4WVFB

Crystal structure of kpt276 in complex with crm1-ran-ranbp1
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
138
structure length
130
Chain Sequence
IHFEPVVTMEEDEEVLYKVRAKLFRFDADAKEWKERGTGDCKFLKNKKTNKVRILMRRDKTLKICANHIIAPEYTLKPNVGSDRSWVYACTADIAEGEAEAFTFAIRFGSKENADKFKEEFEKAQEINKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTP-binding nuclear protein Ran
publication title Nuclear export inhibitors avert progression in preclinical models of inflammatory demyelination.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein/transport protein inhibitor
total genus 34
structure length 130
sequence length 138
ec nomenclature
pdb deposition date 2014-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00638 Ran_BP1 RanBP1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4wvfB00
1OQNA 2D9ZA 1P3RA 1DYNA 2J59M 4DX90 2P0HA 4L6EA 1WVHA 2P0DA 1UPQA 2R0DA 5JHGA 2Z0OA 1Q67A 2E2XA 4IAPA 5JHHA 1U5DA 3P6AA 2LOZA 2AL6A 1BTKA 2DX5A 3TVVA 1X86A 3AU5A 3GYOA 2D9WA 1U2BA 4NY0A 1UEFA 1X05A 2L2IA 1U5GA 3SO6A 3MPXA 3ULCA 2VRWB 4K2PA 4DBBA 3D8EA 1RJ2A 3CXBB 2N23A 2EMSA 3FM8C 3QBVB 2MKRA 1NTVA 1UNRA 3MDBC 3A8QA 1EVHA 5D3WA 1EAZA 2DHIA 2V76A 2K00A 4Z2MB 4A5KA 2H7DA 4WJ7A 3VOQA 1K5GB 2GCJA 3WA0A 4MY6A 2GJYA 2QKLA 3ODXA 1KI1B 2LYDA 3DXDA 3BJIA 3SUZA 2H7EA 2W2WA 2DHKA 3ZVRA 3AJ4A 2PZ1A 2EJ8A 1H4RA 3PZDA 1TJ6A 1H10A 5C5BB 5J3QA 1TXDA 1U5EA 1AQCA 4YL8A 4DX8A 5HE0A 2Z0PA 1GG3A 4KAXB 3N7CA 4MK0A 4WSFA 1U27A 1WJ1A 4D0NB 2Y7BA 1X1GA 2KUPA 3HW2B 4H8SA 2LKOA 1UPRA 1UNPA 2UVMA 5JP4A 2RVBB 3T06A 4HDOA 3TCAA 3VIAA 1KZ7A 2J0MA 1PMSA 2M14A 5LONB 1M7RA 3HQCA 1WJMA 4HAUB 2NMBA 5D27A 5GOWB 2RGNB 1FGYA 2I1JA 2YT0A 3ML4A 3KZ1A 1I2HA 4IOYX 1EF1A 4GPTB 1P6SA 4CHMA 3TO1A 3ZDTA 4KHAA 2I1KA 5D3VA 3WYFB 2D10A 2DKQA 2Y8GA 2CY4A 1IRSA 2BCJA 4ZRKA 2IYBA 4DXAB 2ELBA 2ROVA 2ADZA 2LG1A 2LULA 2YVCA 2YF0A 4K81A 4KHOA 5DIFB 1U29A 1V88A 5CLQB 1OMWA 1ZC3B 1X1FA 1KZGA 4A6FA 3BINA 1DDVA 1DDWA 1XCGA 1WG7A 4PNKA 5J3YA 4GN1A 1Y19B 5HE2A 1FHXA 5CLLB 3PEGA 3QIJA 2OTXA 4TKNA 1NI2A 1V5MA 4EJNA 2CODA 2YS1A 3D8FA 2ELAA 2CRFA 1V89A 4CHJA 4HHVA 1K5DB 1MIZB 1SHCA 5HE3A 1PLSA 4XWXA 2KCJA 4YONA 1V61A 4B6HA 2I5FA 1ISNA 1W1HA 1Z87A 2MDXA 2L1CA 1LW3A 1FOEA 4HB4B 1DBHA 2DHJA 2IFSA 1ZSQA 2GS0A 1V5UA 4F7UP 1DDMA 5C6RA 5J3TA 3X23A 1FHOA 3KSYA 2DTCA 4K17A 4PQ0A 1MK7B 2DX1A 3PVWA 2D9VA 5C16A 2XQNM 1FAOA 2X18A 1N3HA 2K2JA 1AWEA 1M7EA 1DROA 1QQGA 4C0AA 5DI9B 3U7DA 1BWNA 3OANA 2EMTA 2N0YA 2DKPA 3ULBA 4HB2B 2D2QA 1GC6A 1WGQA 3SNHA 5C79A 2UZSA 2RUKB 2VSZA 4EKUA 4HB0B 4ZRJA 2DYNA 3F5RA 2EC1A 1FGZA 5KCVA 4HATB 3PVUA 4HDQA 3FSSA 3IVFA 1BAKA 1XR0B 4F7HA 3NSUA 4GXBA 2RLOA 1W1DA 1WI1A 3RCPA 3TFMA 4IFSA 1LB1A 2DYQA 2D9YA 1XKEA 4TYZA 1RRPB 1E5WA 2D4QA 5DH9B 4GMXB 3M1IB 2W2XD 5EFXA 2P8VA 2GCLA 2MFQA 2ROZB 2HTHB 4A6FB 1MAIA 2VKIA 1P5TA 3D8DA 3KRXA 5DHAB 4CYEA 2YS3A 1ZM0A 4GZUA 1TQZA 2Y8FA 1FHWA 1FB8A 2OQBA 4KVGB 1W1GA 3PG7A 3KRWA 2W2XC 1J19A 1U5FA 2DFKA 