3SO6A

Crystal structure of the ldl receptor tail in complex with autosomal recessive hypercholesterolemia ptb domain
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
137
structure length
137
Chain Sequence
MEGMVFSLKYLGMTLVERPKGEELSAAAVKRIVATAKASGKKLQKVTLKVSPRGIILTDSLTSQLIENVSIYRISYCTADKMHDKVFAYIAQSQQNESLECHAFLCTKRKVAQAVTLTVAQAFKVAFEFWQVSLVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Atomic structure of the autosomal recessive hypercholesterolemia phosphotyrosine-binding domain in complex with the LDL-receptor tail.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Protein binding/protein transport
molecule keywords LDL receptor adaptor protein
total genus 39
structure length 137
sequence length 137
ec nomenclature
pdb deposition date 2011-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00640 PID Phosphotyrosine interaction domain (PTB/PID)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3so6A00
4ZRIA 4A5KA 1FHWA 1SHCA 2W2WA 2LKOA 1TQZA 1MAIA 1UNQA 4DX8A 5C79A 1UEFA 4HB2B 1DDMA 4KHBB 2Y8FA 2EMSA 1V61A 3X23A 1X1GA 3AJ4A 5DHFB 1WJ1A 1UNPA 2EMTA 2DHJA 2K2UA 1NTVA 3MDBC 4HAXB 2D9WA 2I1KA 2QKLA 1X1FA 5HE2A 2N0YA 2KUPA 4HAUB 2D9ZA 3BINA 2D10A 4F7HA 2COAA 3CIKA 3F5RA 1W1HA 4ZRKA 1ZC4B 1Q67A 1MKEA 2DX1A 1NI2A 2OQBA 1LW3A 4GN1A 4Y94A 3QIJA 2RGNB 4HAZB 1OMWA 4WSFA 3ODXA 4BBKA 4GMVA 4GXBA 2COCA 5DH9B 1TJ6A 2FJLA 4PQ0A 2LOZA 3NSUA 2I5FA 1N3HA 2YS3A 2DLWA 5JP4A 3A98B 3O96A 1V5PA 1V5UA 1ZC3B 2OTXA 2Y7BA 2LYDA 2D9YA 1H4RA 2YT1A 5DI9B 5KCVA 2P0FA 5CLQB 2R09A 2UZSA 1P6SA 4KVGB 4CHMA 2UZRA 5FI0A 3M1IB 3KSYA 4KAXB 1BTKA 2NZ8B 2P8VA 3DXDA 2LG1A 4ZRJA 4F7UP 2Z0QA 1PLSA 4L6EA 5D3YA 4TYZA 1DDVA 1AWEA 3KRWA 2GJYA 2K2JA 2J0JA 3ML4A 2MWNB 1X11A 4PNKA 3KY9A 2I1JA 2L1CA 3A8PA 1K5GB 2ROZB 4WVFB 1WJMA 1MIXA 4GMXB 1I2HA 3D8FA 1DDWA 1K5DB 4YL8A 1WG7A 1M7EA 2H7DA 2NMBA 2YS5A 1KZ7A 2ZPYA 2COFA 1DBHA 2GCJA 3AU4A 1MPHA 1WI1A 3KRXA 1OQNA 2M14A 1ZSQA 2E2XA 1Y5OA 3AU5A 3SO6A 2YS1A 2LOXA 2D9XA 4MT7A 2N23A 1Z87A 3TW1A 5KQ4A 2HE7A 3PVLA 2ELAA 4KHAA 1P3RA 2Z0OA 3WA0A 1NTYA 2CRFA 5GOWB 1FOEA 1KZGA 3P7ZA 3VOQA 1X05A 2V76A 3SUZA 1MIZB 2I5CA 3TCAA 2ELBA 4NSWA 3OANA 3DXEA 5D3WA 5JHGA 3HQCA 1XD4A 1EVHA 5J3QA 2P0HA 5C5BB 3SV1A 1GG3A 1WVHA 1U29A 2YSZA 4F7GA 5J3YA 5C6RA 3ZDTA 3BJIA 2ROVA 3PVWA 3ZVRA 2RNRB 3CXBB 3U7DA 3U8ZA 5LOPB 1RRPB 1ZVRA 2G35A 1ZM0A 1H10A 4MK0A 2EC1A 2YT0A 4C0AA 1M7RA 3FM8C 4HAVB 2DX5A 1UNRA 2MDXA 5LONB 5FI1A 1FHOA 1WGUA 1V88A 1DROA 1XR0B 2D2QA 2D9VA 2D11A 2PZ1A 1QQGA 5C5BA 1BWNA 2GCLA 4TKNA 2DYQA 5JLJB 2VRWB 3PSCA 3FEHA 1P5TA 4HAWB 1IRSA 2MKRA 1PMSA 2IYBA 1V5MA 1RJ2A 1U5GA 5L81A 2CY4A 3MPXA 1FGYA 1FHXA 2H7EA 4HAYB 2AEHA 1U2BA 3ULCA 2EJ8A 3ODWA 3P6AA 1X86A 1AQCA 4CHJA 1U5DA 4HATB 1FAOA 2LULA 4XWXA 2W2XC 1I7AA 2CODA 3GYPA 2JP2A 4CYEA 2DN6A 2M38A 4HB0B 1W1GA 2QKMA 5HE1A 1V89A 1PFJA 5EFXA 2Y8GA 4HDQA 2DHKA 1OY2A 2L2IA 2W2XD 2R0DA 4HB3B 2DYNA 2YVCA 2D4QA 3PVUA 3D8DA 1E5WA 2J0MA 1J19A 2KCJA 2GS0A 