4WVFB

Crystal structure of kpt276 in complex with crm1-ran-ranbp1
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
138
structure length
130
Chain Sequence
b'IHFEPVVTMEEDEEVLYKVRAKLFRFDADAKEWKERGTGDCKFLKNKKTNKVRILMRRDKTLKICANHIIAPEYTLKPNVGSDRSWVYACTADIAEGEAEAFTFAIRFGSKENADKFKEEFEKAQEINKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTP-binding nuclear protein Ran
publication title Nuclear export inhibitors avert progression in preclinical models of inflammatory demyelination.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein/transport protein inhibitor
total genus 34
structure length 130
sequence length 138
ec nomenclature
pdb deposition date 2014-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00638 Ran_BP1 RanBP1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4wvfB00
2YT0A 2DA0A 3AU4A 2YS1A 3P7ZA 4IFSA 2I5CA 1FHWA 4ZRKA 2CODA 1U5GA 4HAUB 4ZRJA 4HAVB 4HB2B 4NSWA 3WA0A 4F7HA 3O96A 1Y19B 2M14A 3PVUA 2OTXA 3RCPA 3HQCA 2ELBA 1WJ1A 2BCJA 2DKQA 2W2WA 1FGZA 2AEHA 4GMVA 3WYFB 1OY2A 3V5WA 2DYQA 2D9WA 4KHOA 2MWNB 2KUPA 2GS0A 4TYZA 1X05A 2N0YA 1P6SA 4PQ0A 3TFMA 5C79A 1BAKA 3AU5A 4A6FB 2Y8FA 1WVHA 4ZRIA 4EKUA 4GN1A 3DXCA 4A6KA 2QKLA 2Z0OA 2J0JA 3DXEA 3PVWA 2H7DA 1FHXA 1UEFA 3FM8C 2RUKB 2E2XA 2COCA 2NMBA 4DXAB 2HE7A 1FHOA 5KQ4A 2G35A 2ADZA 1BTKA 3X23A 5C16A 1U2BA 1Z87A 1DDVA 1FAOA 2LG1A 1BTNA 1TJ6A 1XKEA 4WVFB 1V5PA 2Z0PA 4GPTB 3KY9A 5DH9B 4BBKA 3TO1A 1MK9B 4HB3B 1N3HA 2GCLA 3ZDTA 3LJUX 3ZVRA 1ISNA 2OQBA 1ZC4B 2DYNA 3KRXA 1DYNA 4A5KA 3HK0A 3PSCA 2UVMA 2DLWA 5J3TA 2QKMA 3D8EA 4WJ7A 2DTCA 5D3XA 1ZC3B 1GC6A 5HE3A 1XR0B 2HTHB 1U29A 2GCJA 1LB1A 5LONB 2D4QA 3PG7A 3GYOA 1RJ2A 3M1IB 1TQZA 3KRWA 3A98B 1WI1A 3D8FA 4L6EA 4YL8A 1SGHA 4HAWB 2DKPA 5HE1A 4NY0A 5FI0A 3QIJA 1V5MA 2V76A 2I1JA 5J3QA 3F0WA 3D8DA 2P0DA 3AJ4A 2RGNB 1WGUA 3ULBA 2X18A 1Q67A 3ULCA 3SUZA 5D3YA 2RVBB 2YVCA 1EF1A 2AL6A 2IFSA 2ROVA 2MFQA 1DBHA 4CYEA 4HATB 3U8ZA 1MAIA 3VOQA 4P7IA 2D9VA 3QBVB 3U7DA 1UNRA 4H8SA 4HHVA 1NU2A 5DI9B 2DHKA 1PLSA 2KCJA 4Y94A 4HAXB 1DDWA 1M7EA 1XX0A 2R09A 2W2XC 1U5EA 1ZSQA 2PZ1A 2NZ8B 3TVVA 1KZ7A 2UZRA 3PP2A 4IAPA 2L1CA 1B55A 1U5FA 2D9XA 1TXDA 3QWMA 4CHMA 1W1GA 2YS5A 5C5BA 2K2UA 1X1GA 2DFKA 2DX5A 2W2XD 1MK7B 1PMSA 3PZDA 2DN6A 1FOEA 2ROZB 