2M38A 3PVLA 5LOPB 2J0KA 2JP2A 4KHBB 1ZC4B 2YS5A 4NSWA 3QWMA 3FEHA 2D11A 4HB3B 2COCA 5JLJB 1NTYA 2CAYA 5D3XA 2P0FA 4P7IA 1X11A 1WGUA 2R09A 3P7ZA 4HAVB 1MIXA 1EGXA 2HE7A 3ODWA 1XX0A 1OY2A 3HK0A 4HAXB 4HAWB 3GYPA 4GMVA 3PSCA 4MT7A 1MPHA 2D9XA 1UNQA 2AEHA 1MK9B 3U8ZA 3O96A 2FJLA 1ZVRA 4HAZB 4A6KA 1QC6A 4F7GA 2YSZA 3DXCA 2COFA 2QKMA 5C5BA 3CIKA 5HE1A 4HAYB 2RSGA 1Y5OA 2RNRB 4BBKA 5FI0A 5KQ1A 3G9WA 5DHFB 3F0WA 2KGXB 3AU4A 2MWNB 2DN6A 1PFJA 2NZ8B 3A8PA 4ZRIA 1XD4A 4A6HA 1SGHA 5D3YA 4K2OA 1I7AA 2UZRA 3LJUX 4WVFB 1BTNA 1V5PA 1GC7A 3V5WA 2LOXA 5FI1A 5L81A 2J0JA 2DA0A 2G35A 1NU2A 2Q13A 5KQ4A 4EMOA 3PP2A 3SV1A 2YT1A 3KY9A 1J0WA 2COAA 3ODOA 2I5CA 1XODA 1MKEA 3A98B 1B55A 2CY5A 2Z0QA 2DLWA 2K2UA 4Y94A 2ZPYA 3SYXA 3TW1A 3UZTA 3DXEA 4Z2NA 2YRYA
chains in the Genus database with same CATH superfamily
1OQNA 2D9ZA 1P3RA 1DYNA 2J59M 4DX90 2P0HA 4L6EA 1WVHA 2P0DA 1UPQA 2R0DA 5JHGA 2Z0OA 1Q67A 2E2XA 4IAPA 5JHHA 3NWAA 1U5DA 3P6AA 2LOZA 2AL6A 1BTKA 2DX5A 3TVVA 1X86A 2RRFA 3AU5A 3GYOA 2D9WA 1U2BA 3NW8A 4NY0A 1UEFA 1X05A 2L2IA 1U5GA 3FVCA 3SO6A 3MPXA 3ULCA 2VRWB 4K2PA 4DBBA 3D8EA 1RJ2A 3CXBB 2N23A 2EMSA 3FM8C 3QBVB 2MKRA 1NTVA 1UNRA 3MDBC 3A8QA 1EVHA 5D3WA 1EAZA 4QJ4B 2DHIA 2V76A 3B77A 2K00A 4Z2MB 4A5KA 2Z4DA 2H7DA 4WJ7A 3VOQA 1K5GB 2GCJA 3WA0A 4MY6A 2GJYA 2QKLA 3ODXA 1KI1B 2LYDA 3DXDA 3BJIA 3SUZA 2H7EA 2W2WA 4DIXA 2DHKA 3ZVRA 3AJ4A 2PZ1A 2EJ8A 1H4RA 3PZDA 1TJ6A 1H10A 3OHMB 5C5BB 5J3QA 1TXDA 3A58A 1U5EA 4OT1A 1AQCA 4YL8A 4DX8A 5HE0A 4GNKB 5IRSA 2Z0PA 1GG3A 4QJ5B 4KAXB 3N7CA 4MK0A 2KR0A 4WSFA 2K49A 1U27A 1WJ1A 3U12A 4D0NB 2Y7BA 1X1GA 2KUPA 3HW2B 4H8SA 2LKOA 1UPRA 1UNPA 2UVMA 5JP4A 2RVBB 3T06A 4HDOA 3TCAA 3VIAA 1KZ7A 2J0MA 1PMSA 2M14A 5LONB 1M7RA 3HQCA 1WJMA 4HAUB 2NMBA 5D27A 5GOWB 2RGNB 1FGYA 2I1JA 2YT0A 3ML4A 3KZ1A 1I2HA 4IOYX 1EF1A 4GPTB 2K8EA 1P6SA 4CHMA 3TO1A 3ZDTA 4KHAA 2I1KA 5D3VA 3WYFB 2D10A 2DKQA 2Y8GA 2CY4A 1IRSA 1T77A 2BCJA 4ZRKA 2IYBA 4DXAB 1ZYIA 2ELBA 2ROVA 2ADZA 4HSIA 2LG1A 5LG4B 2LULA 2YVCA 2YF0A 4K81A 4KHOA 5DIFB 1U29A 1V88A 5CLQB 1OMWA 1ZC3B 1X1FA 1KZGA 4A6FA 3BINA 1DDVA 1DDWA 1XCGA 1WG7A 4PNKA 5J3YA 3HSAA 4GN1A 1Y19B 5HE2A 1FHXA 5CLLB 3PEGA 3QIJA 2OTXA 4TKNA 1NI2A 1V5MA 4EJNA 2CODA 1MI1A 2YS1A 3D8FA 2ELAA 2CRFA 1V89A 4CHJA 4HHVA 1K5DB 1MIZB 1SHCA 5HE3A 1PLSA 4XWXA 2KCJA 4YONA 1V61A 4KHBA 4B6HA 2I5FA 1ISNA 1W1HA 1Z87A 2MDXA 2L1CA 1LW3A 1FOEA 4HB4B 1DBHA 2DHJA 2IFSA 2ZKMX 1ZSQA 2GS0A 1V5UA 4F7UP 1DDMA 5C6RA 5J3TA 3X23A 1FHOA 3KSYA 2DTCA 4K17A 4PQ0A 1MK7B 2DX1A 3PVWA 2D9VA 5C16A 2XQNM 1FAOA 2KIEA 2X18A 1N3HA 2K2JA 1AWEA 5M4YB 1M7EA 1DROA 1QQGA 4C0AA 5DI9B 3U7DA 1BWNA 3OANA 2EMTA 2N0YA 2DKPA 3ULBA 4HB2B 2D2QA 1GC6A 1WGQA 3SNHA 5C79A 2UZSA 2RUKB 2VSZA 4EKUA 4HB0B 4ZRJA 2DYNA 3F5RA 2EC1A 1FGZA 5KCVA 4HATB 3PVUA 4HDQA 3FSSA 3IVFA 1BAKA 1XR0B 4F7HA 3NSUA 2YT2A 4GXBA 2RLOA 3NWFA 1W1DA 2KIGA 1WI1A 3RCPA 3TFMA 4IFSA 1LB1A 2DYQA 2D9YA 1XKEA 4TYZA 1RRPB 1E5WA 2D4QA 5DH9B 4GMXB 3M1IB 2W2XD 