3G9WA 4IFSA 2CAYA 4EMOA 1XCGA 3QWMA 2DFKA 2AL6A 3VIAA 1LB1A 2MFQA 4DX90 1XKEA 3WYFB 1U27A 1MK9B 1ISNA 1BTNA 1W1DA 4K17A 3QBVB 4HB4B 5D3XA 4HDOA 4A6FA 5D27A 2VSZA 1B55A 1TXDA 3GYOA 5C16A 4IAPA 4H8SA 5JHHA 2P0DA 4MY6A 4KHOA 3PP2A 2RSGA 2DKPA 2Q13A 1WGQA 4HHVA 3ODOA 1UPRA 3SNHA 4K2PA 1UPQA 3F0WA 3A8QA 2YRYA 3KZ1A 2DTCA 1EGXA 1MK7B 2DKQA 4EKUA 2YF0A 2ADZA 5CLLB 3T06A 4A6KA 4DBBA 5DHAB 4K2OA 2J59M 1GC6A 5KQ1A 4DXAB 4P7IA 4GPTB 4GZUA 1GC7A 2Z0PA 4A6HA 4EJNA 3N7CA 3TVVA 5HE0A 4K81A 3IVFA 2CY5A 1FGZA 1XX0A 5J3TA 1DYNA 3HK0A 3PEGA 1KI1B 2VKIA 3PG7A 2DHIA 1BAKA 3UZTA 1NU2A 2KGXB 3SYXA 3DXCA 1U5EA 1XODA 4WJ7A 3D8EA 2IFSA 2UVMA 3V5WA 3PZDA 1SGHA 2RVBB 2DA0A 1J0WA 4IOYX 2J0KA 4YONA 3LJUX 2HTHB 2RUKB 3TFMA 1Y19B 3ULBA 2X18A 2XQNM 4A6FB 1EF1A 4NY0A 5DIFB 1FB8A 3HW2B 3FSSA 3RCPA 4B6HA 1EAZA 2K00A 2RLOA 4Z2NA 4D0NB 3TO1A 4Z2MB 5D3VA 5HE3A 2BCJA 1U5FA 1QC6A
chains in the Genus database with same CATH superfamily
3U12A 4ZRIA 4A5KA 1FHWA 1MI1A 1SHCA 2W2WA 2LKOA 4HSIA 1TQZA 1MAIA 1UNQA 4DX8A 5C79A 1UEFA 4HB2B 1DDMA 4KHBB 2Y8FA 2EMSA 1V61A 3X23A 1X1GA 3AJ4A 5DHFB 1WJ1A 1UNPA 2EMTA 2DHJA 2K2UA 1NTVA 3NWFA 3MDBC 4HAXB 2D9WA 2I1KA 2QKLA 1X1FA 5HE2A 2N0YA 2KUPA 4HAUB 2D9ZA 3BINA 2D10A 4F7HA 2COAA 3CIKA 3F5RA 1W1HA 2K8EA 4ZRKA 1ZC4B 4QJ4B 1Q67A 1MKEA 2DX1A 1NI2A 2OQBA 1LW3A 4GN1A 4Y94A 2KIEA 3QIJA 2RGNB 4HAZB 1OMWA 4WSFA 3ODXA 4BBKA 4GMVA 4GXBA 2COCA 5DH9B 1TJ6A 2FJLA 4PQ0A 2LOZA 3A58A 3NSUA 2I5FA 1N3HA 2YS3A 2DLWA 5JP4A 3A98B 3O96A 1V5PA 1V5UA 1ZC3B 2OTXA 2Y7BA 2LYDA 2D9YA 1H4RA 2YT1A 5DI9B 5KCVA 2P0FA 4CSQA 5CLQB 2R09A 2UZSA 1P6SA 4KVGB 4CHMA 2UZRA 5FI0A 3M1IB 3OHMB 3KSYA 4KAXB 1BTKA 2NZ8B 2P8VA 3DXDA 4QJ3B 2LG1A 4ZRJA 2Z13A 2Z14A 2Z0QA 1PLSA 4L6EA 5D3YA 4TYZA 4F7UP 1DDVA 1AWEA 3KRWA 2GJYA 2K2JA 2J0JA 3ML4A 2MWNB 1X11A 4PNKA 3KY9A 2I1JA 2L1CA 3A8PA 1K5GB 2ROZB 4WVFB 1WJMA 1MIXA 4GMXB 1I2HA 3D8FA 1DDWA 1K5DB 4YL8A 1WG7A 1M7EA 2H7DA 2NMBA 2YS5A 1KZ7A 3NW8A 2ZPYA 2COFA 1DBHA 2GCJA 3AU4A 1MPHA 1WI1A 3KRXA 1T77A 1OQNA 2M14A 4D6WA 1ZSQA 2E2XA 1Y5OA 3AU5A 3SO6A 2YS1A 2Z59A 2LOXA 2D9XA 4MT7A 2N23A 1Z87A 3TW1A 5KQ4A 2HE7A 3PVLA 2ELAA 4KHAA 1P3RA 2Z0OA 3WA0A 1NTYA 2CRFA 5GOWB 1FOEA 1KZGA 3P7ZA 3VOQA 1X05A 2V76A 3SUZA 1MIZB 2I5CA 3TCAA 2ELBA 4NSWA 2NBVA 3OANA 3DXEA 5D3WA 5JHGA 3HQCA 1XD4A 1EVHA 5J3QA 2P0HA 3NWAA 5C5BB 3SV1A 1GG3A 1WVHA 1U29A 2YSZA 4F7GA 5J3YA 5C6RA 3ZDTA 3BJIA 2ROVA 3PVWA 3ZVRA 2RNRB 3CXBB 3U7DA 3U8ZA 5LOPB 4L1RA 1RRPB 1ZVRA 5IRSA 2G35A 1ZM0A 1H10A 4MK0A 2EC1A 2YT0A 2ZKMX 4C0AA 1M7RA 3FM8C 4HAVB 2DX5A 1UNRA 2MDXA 5LONB 5FI1A 1FHOA 1WGUA 1V88A 1DROA 1XR0B 2D2QA 2D9VA 2D11A 2PZ1A 1QQGA 5C5BA 1BWNA 2GCLA 4TKNA 2DYQA 5JLJB 2VRWB 3PSCA 2R2YA 3FEHA 1P5TA 4HAWB 1IRSA 2MKRA 3DCXA 1PMSA 2IYBA 1V5MA 1RJ2A 1U5GA 5L81A 2CY4A 3MPXA 1FGYA 1FHXA 2H7EA 4HAYB 2AEHA 1U2BA 3ULCA 2EJ8A 3ODWA 3P6AA 3HSAA 1X86A 1AQCA 4CHJA 1U5DA 4HATB 3HIEA 1FAOA 2LULA 4XWXA 2W2XC 1I7AA 2CODA 3GYPA 2JP2A 4CYEA 2DN6A 2M38A 4HB0B 1W1GA 2QKMA 