF A;  2MFQ A;  3PZD A;  3VIA A;  1X11 A;  3SNH A;  3MDB C;  1MKE A;  4KHA A;  1X1G A;  1LW3 A;  4P7I A;  1N3H A;  2ELB A;  2YSZ A;  1U5G A;  4C0A A;  2YVC A;  2VSZ A;  1QC6 A;  1U27 A;  2YF0 A;  3T06 A;  3A8Q A;  2CRF A;  3LJU X;  3CIK A;  4HAU B;  4EKU A;  2ROZ B;  4DBB A;  1MPH A;  1FGZ A;  3DXC A;  3PVU A;  5C79 A;  5KQ1 A;  1J0W A;  1WJM A;  5JHH A;  4BBK A;  1GC7 A;  1BAK A;  3A98 B;  5JHG A;  2RLO A;  3N7C A;  1BTN A;  2E2X A;  1V5P A;  2UVM A;  2Y7B A;  2V76 A;  1NU2 A;  2I1K A;  5CLL B;  1DDW A;  2GS0 A;  1EF1 A;  2G35 A;  1FB8 A;  2MKR A;  1TQZ A;  2D9W A;  1DDM A;  1U5E A;  4Z2N A;  3ODO A;  2D10 A;  3NSU A;  3P7Z A;  3A8P A;  4A6H A;  2J0J A;  5DIF B;  2D9V A;  2DX5 A;  1FHW A;  1OY2 A;  1X1F A;  2P0F A;  2RNR B;  4D0N B;  2VRW B;  2XQN M;  1M7R A;  1NTV A;  2IYB A;  2I5C A;  3FM8 C;  1M7E A;  2ROV A;  2H7D A;  4HB4 B;  5DHF B;  3PP2 A;  2Y8F A;  4K2P A;  3TCA A;  4K81 A;  3SO6 A;  5KQ4 A;  2DKP A;  4CHJ A;  3KRW A;  3AU4 A;  1W1H A;  5C6R A;  1UPR A;  1MIZ B;  2DHJ A;  3AJ4 A;  4HAY B;  2KGX B;  1V5U A;  3PG7 A;  1TJ6 A;  2YS3 A;  5HE0 A;  1BTK A;  1WJ1 A;  3TW1 A;  2PZ1 A;  1PMS A;  1H10 A;  3DXD A;  2DKQ A;  3OAN A;  2HTH B;  2DTC A;  5HE2 A;  2M14 A;  4CHM A;  1FGY A;  1P3R A;  4KHO A;  5D3V A;  1WG7 A;  2RSG A;  2LOX A;  3FSS A;  2HE7 A;  4KAX B;  2YS5 A;  1OQN A;  4ZRK A;  1RJ2 A;  1XOD A;  1NI2 A;  4KVG B;  5JP4 A;  2J59 M;  3G9W A;  2LUL A;  1XCG A;  2UZS A;  2AEH A;  2LKO A;  2EJ8 A;  5J3Y A;  2COA A;  5D3Y A;  3IVF A;  4K2O A;  4GN1 A;  2I5F A;  4YON A;  1IRS A;  2NMB A;  3ZVR A;  2KUP A;  2DLW A;  1Q67 A;  1W1D A;  2OTX A;  2GCL A;  2LOZ A;  2MDX A;  1ZC4 B;  2Z0Q A;  1XX0 A;  3HW2 B;  4GPT B;  1OMW A;  2DYN A;  5HE3 A;  5D3X A;  4TYZ A;  1EGX A;  2K2J A;  4HAV B;  5LOP B;  3D8D A;  2CY4 A;  2FJL A;  2Z0P A;  1WI1 A;  2W2X C;  2YT0 A;  3U8Z A;  2JP2 A;  3PSC A;  3TVV A;  4HAW B;  2L2I A;  1UEF A;  4A6F A;  5GOW B;  1KZ7 A;  3M1I B;  2ADZ A;  2BCJ A;  2EMT A;  1Y5O A;  2D9X A;  1PFJ A;  2COF A;  1ZSQ A;  1UNP A;  1ZM0 A;  2W2W A;  2DYQ A;  3CXB B;  2AL6 A;  1SHC A;  2DFK A;  5FI0 A;  2VKI A;  3TO1 A;  2YS1 A;  3KSY A;  4F7U P;  3ML4 A;  3D8E A;  3HK0 A;  4TKN A;  3DXE A;  2K00 A;  2P8V A;  2EC1 A;  1K5D B;  4IFS A;  4EMO A;  4HAZ B;  3SYX A;  1X05 A;  3GYO A;  4HB2 B;  3KRX A;  4DX8 A;  1LB1 A;  1U5D A;  3WYF B;  1UPQ A;  1FOE A;  4WVF B;  4GZU A;  1V61 A;  1EVH A;  1ZC3 B;  2DA0 A;  2QKL A;  1TXD A;  2D2Q A;  3RCP A;  2IFS A;  3ODX A;  1FHX A;  2DHK A;  3V5W A;  2GCJ A;  5D3W A;  4F7G A;  2EMS A;  2CY5 A;  1X86 A;  3BIN A;  3PVW A;  5C16 A;  5DI9 B;  3BJI A;  4GXB A;  4IAP A;  2LYD A;  5D27 A;  1P6S A;  4A6F B;  2N23 A;  1V88 A;  2YRY A;  2W2X D;  4A6K A;  3KZ1 A;  3ODW A;  1AQC A;  5C5B A;  2D4Q A;  3ULC A;  4ZRJ A;  1U29 A;  4A5K A;  2K2U A;  2UZR A;  2DN6 A;  2RVB B;  1NTY A;  4B6H A;  3D8F A;  1RRP B;  3KY9 A;  1B55 A;  1XD4 A;  4MK0 A;  5LON B;  2COC A;  3VOQ A;  2GJY A;  5JLJ B;  1WGU A;  1PLS A;  4HB3 B;  1QQG A;  1UNQ A;  1KI1 B;  1EAZ A;  4HDO A;  4XWX A;  4PNK A;  3F5R A;  3UZT A;  2D11 A;  5DH9 B;  2DHI A;  4F7H A;  3GYP A;  1DDV A;  1I7A A;  1Z87 A;  1I2H A;  1AWE A;  5FI1 A;  3X23 A;  2M38 A;  4CYE A;  1P5T A;  3HQC A;  5J3T A;  1E5W A;  2NZ8 B;  1DBH A;  2I1J A;  1ISN A;  2COD A;  5KCV A;  1V5M A;  2DX1 A;  4H8S A;  4WJ7 A;  2RUK B;  4HAX B;  1MK7 B;  1MAI A;  2J0M A;  3P6A A;  2LG1 A;  1BWN A;  2R09 A;  2YT1 A;  5C5B B;  2R0D A;  2D9Z A;  3WA0 A;  4HHV A;  1FAO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...