5EFXA 2P8VA 2GCLA 2MFQA 2ROZB 3HIEA 2HTHB 4A6FB 1MAIA 2VKIA 1P5TA 3D8DA 3KRXA 5DHAB 4CYEA 2YS3A 5I2SA 2Z14A 4CSQA 1ZM0A 2Z59A 4GZUA 1TQZA 2Y8FA 1FHWA 1FB8A 4QJ3B 2OQBA 3NWDA 4KVGB 4GOUA 1W1GA 4QXAB 3PG7A 3KRWA 2W2XC 1J19A 4L1RA 1U5FA 2DFKA 2M38A 3PVLA 5LOPB 2J0KA 2JP2A 4KHBB 1ZC4B 2YS5A 4NSWA 3QWMA 3FEHA 2D11A 4HB3B 2COCA 5JLJB 1NTYA 2CAYA 5D3XA 2P0FA 4P7IA 1X11A 1WGUA 2R09A 3P7ZA 4HAVB 1MIXA 1EGXA 2HE7A 3ODWA 1XX0A 1OY2A 3HK0A 4HAXB 4HAWB 3GYPA 4GMVA 2FJUB 3PSCA 4MT7A 2R2YA 2NBVA 1MPHA 2GUMA 2D9XA 1UNQA 2AEHA 1MK9B 3U8ZA 3O96A 2FJLA 2KUQA 1ZVRA 4HAZB 4A6KA 1QC6A 4F7GA 2YSZA 3DXCA 2COFA 2QKMA 5C5BA 3CIKA 5HE1A 4HAYB 2RSGA 1Y5OA 2RNRB 4BBKA 5FI0A 5KQ1A 3G9WA 5DHFB 3F0WA 2KGXB 3AU4A 2MWNB 4D6WA 2DN6A 1PFJA 2NZ8B 3A8PA 4ZRIA 1XD4A 4A6HA 1SGHA 5D3YA 4K2OA 1I7AA 2UZRA 3LJUX 4WVFB 1BTNA 1V5PA 1GC7A 3V5WA 2LOXA 5FI1A 5L81A 2J0JA 2DA0A 2G35A 1NU2A 2Q13A 5KQ4A 4EMOA 3PP2A 3SV1A 2YT1A 3KY9A 1J0WA 2COAA 3ODOA 5I2MA 2I5CA 1XODA 1MKEA 3A98B 1B55A 2CY5A 2Z0QA 2DLWA 2K2UA 4Y94A 2ZPYA 4OSNA 3SYXA 3DCXA 3TW1A 3UZTA 3DXEA 4Z2NA 2Z13A 2YRYA
chains in the Genus database with same CATH topology
1OQNA 2D9ZA 1P3RA 1DYNA 2J59M 4DX90 2P0HA 4L6EA 1WVHA 2P0DA 1UPQA 2R0DA 5JHGA 2Z0OA 1Q67A 2E2XA 4IAPA 5JHHA 1U5DA 3P6AA 2LOZA 2AL6A 1BTKA 2DX5A 3TVVA 1X86A 3AU5A 3GYOA 2D9WA 1U2BA 4NY0A 1UEFA 1X05A 2L2IA 1U5GA 3SO6A 3MPXA 3ULCA 2VRWB 4K2PA 4DBBA 3D8EA 1RJ2A 3CXBB 2N23A 2EMSA 3FM8C 3QBVB 2MKRA 1NTVA 1UNRA 3MDBC 3A8QA 1EVHA 5D3WA 1EAZA 2DHIA 2V76A 2K00A 4Z2MB 4A5KA 2H7DA 4WJ7A 3VOQA 1K5GB 2GCJA 3WA0A 4MY6A 2GJYA 2QKLA 3ODXA 1KI1B 2LYDA 3DXDA 3BJIA 3SUZA 2H7EA 2W2WA 2DHKA 3ZVRA 3AJ4A 2PZ1A 2EJ8A 1H4RA 3PZDA 1TJ6A 1H10A 5C5BB 5J3QA 1TXDA 1U5EA 1AQCA 4YL8A 4DX8A 5HE0A 2Z0PA 1GG3A 4KAXB 3N7CA 4MK0A 4WSFA 1U27A 1WJ1A 4D0NB 2Y7BA 1X1GA 2KUPA 3HW2B 4H8SA 2LKOA 1UPRA 1UNPA 2UVMA 5JP4A 2RVBB 3T06A 4HDOA 3TCAA 3VIAA 1KZ7A 2J0MA 1PMSA 2M14A 5LONB 1M7RA 3HQCA 1WJMA 4HAUB 2NMBA 5D27A 5GOWB 2RGNB 1FGYA 2I1JA 2YT0A 3ML4A 3KZ1A 1I2HA 4IOYX 1EF1A 4GPTB 1P6SA 4CHMA 3TO1A 3ZDTA 4KHAA 2I1KA 5D3VA 3WYFB 2D10A 2DKQA 2Y8GA 2CY4A 1IRSA 2BCJA 4ZRKA 2IYBA 4DXAB 2ELBA 2ROVA 2ADZA 2LG1A 2LULA 2YVCA 2YF0A 4K81A 4KHOA 5DIFB 1U29A 1V88A 5CLQB 1OMWA 1ZC3B 1X1FA 1KZGA 4A6FA 3BINA 1DDVA 1DDWA 1XCGA 1WG7A 4PNKA 5J3YA 4GN1A 1Y19B 5HE2A 1FHXA 5CLLB 3PEGA 3QIJA 2OTXA 4TKNA 1NI2A 1V5MA 4EJNA 2CODA 2YS1A 3D8FA 2ELAA 2CRFA 1V89A 4CHJA 4HHVA 1K5DB 1MIZB 1SHCA 5HE3A 1PLSA 4XWXA 2KCJA 4YONA 1V61A 4B6HA 2I5FA 1ISNA 1W1HA 1Z87A 2MDXA 2L1CA 1LW3A 1FOEA 4HB4B 1DBHA 2DHJA 2IFSA 1ZSQA 2GS0A 1V5UA 4F7UP 1DDMA 5C6RA 5J3TA 3X23A 1FHOA 3KSYA 2DTCA 4K17A 4PQ0A 1MK7B 2DX1A 3PVWA 2D9VA 5C16A 2XQNM 1FAOA 2X18A 1N3HA 2K2JA 1AWEA 1M7EA 1DROA 1QQGA 4C0AA 5DI9B 3U7DA 1BWNA 3OANA 2EMTA 2N0YA 2DKPA 3ULBA 4HB2B 2D2QA 1GC6A 1WGQA 3SNHA 5C79A 2UZSA 2RUKB 2VSZA 4EKUA 4HB0B 4ZRJA 2DYNA 3F5RA 2EC1A 1FGZA 5KCVA 4HATB 3PVUA 4HDQA 3FSSA 3IVFA 1BAKA 1XR0B 4F7HA 3NSUA 4GXBA 