4GNKB 5HE1A 1V89A 1PFJA 5EFXA 2Y8GA 4HDQA 2DHKA 1OY2A 2L2IA 2W2XD 2R0DA 4HB3B 2DYNA 2FJUB 2YVCA 2D4QA 3PVUA 4QJ5B 3D8DA 1E5WA 2J0MA 1J19A 2KCJA 1ZYIA 2GS0A 3G9WA 4IFSA 2CAYA 4EMOA 1XCGA 4GOUA 2K49A 3QWMA 2DFKA 5LG4B 2AL6A 3VIAA 1LB1A 2MFQA 4DX90 1XKEA 3WYFB 1U27A 2KUQA 1MK9B 1ISNA 1BTNA 1W1DA 4K17A 3QBVB 4HB4B 5D3XA 4HDOA 4A6FA 5D27A 2VSZA 1B55A 1TXDA 3GYOA 5C16A 4IAPA 4OT1A 4H8SA 5JHHA 2P0DA 4MY6A 4KHOA 3PP2A 2RSGA 2DKPA 2Q13A 1WGQA 4HHVA 3ODOA 1UPRA 3B77A 3SNHA 4K2PA 1UPQA 3F0WA 3A8QA 2YRYA 3KZ1A 2DTCA 2Z4DA 1EGXA 1MK7B 2DKQA 4EKUA 2YF0A 2ADZA 5CLLB 5I2SA 3T06A 4A6KA 4DBBA 5DHAB 4K2OA 2J59M 1GC6A 5KQ1A 2YT2A 4DXAB 4P7IA 4GPTB 4GZUA 1GC7A 2Z0PA 4A6HA 4EJNA 3N7CA 3TVVA 5HE0A 4K81A 3IVFA 2CY5A 3NWDA 4QXAB 1FGZA 1XX0A 5J3TA 1DYNA 3HK0A 3PEGA 5I2MA 4KHBA 1KI1B 4OSNA 2KIGA 2VKIA 4DIXA 3PG7A 2DHIA 1BAKA 2KR0A 3UZTA 1NU2A 2KGXB 3SYXA 3DXCA 1U5EA 1XODA 3FVCA 4WJ7A 3D8EA 2IFSA 2UVMA 3V5WA 3PZDA 1SGHA 2RVBB 2GUMA 2DA0A 1J0WA 4IOYX 2J0KA 4YONA 3LJUX 2RRFA 2HTHB 2RUKB 3TFMA 1Y19B 3ULBA 2X18A 2XQNM 4A6FB 1EF1A 5M4YB 4NY0A 5DIFB 1FB8A 3HW2B 3FSSA 3RCPA 4B6HA 1EAZA 2K00A 2RLOA 4Z2NA 4D0NB 3TO1A 4Z2MB 5D3VA 5HE3A 2BCJA 1U5FA 1QC6A
chains in the Genus database with same CATH topology
4ZRIA 4A5KA 1FHWA 1SHCA 2W2WA 2LKOA 1TQZA 1MAIA 1UNQA 4DX8A 5C79A 1UEFA 4HB2B 1DDMA 4KHBB 2Y8FA 2EMSA 1V61A 3X23A 1X1GA 3AJ4A 5DHFB 1WJ1A 1UNPA 2EMTA 2DHJA 2K2UA 1NTVA 3MDBC 4HAXB 2D9WA 2I1KA 2QKLA 1X1FA 5HE2A 2N0YA 2KUPA 4HAUB 2D9ZA 3BINA 2D10A 4F7HA 2COAA 3CIKA 3F5RA 1W1HA 4ZRKA 1ZC4B 1Q67A 1MKEA 2DX1A 1NI2A 2OQBA 1LW3A 4GN1A 4Y94A 3QIJA 2RGNB 4HAZB 1OMWA 4WSFA 3ODXA 4BBKA 4GMVA 4GXBA 2COCA 5DH9B 1TJ6A 2FJLA 4PQ0A 2LOZA 3NSUA 2I5FA 1N3HA 2YS3A 2DLWA 5JP4A 3A98B 3O96A 1V5PA 1V5UA 1ZC3B 2OTXA 2Y7BA 2LYDA 2D9YA 1H4RA 2YT1A 5DI9B 5KCVA 2P0FA 5CLQB 2R09A 2UZSA 1P6SA 4KVGB 4CHMA 2UZRA 5FI0A 3M1IB 3KSYA 4KAXB 1BTKA 2NZ8B 2P8VA 3DXDA 2LG1A 4ZRJA 4F7UP 2Z0QA 1PLSA 4L6EA 5D3YA 4TYZA 1DDVA 1AWEA 3KRWA 2GJYA 2K2JA 2J0JA 3ML4A 2MWNB 1X11A 4PNKA 3KY9A 2I1JA 2L1CA 3A8PA 1K5GB 2ROZB 4WVFB 1WJMA 1MIXA 4GMXB 1I2HA 3D8FA 1DDWA 1K5DB 4YL8A 1WG7A 1M7EA 2H7DA 2NMBA 2YS5A 1KZ7A 2ZPYA 2COFA 1DBHA 2GCJA 3AU4A 1MPHA 1WI1A 3KRXA 1OQNA 2M14A 1ZSQA 2E2XA 1Y5OA 3AU5A 3SO6A 2YS1A 2LOXA 2D9XA 4MT7A 2N23A 1Z87A 3TW1A 5KQ4A 2HE7A 3PVLA 2ELAA 4KHAA 1P3RA 2Z0OA 3WA0A 1NTYA 2CRFA 5GOWB 1FOEA 1KZGA 3P7ZA 3VOQA 1X05A 2V76A 3SUZA 1MIZB 2I5CA 3TCAA 2ELBA 4NSWA 3OANA 3DXEA 5D3WA 5JHGA 3HQCA 1XD4A 1EVHA 5J3QA 2P0HA 5C5BB 3SV1A 1GG3A 1WVHA 1U29A 2YSZA 4F7GA 5J3YA 5C6RA 3ZDTA 3BJIA 2ROVA 3PVWA 3ZVRA 2RNRB 3CXBB 3U7DA 3U8ZA 5LOPB 1RRPB 1ZVRA 2G35A 1ZM0A 1H10A 4MK0A 2EC1A 2YT0A 4C0AA 1M7RA 3FM8C 4HAVB 2DX5A 1UNRA 2MDXA 5LONB 5FI1A 1FHOA 1WGUA 1V88A 1DROA 1XR0B 2D2QA 2D9VA 2D11A 2PZ1A 1QQGA 5C5BA 1BWNA 2GCLA 4TKNA 2DYQA 5JLJB 2VRWB 3PSCA 3FEHA 1P5TA 4HAWB 1IRSA 2MKRA 1PMSA 2IYBA 1V5MA 1RJ2A 1U5GA 5L81A 2CY4A 3MPXA 1FGYA 1FHXA 2H7EA 4HAYB 2AEHA 1U2BA 3ULCA 2EJ8A 3ODWA 3P6AA 1X86A 1AQCA 4CHJA 1U5DA 4HATB 1FAOA 2LULA 4XWXA 2W2XC 1I7AA 2CODA 3GYPA 2JP2A 4CYEA 2DN6A 2M38A 4HB0B 1W1GA 2QKMA 5HE1A 1V89A 1PFJA 5EFXA 2Y8GA 4HDQA 2DHKA 1OY2A 2L2IA 2W2XD 2R0DA 4HB3B 2DYNA 2YVCA 2D4QA 3PVUA 3D8DA 1E5WA 2J0MA 1J19A 2KCJA 2GS0A 3G9WA 4IFSA 2CAYA 4EMOA 1XCGA 3QWMA 2DFKA 2AL6A 3VIAA 1LB1A 2MFQA 4DX90 1XKEA 3WYFB 1U27A 1MK9B 1ISNA 1BTNA 1W1DA 4K17A 3QBVB 4HB4B 5D3XA 4HDOA 4A6FA 5D27A 2VSZA 1B55A 1TXDA 3GYOA 5C16A 4IAPA 4H8SA 5JHHA 2P0DA 4MY6A 4KHOA 3PP2A 2RSGA 2DKPA 2Q13A 1WGQA 4HHVA 3ODOA 1UPRA 3SNHA 4K2PA 1UPQA 3F0WA 3A8QA 2YRYA 3KZ1A 2DTCA 1EGXA 1MK7B 2DKQA 4EKUA 2YF0A 2ADZA 5CLLB 3T06A 4A6KA 4DBBA 5DHAB 4K2OA 2J59M 1GC6A 5KQ1A 4DXAB 4P7IA 4GPTB 4GZUA 1GC7A 2Z0PA 4A6HA 4EJNA 3N7CA 3TVVA 5HE0A 4K81A 3IVFA 2CY5A 1FGZA 1XX0A 5J3TA 1DYNA 3HK0A 3PEGA 1KI1B 2VKIA 3PG7A 2DHIA 1BAKA 3UZTA 1NU2A 2KGXB 3SYXA 3DXCA 1U5EA 1XODA 4WJ7A 3D8EA 2IFSA 2UVMA 3V5WA 3PZDA 1SGHA 2RVBB 2DA0A 1J0WA 4IOYX 2J0KA 4YONA 3LJUX 2HTHB 2RUKB 3TFMA 1Y19B 3ULBA 2X18A 2XQNM 4A6FB 1EF1A 4NY0A 5DIFB 1FB8A 3HW2B 3FSSA 3RCPA 4B6HA 1EAZA 2K00A 2RLOA 4Z2NA 4D0NB 3TO1A 4Z2MB 5D3VA 5HE3A 2BCJA 1U5FA 1QC6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZRI A;  4A5K A;  1FHW A;  1SHC A;  2W2W A;  2LKO A;  1TQZ A;  1MAI A;  1UNQ A;  4DX8 A;  5C79 A;  1UEF A;  4HB2 B;  1DDM A;  4KHB B;  2Y8F A;  2EMS A;  1V61 A;  3X23 A;  1X1G A;  3AJ4 A;  5DHF B;  1WJ1 A;  1UNP A;  2EMT A;  2DHJ A;  2K2U A;  1NTV A;  3MDB C;  4HAX B;  2D9W A;  2I1K A;  2QKL A;  1X1F A;  5HE2 A;  2N0Y A;  2KUP A;  4HAU B;  2D9Z A;  3BIN A;  2D10 A;  4F7H A;  2COA A;  3CIK A;  3F5R A;  1W1H A;  4ZRK A;  1ZC4 B;  1Q67 A;  1MKE A;  2DX1 A;  1NI2 A;  2OQB A;  1LW3 A;  4GN1 A;  4Y94 A;  3QIJ A;  2RGN B;  4HAZ B;  1OMW A;  4WSF A;  3ODX A;  4BBK A;  4GMV A;  4GXB A;  2COC A;  5DH9 B;  1TJ6 A;  2FJL A;  4PQ0 A;  2LOZ A;  3NSU A;  2I5F A;  1N3H A;  2YS3 A;  2DLW A;  5JP4 A;  3A98 B;  3O96 A;  1V5P A;  1V5U A;  1ZC3 B;  2OTX A;  2Y7B A;  2LYD A;  2D9Y A;  1H4R A;  2YT1 A;  5DI9 B;  5KCV A;  2P0F A;  5CLQ B;  2R09 A;  2UZS A;  1P6S A;  4KVG B;  4CHM A;  2UZR A;  5FI0 A;  3M1I B;  3KSY A;  4KAX B;  1BTK A;  2NZ8 B;  2P8V A;  3DXD A;  2LG1 A;  4ZRJ A;  4F7U P;  2Z0Q A;  1PLS A;  4L6E A;  5D3Y A;  4TYZ A;  1DDV A;  1AWE A;  3KRW A;  2GJY A;  2K2J A;  2J0J A;  3ML4 A;  2MWN B;  1X11 A;  4PNK A;  3KY9 A;  2I1J A;  2L1C A;  3A8P A;  1K5G B;  2ROZ B;  4WVF B;  1WJM A;  1MIX A;  4GMX B;  1I2H A;  3D8F A;  1DDW A;  1K5D B;  4YL8 A;  1WG7 A;  1M7E A;  2H7D A;  2NMB A;  2YS5 A;  1KZ7 A;  2ZPY A;  2COF A;  1DBH A;  2GCJ A;  3AU4 A;  1MPH A;  1WI1 A;  3KRX A;  1OQN A;  2M14 A;  1ZSQ A;  2E2X A;  1Y5O A;  3AU5 A;  3SO6 A;  2YS1 A;  2LOX A;  2D9X A;  4MT7 A;  2N23 A;  1Z87 A;  3TW1 A;  5KQ4 A;  2HE7 A;  3PVL A;  2ELA A;  4KHA A;  1P3R A;  2Z0O A;  3WA0 A;  1NTY A;  2CRF A;  5GOW B;  1FOE A;  1KZG A;  3P7Z A;  3VOQ A;  1X05 A;  2V76 A;  3SUZ A;  1MIZ B;  