2RLOA 1W1DA 1WI1A 3RCPA 3TFMA 4IFSA 1LB1A 2DYQA 2D9YA 1XKEA 4TYZA 1RRPB 1E5WA 2D4QA 5DH9B 4GMXB 3M1IB 2W2XD 5EFXA 2P8VA 2GCLA 2MFQA 2ROZB 2HTHB 4A6FB 1MAIA 2VKIA 1P5TA 3D8DA 3KRXA 5DHAB 4CYEA 2YS3A 1ZM0A 4GZUA 1TQZA 2Y8FA 1FHWA 1FB8A 2OQBA 4KVGB 1W1GA 3PG7A 3KRWA 2W2XC 1J19A 1U5FA 2DFKA 2M38A 3PVLA 5LOPB 2J0KA 2JP2A 4KHBB 1ZC4B 2YS5A 4NSWA 3QWMA 3FEHA 2D11A 4HB3B 2COCA 5JLJB 1NTYA 2CAYA 5D3XA 2P0FA 4P7IA 1X11A 1WGUA 2R09A 3P7ZA 4HAVB 1MIXA 1EGXA 2HE7A 3ODWA 1XX0A 1OY2A 3HK0A 4HAXB 4HAWB 3GYPA 4GMVA 3PSCA 4MT7A 1MPHA 2D9XA 1UNQA 2AEHA 1MK9B 3U8ZA 3O96A 2FJLA 1ZVRA 4HAZB 4A6KA 1QC6A 4F7GA 2YSZA 3DXCA 2COFA 2QKMA 5C5BA 3CIKA 5HE1A 4HAYB 2RSGA 1Y5OA 2RNRB 4BBKA 5FI0A 5KQ1A 3G9WA 5DHFB 3F0WA 2KGXB 3AU4A 2MWNB 2DN6A 1PFJA 2NZ8B 3A8PA 4ZRIA 1XD4A 4A6HA 1SGHA 5D3YA 4K2OA 1I7AA 2UZRA 3LJUX 4WVFB 1BTNA 1V5PA 1GC7A 3V5WA 2LOXA 5FI1A 5L81A 2J0JA 2DA0A 2G35A 1NU2A 2Q13A 5KQ4A 4EMOA 3PP2A 3SV1A 2YT1A 3KY9A 1J0WA 2COAA 3ODOA 2I5CA 1XODA 1MKEA 3A98B 1B55A 2CY5A 2Z0QA 2DLWA 2K2UA 4Y94A 2ZPYA 3SYXA 3TW1A 3UZTA 3DXEA 4Z2NA 2YRYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OQN A;  2D9Z A;  1P3R A;  1DYN A;  2J59 M;  4DX9 0;  2P0H A;  4L6E A;  1WVH A;  2P0D A;  1UPQ A;  2R0D A;  5JHG A;  2Z0O A;  1Q67 A;  2E2X A;  4IAP A;  5JHH A;  1U5D A;  3P6A A;  2LOZ A;  2AL6 A;  1BTK A;  2DX5 A;  3TVV A;  1X86 A;  3AU5 A;  3GYO A;  2D9W A;  1U2B A;  4NY0 A;  1UEF A;  1X05 A;  2L2I A;  1U5G A;  3SO6 A;  3MPX A;  3ULC A;  2VRW B;  4K2P A;  4DBB A;  3D8E A;  1RJ2 A;  3CXB B;  2N23 A;  2EMS A;  3FM8 C;  3QBV B;  2MKR A;  1NTV A;  1UNR A;  3MDB C;  3A8Q A;  1EVH A;  5D3W A;  1EAZ A;  2DHI A;  2V76 A;  2K00 A;  4Z2M B;  4A5K A;  2H7D A;  4WJ7 A;  3VOQ A;  1K5G B;  2GCJ A;  3WA0 A;  4MY6 A;  2GJY A;  2QKL A;  3ODX A;  1KI1 B;  2LYD A;  3DXD A;  3BJI A;  3SUZ A;  2H7E A;  2W2W A;  2DHK A;  3ZVR A;  3AJ4 A;  2PZ1 A;  2EJ8 A;  1H4R A;  3PZD A;  1TJ6 A;  1H10 A;  5C5B B;  5J3Q A;  1TXD A;  1U5E A;  1AQC A;  4YL8 A;  4DX8 A;  5HE0 A;  2Z0P A;  1GG3 A;  4KAX B;  3N7C A;  4MK0 A;  4WSF A;  1U27 A;  1WJ1 A;  4D0N B;  2Y7B A;  1X1G A;  2KUP A;  3HW2 B;  4H8S A;  2LKO A;  1UPR A;  1UNP A;  2UVM A;  5JP4 A;  2RVB B;  3T06 A;  4HDO A;  3TCA A;  3VIA A;  1KZ7 A;  2J0M A;  1PMS A;  2M14 A;  5LON B;  1M7R A;  3HQC A;  1WJM A;  4HAU B;  2NMB A;  5D27 A;  5GOW B;  2RGN B;  1FGY A;  2I1J A;  2YT0 A;  3ML4 A;  3KZ1 A;  1I2H A;  4IOY X;  1EF1 A;  4GPT B;  1P6S A;  4CHM A;  3TO1 A;  3ZDT A;  4KHA A;  2I1K A;  5D3V A;  3WYF B;  2D10 A;  2DKQ A;  2Y8G A;  2CY4 A;  1IRS A;  2BCJ A;  4ZRK A;  2IYB A;  4DXA B;  2ELB A;  2ROV A;  2ADZ A;  2LG1 A;  2LUL A;  2YVC A;  2YF0 A;  4K81 A;  4KHO A;  5DIF B;  1U29 A;  1V88 A;  5CLQ B;  1OMW A;  1ZC3 B;  1X1F A;  1KZG A;  4A6F A;  3BIN A;  1DDV A;  1DDW A;  1XCG A;  1WG7 A;  4PNK A;  5J3Y A;  4GN1 A;  1Y19 B;  5HE2 A;  1FHX A;  5CLL B;  3PEG A;  3QIJ A;  2OTX A;  4TKN A;  1NI2 A;  1V5M