2I5C A;  3TCA A;  2ELB A;  4NSW A;  3OAN A;  3DXE A;  5D3W A;  5JHG A;  3HQC A;  1XD4 A;  1EVH A;  5J3Q A;  2P0H A;  5C5B B;  3SV1 A;  1GG3 A;  1WVH A;  1U29 A;  2YSZ A;  4F7G A;  5J3Y A;  5C6R A;  3ZDT A;  3BJI A;  2ROV A;  3PVW A;  3ZVR A;  2RNR B;  3CXB B;  3U7D A;  3U8Z A;  5LOP B;  1RRP B;  1ZVR A;  2G35 A;  1ZM0 A;  1H10 A;  4MK0 A;  2EC1 A;  2YT0 A;  4C0A A;  1M7R A;  3FM8 C;  4HAV B;  2DX5 A;  1UNR A;  2MDX A;  5LON B;  5FI1 A;  1FHO A;  1WGU A;  1V88 A;  1DRO A;  1XR0 B;  2D2Q A;  2D9V A;  2D11 A;  2PZ1 A;  1QQG A;  5C5B A;  1BWN A;  2GCL A;  4TKN A;  2DYQ A;  5JLJ B;  2VRW B;  3PSC A;  3FEH A;  1P5T A;  4HAW B;  1IRS A;  2MKR A;  1PMS A;  2IYB A;  1V5M A;  1RJ2 A;  1U5G A;  5L81 A;  2CY4 A;  3MPX A;  1FGY A;  1FHX A;  2H7E A;  4HAY B;  2AEH A;  1U2B A;  3ULC A;  2EJ8 A;  3ODW A;  3P6A A;  1X86 A;  1AQC A;  4CHJ A;  1U5D A;  4HAT B;  1FAO A;  2LUL A;  4XWX A;  2W2X C;  1I7A A;  2COD A;  3GYP A;  2JP2 A;  4CYE A;  2DN6 A;  2M38 A;  4HB0 B;  1W1G A;  2QKM A;  5HE1 A;  1V89 A;  1PFJ A;  5EFX A;  2Y8G A;  4HDQ A;  2DHK A;  1OY2 A;  2L2I A;  2W2X D;  2R0D A;  4HB3 B;  2DYN A;  2YVC A;  2D4Q A;  3PVU A;  3D8D A;  1E5W A;  2J0M A;  1J19 A;  2KCJ A;  2GS0 A;  3G9W A;  4IFS A;  2CAY A;  4EMO A;  1XCG A;  3QWM A;  2DFK A;  2AL6 A;  3VIA A;  1LB1 A;  2MFQ A;  4DX9 0;  1XKE A;  3WYF B;  1U27 A;  1MK9 B;  1ISN A;  1BTN A;  1W1D A;  4K17 A;  3QBV B;  4HB4 B;  5D3X A;  4HDO A;  4A6F A;  5D27 A;  2VSZ A;  1B55 A;  1TXD A;  3GYO A;  5C16 A;  4IAP A;  4H8S A;  5JHH A;  2P0D A;  4MY6 A;  4KHO A;  3PP2 A;  2RSG A;  2DKP A;  2Q13 A;  1WGQ A;  4HHV A;  3ODO A;  1UPR A;  3SNH A;  4K2P A;  1UPQ A;  3F0W A;  3A8Q A;  2YRY A;  3KZ1 A;  2DTC A;  1EGX A;  1MK7 B;  2DKQ A;  4EKU A;  2YF0 A;  2ADZ A;  5CLL B;  3T06 A;  4A6K A;  4DBB A;  5DHA B;  4K2O A;  2J59 M;  1GC6 A;  5KQ1 A;  4DXA B;  4P7I A;  4GPT B;  4GZU A;  1GC7 A;  2Z0P A;  4A6H A;  4EJN A;  3N7C A;  3TVV A;  5HE0 A;  4K81 A;  3IVF A;  2CY5 A;  1FGZ A;  1XX0 A;  5J3T A;  1DYN A;  3HK0 A;  3PEG A;  1KI1 B;  2VKI A;  3PG7 A;  2DHI A;  1BAK A;  3UZT A;  1NU2 A;  2KGX B;  3SYX A;  3DXC A;  1U5E A;  1XOD A;  4WJ7 A;  3D8E A;  2IFS A;  2UVM A;  3V5W A;  3PZD A;  1SGH A;  2RVB B;  2DA0 A;  1J0W A;  4IOY X;  2J0K A;  4YON A;  3LJU X;  2HTH B;  2RUK B;  3TFM A;  1Y19 B;  3ULB A;  2X18 A;  2XQN M;  4A6F B;  1EF1 A;  4NY0 A;  5DIF B;  1FB8 A;  3HW2 B;  3FSS A;  3RCP A;  4B6H A;  1EAZ A;  2K00 A;  2RLO A;  4Z2N A;  4D0N B;  3TO1 A;  4Z2M B;  5D3V A;  5HE3 A;  2BCJ A;  1U5F A;  1QC6 A; 
#chains in the Genus database with same CATH topology
 3U12 A;  4ZRI A;  4A5K A;  1FHW A;  1MI1 A;  1SHC A;  2W2W A;  2LKO A;  4HSI A;  1TQZ A;  1MAI A;  1UNQ A;  4DX8 A;  5C79 A;  1UEF A;  4HB2 B;  1DDM A;  4KHB B;  2Y8F A;  2EMS A;  1V61 A;  3X23 A;  1X1G A;  3AJ4 A;  5DHF B;  1WJ1 A;  1UNP A;  2EMT A;  2DHJ A;  2K2U A;  1NTV A;  3NWF A;  3MDB C;  4HAX B;  2D9W A;  2I1K A;  2QKL A;  1X1F A;  5HE2 A;  2N0Y A;  2KUP A;  4HAU B;  2D9Z A;  3BIN A;  2D10 A;  4F7H A;  2COA A;  3CIK A;  3F5R A;  1W1H A;  2K8E A;  4ZRK A;  1ZC4 B;  4QJ4 B;  1Q67 A;  1MKE A;  2DX1 A;  1NI2 A;  2OQB A;  1LW3 A;  4GN1 A;  4Y94 A;  2KIE A;  3QIJ A;  2RGN B;  4HAZ B;  1OMW A;  4WSF A;  3ODX A;  4BBK A;  4GMV A;  4GXB A;  2COC A;  5DH9 B;  1TJ6 A;  2FJL A;  4PQ0 A;  2LOZ A;  3A58 A;  3NSU A;  2I5F A;  1N3H A;  2YS3 A;  2DLW A;  5JP4 A;  3A98 B;  3O96 A;  1V5P A;  1V5U A;  1ZC3 B;  2OTX A;  2Y7B A;  2LYD A;  2D9Y A;  1H4R A;  2YT1 A;  5DI9 B;  5KCV A;  2P0F A;  4CSQ A;  5CLQ B;  2R09 A;  2UZS A;  1P6S A;  4KVG B;  4CHM A;  2UZR A;  5FI0 A;  3M1I B;  3OHM B;  3KSY A;  4KAX B;  1BTK A;  2NZ8 B;  2P8V A;  3DXD A;  4QJ3 B;  2LG1 A;  4ZRJ A;  2Z13 A;  2Z14 A;  2Z0Q A;  1PLS A;  4L6E A;  5D3Y A;  4TYZ A;  4F7U P;  1DDV A;  1AWE A;  3KRW A;  2GJY A;  2K2J A;  2J0J A;  3ML4 A;  2MWN B;  1X11 A;  4PNK A;  3KY9 A;  2I1J A;  2L1C A;  3A8P A;  1K5G B;  2ROZ B;  4WVF B;  1WJM A;  1MIX A;  4GMX B;  1I2H A;  3D8F A;  1DDW A;  1K5D B;  4YL8 A;  1WG7 A;  1M7E A;  2H7D A;  2NMB A;  2YS5 A;  1KZ7 A;  3NW8 A;  2ZPY A;  2COF A;  1DBH A;  2GCJ A;  3AU4 A;  1MPH A;  1WI1 A;  3KRX A;  1T77 A;  1OQN A;  2M14 A;  4D6W A;  1ZSQ A;  2E2X A;  1Y5O A;  3AU5 A;  3SO6 A;  2YS1 A;  2Z59 A;  2LOX A;  2D9X A;  4MT7 A;  2N23 A;  1Z87 A;  3TW1 A;  5KQ4 A;  2HE7 A;  3PVL A;  2ELA A;  4KHA A;  1P3R A;  2Z0O A;  3WA0 A;  1NTY A;  2CRF A;  5GOW B;  1FOE A;  1KZG A;  3P7Z A;  3VOQ A;  1X05 A;  2V76 A;  3SUZ A;  1MIZ B;  2I5C A;  3TCA A;  2ELB A;  4NSW A;  2NBV A;  3OAN A;  3DXE A;  5D3W A;  5JHG A;  3HQC A;  1XD4 A;  1EVH A;  5J3Q A;  2P0H A;  3NWA A;  5C5B B;  3SV1 A;  1GG3 A;  1WVH A;  1U29 A;  2YSZ A;  4F7G A;  5J3Y A;  5C6R A;  3ZDT A;  3BJI A;  2ROV A;  3PVW A;  3ZVR A;  2RNR B;  3CXB B;  3U7D A;  3U8Z A;  5LOP B;  4L1R A;  1RRP B;  1ZVR A;  5IRS A;  2G35 A;  1ZM0 A;  1H10 A;  4MK0 A;  2EC1 A;  2YT0 A;  2ZKM X;  4C0A A;  1M7R A;  3FM8 C;  4HAV B;  2DX5 A;  1UNR A;  2MDX A;  5LON B;  5FI1 A;  1FHO A;  1WGU A;  1V88 A;  1DRO A;  1XR0 B;  2D2Q A;  2D9V A;  2D11 A;  2PZ1 A;  1QQG A;  5C5B A;  1BWN A;  2GCL A;  4TKN A;  2DYQ A;  5JLJ B;  2VRW B;  3PSC A;  2R2Y A;  3FEH A;  1P5T A;  4HAW B;  1IRS A;  2MKR A;  3DCX A;  1PMS A;  2IYB A;  1V5M A;  1RJ2 A;  1U5G A;  5L81 A;  2CY4 A;  3MPX A;  1FGY A;  1FHX A;  2H7E A;  4HAY B;  2AEH A;  1U2B A;  3ULC A;  2EJ8 A;  3ODW A;  3P6A A;  3HSA A;  1X86 A;  1AQC A;  4CHJ A;  1U5D A;  4HAT B;  3HIE A;  1FAO A;  2LUL A;  4XWX A;  2W2X C;  1I7A A;  2COD A;  3GYP A;  2JP2 A;  4CYE A;  2DN6 A;  2M38 A;  4HB0 B;  1W1G A;  2QKM A;  4GNK B;  5HE1 A;  1V89 A;  1PFJ A;  5EFX A;  2Y8G A;  4HDQ A;  2DHK A;  1OY2 A;  2L2I A;  2W2X D;  2R0D A;  4HB3 B;  2DYN A;  2FJU B;  2YVC A;  2D4Q A;  3PVU A;  4QJ5 B;  3D8D A;  1E5W A;  2J0M A;  1J19 A;  2KCJ A;  1ZYI A;  2GS0 A;  3G9W A;  4IFS A;  2CAY A;  4EMO A;  