A;  4EJN A;  2COD A;  2YS1 A;  3D8F A;  2ELA A;  2CRF A;  1V89 A;  4CHJ A;  4HHV A;  1K5D B;  1MIZ B;  1SHC A;  5HE3 A;  1PLS A;  4XWX A;  2KCJ A;  4YON A;  1V61 A;  4B6H A;  2I5F A;  1ISN A;  1W1H A;  1Z87 A;  2MDX A;  2L1C A;  1LW3 A;  1FOE A;  4HB4 B;  1DBH A;  2DHJ A;  2IFS A;  1ZSQ A;  2GS0 A;  1V5U A;  4F7U P;  1DDM A;  5C6R A;  5J3T A;  3X23 A;  1FHO A;  3KSY A;  2DTC A;  4K17 A;  4PQ0 A;  1MK7 B;  2DX1 A;  3PVW A;  2D9V A;  5C16 A;  2XQN M;  1FAO A;  2X18 A;  1N3H A;  2K2J A;  1AWE A;  1M7E A;  1DRO A;  1QQG A;  4C0A A;  5DI9 B;  3U7D A;  1BWN A;  3OAN A;  2EMT A;  2N0Y A;  2DKP A;  3ULB A;  4HB2 B;  2D2Q A;  1GC6 A;  1WGQ A;  3SNH A;  5C79 A;  2UZS A;  2RUK B;  2VSZ A;  4EKU A;  4HB0 B;  4ZRJ A;  2DYN A;  3F5R A;  2EC1 A;  1FGZ A;  5KCV A;  4HAT B;  3PVU A;  4HDQ A;  3FSS A;  3IVF A;  1BAK A;  1XR0 B;  4F7H A;  3NSU A;  4GXB A;  2RLO A;  1W1D A;  1WI1 A;  3RCP A;  3TFM A;  4IFS A;  1LB1 A;  2DYQ A;  2D9Y A;  1XKE A;  4TYZ A;  1RRP B;  1E5W A;  2D4Q A;  5DH9 B;  4GMX B;  3M1I B;  2W2X D;  5EFX A;  2P8V A;  2GCL A;  2MFQ A;  2ROZ B;  2HTH B;  4A6F B;  1MAI A;  2VKI A;  1P5T A;  3D8D A;  3KRX A;  5DHA B;  4CYE A;  2YS3 A;  1ZM0 A;  4GZU A;  1TQZ A;  2Y8F A;  1FHW A;  1FB8 A;  2OQB A;  4KVG B;  1W1G A;  3PG7 A;  3KRW A;  2W2X C;  1J19 A;  1U5F A;  2DFK A;  2M38 A;  3PVL A;  5LOP B;  2J0K A;  2JP2 A;  4KHB B;  1ZC4 B;  2YS5 A;  4NSW A;  3QWM A;  3FEH A;  2D11 A;  4HB3 B;  2COC A;  5JLJ B;  1NTY A;  2CAY A;  5D3X A;  2P0F A;  4P7I A;  1X11 A;  1WGU A;  2R09 A;  3P7Z A;  4HAV B;  1MIX A;  1EGX A;  2HE7 A;  3ODW A;  1XX0 A;  1OY2 A;  3HK0 A;  4HAX B;  4HAW B;  3GYP A;  4GMV A;  3PSC A;  4MT7 A;  1MPH A;  2D9X A;  1UNQ A;  2AEH A;  1MK9 B;  3U8Z A;  3O96 A;  2FJL A;  1ZVR A;  4HAZ B;  4A6K A;  1QC6 A;  4F7G A;  2YSZ A;  3DXC A;  2COF A;  2QKM A;  5C5B A;  3CIK A;  5HE1 A;  4HAY B;  2RSG A;  1Y5O A;  2RNR B;  4BBK A;  5FI0 A;  5KQ1 A;  3G9W A;  5DHF B;  3F0W A;  2KGX B;  3AU4 A;  2MWN B;  2DN6 A;  1PFJ A;  2NZ8 B;  3A8P A;  4ZRI A;  1XD4 A;  4A6H A;  1SGH A;  5D3Y A;  4K2O A;  1I7A A;  2UZR A;  3LJU X;  4WVF B;  1BTN A;  1V5P A;  1GC7 A;  3V5W A;  2LOX A;  5FI1 A;  5L81 A;  2J0J A;  2DA0 A;  2G35 A;  1NU2 A;  2Q13 A;  5KQ4 A;  4EMO A;  3PP2 A;  3SV1 A;  2YT1 A;  3KY9 A;  1J0W A;  2COA A;  3ODO A;  2I5C A;  1XOD A;  1MKE A;  3A98 B;  1B55 A;  2CY5 A;  2Z0Q A;  2DLW A;  2K2U A;  4Y94 A;  2ZPY A;  3SYX A;  3TW1 A;  3UZT A;  3DXE A;  4Z2N A;  2YRY A; 
#chains in the Genus database with same CATH topology
 1OQN A;  2D9Z A;  1P3R A;  1DYN A;  2J59 M;  4DX9 0;  2P0H A;  4L6E A;  1WVH A;  2P0D A;  1UPQ A;  2R0D A;  5JHG A;  2Z0O A;  1Q67 A;  2E2X A;  4IAP A;  5JHH A;  3NWA A;  1U5D A;  3P6A A;  2LOZ A;  2AL6 A;  1BTK A;  2DX5 A;  3TVV A;  1X86 A;  2RRF A;  3AU5 A;  3GYO A;  2D9W A;  1U2B A;  3NW8 A;  4NY0 A;  1UEF A;  1X05 A;  2L2I A;  1U5G A;  3FVC A;  3SO6 A;  3MPX A;  3ULC A;  2VRW B;  4K2P A;  4DBB A;  3D8E A;  1RJ2 A;  3CXB B;  2N23 A;  2EMS A;  3FM8 C;  3QBV B;  2MKR A;  1NTV A;  1UNR A;  3MDB C;  3A8Q A;  1EVH A;  5D3W A;  1EAZ A;  4QJ4 B;  2DHI A;  2V76 A;  3B77 A;  2K00 A;  4Z2M B;  4A5K A;  2Z4D A;  2H7D A;  4WJ7 A;  3VOQ A;  1K5G B;  2GCJ A;  3WA0 A;  4MY6 A;  2GJY A;  2QKL A;  3ODX A;  1KI1 B;  2LYD A;  3DXD A;  3BJI A;  3SUZ A;  2H7E A;  2W2W A;  4DIX A;  2DHK A;  3ZVR A;  3AJ4 A;  2PZ1 A;  2EJ8 A;  1H4R A;  3PZD A;  1TJ6 A;  1H10 A;  3OHM B;  5C5B B;  5J3Q A;  1TXD A;  3A58 A;  1U5E A;  4OT1 A;  1AQC A;  4YL8 A;  4DX8 A;  5HE0 A;  4GNK B;  5IRS A;  2Z0P A;  1GG3 A;  4QJ5 B;  4KAX B;  3N7C A;  4MK0 A;  2KR0 A;  4WSF A;  2K49 A;  1U27 A;  1WJ1 A;  3U12 A;  4D0N B;  2Y7B A;  1X1G A;  2KUP A;  3HW2 B;  4H8S A;  2LKO A;  1UPR A;  1UNP A;  2UVM A;  5JP4 A;  2RVB B;  3T06 A;  4HDO A;  3TCA A;  3VIA A;  1KZ7 A;  2J0M A;  1PMS A;  2M14 A;  5LON B;  1M7R A;  3HQC A;  1WJM A;  4HAU B;  2NMB A;  5D27 A;  5GOW B;  2RGN B;  1FGY A;  2I1J A;  2YT0 A;  3ML4 A;  3KZ1 A;  1I2H A;  4IOY X;  1EF1 A;  4GPT B;  2K8E A;  1P6S A;  4CHM A;  3TO1 A;  3ZDT A;  4KHA A;  2I1K A;  5D3V A;  3WYF B;  2D10 A;  2DKQ A;  2Y8G A;  2CY4 A;  1IRS A;  1T77 A;  2BCJ A;  4ZRK A;  2IYB A;  4DXA B;  1ZYI A;  2ELB A;  2ROV A;  2ADZ A;  4HSI A;  2LG1 A;  5LG4 B;  2LUL A;  2YVC A;  2YF0 A;  4K81 A;  4KHO A;  5DIF B;  1U29 A;  1V88 A;  5CLQ B;  1OMW A;  1ZC3 B;  1X1F A;  1KZG A;  4A6F A;  3BIN A;  1DDV A;  1DDW A;  1XCG A;  1WG7 A;  4PNK A;  5J3Y A;  3HSA A;  4GN1 A;  1Y19 B;  5HE2 A;  1FHX A;  5CLL B;  3PEG A;  3QIJ A;  2OTX A;  4TKN A;  1NI2 A;  1V5M A;  4EJN A;  2COD A;  1MI1 A;  2YS1 A;  3D8F A;  2ELA A;  2CRF A;  1V89 A;  4CHJ A;  4HHV A;  1K5D B;  1MIZ B;  1SHC A;  5HE3 A;  1PLS A;  4XWX A;  2KCJ A;  4YON A;  1V61 A;  4KHB A;  4B6H A;  2I5F A;  1ISN A;  1W1H A;  1Z87 A;  2MDX A;  2L1C A;  1LW3 A;  1FOE A;  4HB4 B;  1DBH A;  2DHJ A;  2IFS A;  2ZKM X;  1ZSQ A;  2GS0 A;  1V5U A;  4F7U P;  1DDM A;  5C6R A;  5J3T A;  3X23 A;  1FHO A;  3KSY A;  2DTC A;  4K17 A;  4PQ0 A;  1MK7 B;  2DX1 A;  3PVW A;  2D9V A;  5C16 A;  2XQN M;  1FAO A;  2KIE A;  2X18 A;  1N3H A;  2K2J A;  1AWE A;  5M4Y B;  1M7E A;  1DRO A;  1QQG A;  4C0A A;  5DI9 B;  3U7D A;  1BWN A;  3OAN A;  2EMT A;  2N0Y A;  2DKP A;  3ULB A;  4HB2 B;  2D2Q A;  1GC6 A;  1WGQ A;  3SNH A;  5C79 A;  2UZS A;  2RUK B;  2VSZ A;  4EKU A;  4HB0 B;  4ZRJ A;  2DYN A;  3F5R A;  2EC1 A;  1FGZ A;  5KCV A;  4HAT B;  3PVU A;  4HDQ A;  3FSS A;  3IVF A;  1BAK A;  1XR0 B;  4F7H A;  3NSU A;  2YT2 A;  4GXB A;  2RLO A;  3NWF A;  1W1D A;  2KIG A;  1WI1 A;  3RCP A;  3TFM A;  4IFS A;  1LB1 A;  2DYQ A;  2D9Y A;  1XKE A;  4TYZ A;  1RRP B;  1E5W A;  2D4Q A;  5DH9 B;  4GMX B;  3M1I B;  2W2X D;  5EFX A;  2P8V A;  2GCL A;  2MFQ A;  2ROZ B;  3HIE A;  2HTH B;  4A6F B;  1MAI A;  2VKI A;  1P5T A;  3D8D A;  3KRX A;  5DHA B;  4CYE A;  2YS3 A;  5I2S A;  2Z14 