1XCG A;  4GOU A;  2K49 A;  3QWM A;  2DFK A;  5LG4 B;  2AL6 A;  3VIA A;  1LB1 A;  2MFQ A;  4DX9 0;  1XKE A;  3WYF B;  1U27 A;  2KUQ A;  1MK9 B;  1ISN A;  1BTN A;  1W1D A;  4K17 A;  3QBV B;  4HB4 B;  5D3X A;  4HDO A;  4A6F A;  5D27 A;  2VSZ A;  1B55 A;  1TXD A;  3GYO A;  5C16 A;  4IAP A;  4OT1 A;  4H8S A;  5JHH A;  2P0D A;  4MY6 A;  4KHO A;  3PP2 A;  2RSG A;  2DKP A;  2Q13 A;  1WGQ A;  4HHV A;  3ODO A;  1UPR A;  3B77 A;  3SNH A;  4K2P A;  1UPQ A;  3F0W A;  3A8Q A;  2YRY A;  3KZ1 A;  2DTC A;  2Z4D A;  1EGX A;  1MK7 B;  2DKQ A;  4EKU A;  2YF0 A;  2ADZ A;  5CLL B;  5I2S A;  3T06 A;  4A6K A;  4DBB A;  5DHA B;  4K2O A;  2J59 M;  1GC6 A;  5KQ1 A;  2YT2 A;  4DXA B;  4P7I A;  4GPT B;  4GZU A;  1GC7 A;  2Z0P A;  4A6H A;  4EJN A;  3N7C A;  3TVV A;  5HE0 A;  4K81 A;  3IVF A;  2CY5 A;  3NWD A;  4QXA B;  1FGZ A;  1XX0 A;  5J3T A;  1DYN A;  3HK0 A;  3PEG A;  5I2M A;  4KHB A;  1KI1 B;  4OSN A;  2KIG A;  2VKI A;  4DIX A;  3PG7 A;  2DHI A;  1BAK A;  2KR0 A;  3UZT A;  1NU2 A;  2KGX B;  3SYX A;  3DXC A;  1U5E A;  1XOD A;  3FVC A;  4WJ7 A;  3D8E A;  2IFS A;  2UVM A;  3V5W A;  3PZD A;  1SGH A;  2RVB B;  2GUM A;  2DA0 A;  1J0W A;  4IOY X;  2J0K A;  4YON A;  3LJU X;  2RRF A;  2HTH B;  2RUK B;  3TFM A;  1Y19 B;  3ULB A;  2X18 A;  2XQN M;  4A6F B;  1EF1 A;  5M4Y B;  4NY0 A;  5DIF B;  1FB8 A;  3HW2 B;  3FSS A;  3RCP A;  4B6H A;  1EAZ A;  2K00 A;  2RLO A;  4Z2N A;  4D0N B;  3TO1 A;  4Z2M B;  5D3V A;  5HE3 A;  2BCJ A;  1U5F A;  1QC6 A; 
#chains in the Genus database with same CATH homology
 4ZRI A;  4A5K A;  1FHW A;  1SHC A;  2W2W A;  2LKO A;  1TQZ A;  1MAI A;  1UNQ A;  4DX8 A;  5C79 A;  1UEF A;  4HB2 B;  1DDM A;  4KHB B;  2Y8F A;  2EMS A;  1V61 A;  3X23 A;  1X1G A;  3AJ4 A;  5DHF B;  1WJ1 A;  1UNP A;  2EMT A;  2DHJ A;  2K2U A;  1NTV A;  3MDB C;  4HAX B;  2D9W A;  2I1K A;  2QKL A;  1X1F A;  5HE2 A;  2N0Y A;  2KUP A;  4HAU B;  2D9Z A;  3BIN A;  2D10 A;  4F7H A;  2COA A;  3CIK A;  3F5R A;  1W1H A;  4ZRK A;  1ZC4 B;  1Q67 A;  1MKE A;  2DX1 A;  1NI2 A;  2OQB A;  1LW3 A;  4GN1 A;  4Y94 A;  3QIJ A;  2RGN B;  4HAZ B;  1OMW A;  4WSF A;  3ODX A;  4BBK A;  4GMV A;  4GXB A;  2COC A;  5DH9 B;  1TJ6 A;  2FJL A;  4PQ0 A;  2LOZ A;  3NSU A;  2I5F A;  1N3H A;  2YS3 A;  2DLW A;  5JP4 A;  3A98 B;  3O96 A;  1V5P A;  1V5U A;  1ZC3 B;  2OTX A;  2Y7B A;  2LYD A;  2D9Y A;  1H4R A;  2YT1 A;  5DI9 B;  5KCV A;  2P0F A;  5CLQ B;  2R09 A;  2UZS A;  1P6S A;  4KVG B;  4CHM A;  2UZR A;  5FI0 A;  3M1I B;  3KSY A;  4KAX B;  1BTK A;  2NZ8 B;  2P8V A;  3DXD A;  2LG1 A;  4ZRJ A;  4F7U P;  2Z0Q A;  1PLS A;  4L6E A;  5D3Y A;  4TYZ A;  1DDV A;  1AWE A;  3KRW A;  2GJY A;  2K2J A;  2J0J A;  3ML4 A;  2MWN B;  1X11 A;  4PNK A;  3KY9 A;  2I1J A;  2L1C A;  3A8P A;  1K5G B;  2ROZ B;  4WVF B;  1WJM A;  1MIX A;  4GMX B;  1I2H A;  3D8F A;  1DDW A;  1K5D B;  4YL8 A;  1WG7 A;  1M7E A;  2H7D A;  2NMB A;  2YS5 A;  1KZ7 A;  2ZPY A;  2COF A;  1DBH A;  2GCJ A;  3AU4 A;  1MPH A;  1WI1 A;  3KRX A;  1OQN A;  2M14 A;  1ZSQ A;  2E2X A;  1Y5O A;  3AU5 A;  3SO6 A;  2YS1 A;  2LOX A;  2D9X A;  4MT7 A;  2N23 A;  1Z87 A;  3TW1 A;  5KQ4 A;  2HE7 A;  3PVL A;  2ELA A;  4KHA A;  1P3R A;  2Z0O A;  3WA0 A;  1NTY A;  2CRF A;  5GOW B;  1FOE A;  1KZG A;  3P7Z A;  3VOQ A;  1X05 A;  2V76 A;  3SUZ A;  1MIZ B;  2I5C A;  3TCA A;  2ELB A;  4NSW A;  3OAN A;  3DXE A;  5D3W A;  5JHG A;  3HQC A;  1XD4 A;  1EVH A;  5J3Q A;  2P0H A;  5C5B B;  3SV1 A;  1GG3 A;  1WVH A;  1U29 A;  2YSZ A;  4F7G A;  5J3Y A;  5C6R A;  3ZDT A;  3BJI A;  2ROV A;  3PVW A;  3ZVR A;  2RNR B;  3CXB B;  3U7D A;  3U8Z A;  5LOP B;  1RRP B;  1ZVR A;  2G35 A;  1ZM0 A;  1H10 A;  4MK0 A;  2EC1 A;  2YT0 A;  4C0A A;  1M7R A;  3FM8 C;  4HAV B;  2DX5 A;  1UNR A;  2MDX A;  5LON B;  5FI1 A;  1FHO A;  1WGU A;  1V88 A;  1DRO A;  1XR0 B;  2D2Q A;  2D9V A;  2D11 A;  2PZ1 A;  1QQG A;  5C5B A;  1BWN A;  2GCL A;  4TKN A;  2DYQ A;  5JLJ B;  2VRW B;  3PSC A;  3FEH A;  1P5T A;  4HAW B;  1IRS A;  2MKR A;  1PMS A;  2IYB A;  1V5M A;  1RJ2 A;  1U5G A;  5L81 A;  2CY4 A;  3MPX A;  1FGY A;  1FHX A;  2H7E A;  4HAY B;  2AEH A;  1U2B A;  3ULC A;  2EJ8 A;  3ODW A;  3P6A A;  1X86 A;  1AQC A;  4CHJ A;  1U5D A;  4HAT B;  1FAO A;  2LUL A;  4XWX A;  2W2X C;  1I7A A;  2COD A;  3GYP A;  2JP2 A;  4CYE A;  2DN6 A;  2M38 A;  4HB0 B;  1W1G A;  2QKM A;  5HE1 A;  1V89 A;  1PFJ A;  5EFX A;  2Y8G A;  4HDQ A;  2DHK A;  1OY2 A;  2L2I A;  2W2X D;  2R0D A;  4HB3 B;  2DYN A;  2YVC A;  2D4Q A;  3PVU A;  3D8D A;  1E5W A;  2J0M A;  1J19 A;  2KCJ A;  2GS0 A;  3G9W A;  4IFS A;  2CAY A;  4EMO A;  1XCG A;  3QWM A;  2DFK A;  2AL6 A;  3VIA A;  1LB1 A;  2MFQ A;  4DX9 0;  1XKE A;  3WYF B;  1U27 A;  1MK9 B;  1ISN A;  1BTN A;  1W1D A;  4K17 A;  3QBV B;  4HB4 B;  5D3X A;  4HDO A;  4A6F A;  5D27 A;  2VSZ A;  1B55 A;  1TXD A;  3GYO A;  5C16 A;  4IAP A;  4H8S A;  5JHH A;  2P0D A;  4MY6 A;  4KHO A;  3PP2 A;  2RSG A;  2DKP A;  2Q13 A;  1WGQ A;  4HHV A;  3ODO A;  1UPR A;  3SNH A;  4K2P A;  1UPQ A;  3F0W A;  3A8Q A;  2YRY A;  3KZ1 A;  2DTC A;  1EGX A;  1MK7 B;  2DKQ A;  4EKU A;  2YF0 A;  2ADZ A;  5CLL B;  3T06 A;  4A6K A;  4DBB A;  5DHA B;  4K2O A;  2J59 M;  1GC6 A;  5KQ1 A;  4DXA B;  4P7I A;  4GPT B;  4GZU A;  1GC7 A;  2Z0P A;  4A6H A;  4EJN A;  3N7C A;  3TVV A;  5HE0 A;  4K81 A;  3IVF A;  2CY5 A;  1FGZ A;  1XX0 A;  5J3T A;  1DYN A;  3HK0 A;  3PEG A;  1KI1 B;  2VKI A;  3PG7 A;  2DHI A;  1BAK A;  3UZT A;  1NU2 A;  2KGX B;  3SYX A;  3DXC A;  1U5E A;  1XOD A;  4WJ7 A;  3D8E A;  2IFS A;  2UVM A;  3V5W A;  3PZD A;  1SGH A;  2RVB B;  2DA0 A;  1J0W A;  4IOY X;  2J0K A;  4YON A;  3LJU X;  2HTH B;  2RUK B;  3TFM A;  1Y19 B;  3ULB A;  2X18 A;  2XQN M;  4A6F B;  1EF1 A;  4NY0 A;  5DIF B;  1FB8 A;  3HW2 B;  3FSS A;  3RCP A;  4B6H A;  1EAZ A;  2K00 A;  2RLO A;  4Z2N A;  4D0N B;  3TO1 A;  4Z2M B;  5D3V A;  5HE3 A;  2BCJ A;  1U5F A;  1QC6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...