A;  4CSQ A;  1ZM0 A;  2Z59 A;  4GZU A;  1TQZ A;  2Y8F A;  1FHW A;  1FB8 A;  4QJ3 B;  2OQB A;  3NWD A;  4KVG B;  4GOU A;  1W1G A;  4QXA B;  3PG7 A;  3KRW A;  2W2X C;  1J19 A;  4L1R A;  1U5F A;  2DFK A;  2M38 A;  3PVL A;  5LOP B;  2J0K A;  2JP2 A;  4KHB B;  1ZC4 B;  2YS5 A;  4NSW A;  3QWM A;  3FEH A;  2D11 A;  4HB3 B;  2COC A;  5JLJ B;  1NTY A;  2CAY A;  5D3X A;  2P0F A;  4P7I A;  1X11 A;  1WGU A;  2R09 A;  3P7Z A;  4HAV B;  1MIX A;  1EGX A;  2HE7 A;  3ODW A;  1XX0 A;  1OY2 A;  3HK0 A;  4HAX B;  4HAW B;  3GYP A;  4GMV A;  2FJU B;  3PSC A;  4MT7 A;  2R2Y A;  2NBV A;  1MPH A;  2GUM A;  2D9X A;  1UNQ A;  2AEH A;  1MK9 B;  3U8Z A;  3O96 A;  2FJL A;  2KUQ A;  1ZVR A;  4HAZ B;  4A6K A;  1QC6 A;  4F7G A;  2YSZ A;  3DXC A;  2COF A;  2QKM A;  5C5B A;  3CIK A;  5HE1 A;  4HAY B;  2RSG A;  1Y5O A;  2RNR B;  4BBK A;  5FI0 A;  5KQ1 A;  3G9W A;  5DHF B;  3F0W A;  2KGX B;  3AU4 A;  2MWN B;  4D6W A;  2DN6 A;  1PFJ A;  2NZ8 B;  3A8P A;  4ZRI A;  1XD4 A;  4A6H A;  1SGH A;  5D3Y A;  4K2O A;  1I7A A;  2UZR A;  3LJU X;  4WVF B;  1BTN A;  1V5P A;  1GC7 A;  3V5W A;  2LOX A;  5FI1 A;  5L81 A;  2J0J A;  2DA0 A;  2G35 A;  1NU2 A;  2Q13 A;  5KQ4 A;  4EMO A;  3PP2 A;  3SV1 A;  2YT1 A;  3KY9 A;  1J0W A;  2COA A;  3ODO A;  5I2M A;  2I5C A;  1XOD A;  1MKE A;  3A98 B;  1B55 A;  2CY5 A;  2Z0Q A;  2DLW A;  2K2U A;  4Y94 A;  2ZPY A;  4OSN A;  3SYX A;  3DCX A;  3TW1 A;  3UZT A;  3DXE A;  4Z2N A;  2Z13 A;  2YRY A; 
#chains in the Genus database with same CATH homology
 1OQN A;  2D9Z A;  1P3R A;  1DYN A;  2J59 M;  4DX9 0;  2P0H A;  4L6E A;  1WVH A;  2P0D A;  1UPQ A;  2R0D A;  5JHG A;  2Z0O A;  1Q67 A;  2E2X A;  4IAP A;  5JHH A;  1U5D A;  3P6A A;  2LOZ A;  2AL6 A;  1BTK A;  2DX5 A;  3TVV A;  1X86 A;  3AU5 A;  3GYO A;  2D9W A;  1U2B A;  4NY0 A;  1UEF A;  1X05 A;  2L2I A;  1U5G A;  3SO6 A;  3MPX A;  3ULC A;  2VRW B;  4K2P A;  4DBB A;  3D8E A;  1RJ2 A;  3CXB B;  2N23 A;  2EMS A;  3FM8 C;  3QBV B;  2MKR A;  1NTV A;  1UNR A;  3MDB C;  3A8Q A;  1EVH A;  5D3W A;  1EAZ A;  2DHI A;  2V76 A;  2K00 A;  4Z2M B;  4A5K A;  2H7D A;  4WJ7 A;  3VOQ A;  1K5G B;  2GCJ A;  3WA0 A;  4MY6 A;  2GJY A;  2QKL A;  3ODX A;  1KI1 B;  2LYD A;  3DXD A;  3BJI A;  3SUZ A;  2H7E A;  2W2W A;  2DHK A;  3ZVR A;  3AJ4 A;  2PZ1 A;  2EJ8 A;  1H4R A;  3PZD A;  1TJ6 A;  1H10 A;  5C5B B;  5J3Q A;  1TXD A;  1U5E A;  1AQC A;  4YL8 A;  4DX8 A;  5HE0 A;  2Z0P A;  1GG3 A;  4KAX B;  3N7C A;  4MK0 A;  4WSF A;  1U27 A;  1WJ1 A;  4D0N B;  2Y7B A;  1X1G A;  2KUP A;  3HW2 B;  4H8S A;  2LKO A;  1UPR A;  1UNP A;  2UVM A;  5JP4 A;  2RVB B;  3T06 A;  4HDO A;  3TCA A;  3VIA A;  1KZ7 A;  2J0M A;  1PMS A;  2M14 A;  5LON B;  1M7R A;  3HQC A;  1WJM A;  4HAU B;  2NMB A;  5D27 A;  5GOW B;  2RGN B;  1FGY A;  2I1J A;  2YT0 A;  3ML4 A;  3KZ1 A;  1I2H A;  4IOY X;  1EF1 A;  4GPT B;  1P6S A;  4CHM A;  3TO1 A;  3ZDT A;  4KHA A;  2I1K A;  5D3V A;  3WYF B;  2D10 A;  2DKQ A;  2Y8G A;  2CY4 A;  1IRS A;  2BCJ A;  4ZRK A;  2IYB A;  4DXA B;  2ELB A;  2ROV A;  2ADZ A;  2LG1 A;  2LUL A;  2YVC A;  2YF0 A;  4K81 A;  4KHO A;  5DIF B;  1U29 A;  1V88 A;  5CLQ B;  1OMW A;  1ZC3 B;  1X1F A;  1KZG A;  4A6F A;  3BIN A;  1DDV A;  1DDW A;  1XCG A;  1WG7 A;  4PNK A;  5J3Y A;  4GN1 A;  1Y19 B;  5HE2 A;  1FHX A;  5CLL B;  3PEG A;  3QIJ A;  2OTX A;  4TKN A;  1NI2 A;  1V5M A;  4EJN A;  2COD A;  2YS1 A;  3D8F A;  2ELA A;  2CRF A;  1V89 A;  4CHJ A;  4HHV A;  1K5D B;  1MIZ B;  1SHC A;  5HE3 A;  1PLS A;  4XWX A;  2KCJ A;  4YON A;  1V61 A;  4B6H A;  2I5F A;  1ISN A;  1W1H A;  1Z87 A;  2MDX A;  2L1C A;  1LW3 A;  1FOE A;  4HB4 B;  1DBH A;  2DHJ A;  2IFS A;  1ZSQ A;  2GS0 A;  1V5U A;  4F7U P;  1DDM A;  5C6R A;  5J3T A;  3X23 A;  1FHO A;  3KSY A;  2DTC A;  4K17 A;  4PQ0 A;  1MK7 B;  2DX1 A;  3PVW A;  2D9V A;  5C16 A;  2XQN M;  1FAO A;  2X18 A;  1N3H A;  2K2J A;  1AWE A;  1M7E A;  1DRO A;  1QQG A;  4C0A A;  5DI9 B;  3U7D A;  1BWN A;  3OAN A;  2EMT A;  2N0Y A;  2DKP A;  3ULB A;  4HB2 B;  2D2Q A;  1GC6 A;  1WGQ A;  3SNH A;  5C79 A;  2UZS A;  2RUK B;  2VSZ A;  4EKU A;  4HB0 B;  4ZRJ A;  2DYN A;  3F5R A;  2EC1 A;  1FGZ A;  5KCV A;  4HAT B;  3PVU A;  4HDQ A;  3FSS A;  3IVF A;  1BAK A;  1XR0 B;  4F7H A;  3NSU A;  4GXB A;  2RLO A;  1W1D A;  1WI1 A;  3RCP A;  3TFM A;  4IFS A;  1LB1 A;  2DYQ A;  2D9Y A;  1XKE A;  4TYZ A;  1RRP B;  1E5W A;  2D4Q A;  5DH9 B;  4GMX B;  3M1I B;  2W2X D;  5EFX A;  2P8V A;  2GCL A;  2MFQ A;  2ROZ B;  2HTH B;  4A6F B;  1MAI A;  2VKI A;  1P5T A;  3D8D A;  3KRX A;  5DHA B;  4CYE A;  2YS3 A;  1ZM0 A;  4GZU A;  1TQZ A;  2Y8F A;  1FHW A;  1FB8 A;  2OQB A;  4KVG B;  1W1G A;  3PG7 A;  3KRW A;  2W2X C;  1J19 A;  1U5F A;  2DFK A;  2M38 A;  3PVL A;  5LOP B;  2J0K A;  2JP2 A;  4KHB B;  1ZC4 B;  2YS5 A;  4NSW A;  3QWM A;  3FEH A;  2D11 A;  4HB3 B;  2COC A;  5JLJ B;  1NTY A;  2CAY A;  5D3X A;  2P0F A;  4P7I A;  1X11 A;  1WGU A;  2R09 A;  3P7Z A;  4HAV B;  1MIX A;  1EGX A;  2HE7 A;  3ODW A;  1XX0 A;  1OY2 A;  3HK0 A;  4HAX B;  4HAW B;  3GYP A;  4GMV A;  3PSC A;  4MT7 A;  1MPH A;  2D9X A;  1UNQ A;  2AEH A;  1MK9 B;  3U8Z A;  3O96 A;  2FJL A;  1ZVR A;  4HAZ B;  4A6K A;  1QC6 A;  4F7G A;  2YSZ A;  3DXC A;  2COF A;  2QKM A;  5C5B A;  3CIK A;  5HE1 A;  4HAY B;  2RSG A;  1Y5O A;  2RNR B;  4BBK A;  5FI0 A;  5KQ1 A;  3G9W A;  5DHF B;  3F0W A;  2KGX B;  3AU4 A;  2MWN B;  2DN6 A;  1PFJ A;  2NZ8 B;  3A8P A;  4ZRI A;  1XD4 A;  4A6H A;  1SGH A;  5D3Y A;  4K2O A;  1I7A A;  2UZR A;  3LJU X;  4WVF B;  1BTN A;  1V5P A;  1GC7 A;  3V5W A;  2LOX A;  5FI1 A;  5L81 A;  2J0J A;  2DA0 A;  2G35 A;  1NU2 A;  2Q13 A;  5KQ4 A;  4EMO A;  3PP2 A;  3SV1 A;  2YT1 A;  3KY9 A;  1J0W A;  2COA A;  3ODO A;  2I5C A;  1XOD A;  1MKE A;  3A98 B;  1B55 A;  2CY5 A;  2Z0Q A;  2DLW A;  2K2U A;  4Y94 A;  2ZPY A;  3SYX A;  3TW1 A;  3UZT A;  3DXE A;  4Z2N A;  2YRY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...