1I7AA 3HW2B 2RLOA 4KVGB 2P8VA 2ZPYA 2IYBA 4YONA 1SHCA 5HE0A 5JLJB 2EMSA 2MKRA 3UZTA 1WG7A 2GJYA 3ODOA 4IOYX 1ZM0A 4HDQA 5D3VA 1XCGA 2Z0QA 1MIXA 4C0AA 3NSUA 4K81A 1H10A 1M7RA 2EC1A 2D9YA 5EFXA 1Y5OA 2Q13A 5KQ1A 2LKOA 5HE2A 3SV1A 4F7GA 2MDXA 4TKNA 2YF0A 1MIZB 2P0FA 2YSZA 3CXBB 2VSZA 2K2JA 2P0HA 4MK0A 1AQCA 4EJNA 1XODA 3TCAA 4F7UP 2LYDA 3SYXA 2LULA 4PNKA 1BWNA 1LW3A 3ML4A 2CY4A 3BJIA 2I5FA 3KSYA 1W1DA 2I1KA 1MPHA 1AWEA 5C5BB 3F5RA 1J0WA 3SNHA 4K2OA 4K17A 5DIFB 3P6AA 1EAZA 5JP4A 2YRYA 1GC7A 4DX90 1NTYA 5LOPB 1E5WA 1KZGA 1DDMA 1UNPA 5JHGA 1DROA 2L2IA 4HB0B 5CLLB 2COFA 1MKEA 2ELAA 1OQNA 1NTVA 1OMWA 4B6HA 1K5DB 2VRWB 2LOXA 2YS3A 2R0DA 1ZVRA 2M38A 1X86A 2COAA 2DX1A 4K2PA 5D27A 5L81A 3FEHA 4EMOA 1XD4A 3DXDA 3T06A 2Y7BA 4GZUA 2LOZA 1J19A 1V61A 1NI2A 4HDOA 4CHJA 1V5UA 4WSFA 2KGXB 1IRSA 5C6RA 1GG3A 1H4RA 2J0MA 2H7EA 4KAXB 2RNRB 2K00A 5DHFB 2CY5A 2D11A 2D2QA 3IVFA 2DHIA 5J3YA 1UPQA 4KHBB 1V89A 1U27A 3VIAA 1V88A 3PEGA 3PVLA 1U5DA 3SO6A 4HAZB 4KHAA 4HB4B 4XWXA 3OANA 1EVHA 3A8PA 5KCVA 2RSGA 1FB8A 1WJMA 4A6HA 4Z2MB 3TW1A 5FI1A 4DBBA 5CLQB 1P3RA 1QQGA 4DX8A 2JP2A 2DHJA 2N23A 1I2HA 2UZSA 2CRFA 5DHAB 2EJ8A 2YT1A 1P5TA 3MPXA 5D3WA 3A8QA 2D10A 2FJLA 3ODXA 2CAYA 2VKIA 4MY6A 2J59M 5GOWB 3MDBC 1QC6A 1UNQA 4D0NB 2EMTA 1K5GB 3G9WA 4GMXB 4A6FA 2J0KA 4Z2NA 3CIKA 1RRPB 1UPRA 3GYPA 4MT7A 1PFJA 2D9ZA 2Y8GA 3FSSA 3ODWA 1FGYA 5JHHA 2XQNM 3N7CA 1X1FA 1KI1B 1X11A 4GXBA 4HAYB 1W1HA 3BINA 1EGXA 1WGQA 3KZ1A
chains in the Genus database with same CATH superfamily
2YT0A 2DA0A 3AU4A 2YS1A 3P7ZA 5I2SA 4IFSA 2I5CA 1FHWA 4ZRKA 2CODA 1U5GA 4HAUB 4ZRJA 4HAVB 4HB2B 4NSWA 3WA0A 2KUQA 4F7HA 3O96A 1Y19B 2M14A 3PVUA 2OTXA 2K8EA 3HQCA 3RCPA 2ELBA 1WJ1A 2BCJA 2DKQA 2W2WA 1FGZA 2AEHA 4GMVA 3WYFB 1OY2A 4GOUA 3V5WA 2DYQA 2D9WA 4KHOA 2MWNB 2KUPA 1T77A 2GS0A 4TYZA 1X05A 2N0YA 1P6SA 4PQ0A 3TFMA 5C79A 1BAKA 3AU5A 4A6FB 2Y8FA 1WVHA 4ZRIA 4EKUA 4QJ3B 4GN1A 3DXCA 4A6KA 2QKLA 2Z0OA 2J0JA 3DXEA 3PVWA 2H7DA 1FHXA 1UEFA 3FM8C 3NWFA 2RUKB 2E2XA 2COCA 2NMBA 4DXAB 2HE7A 1FHOA 5KQ4A 2G35A 3U12A 2ADZA 1BTKA 3X23A 5C16A 1U2BA 1Z87A 1DDVA 1FAOA 2LG1A 1BTNA 1TJ6A 1XKEA 4WVFB 1V5PA 2Z0PA 4GPTB 2RRFA 3KY9A 5DH9B 4BBKA 3TO1A 1MK9B 4HB3B 4QXAB 3HIEA 1N3HA 2GCLA 3ZDTA 3LJUX 3ZVRA 2Z14A 4OT1A 1ISNA 2OQBA 5I2MA 1ZC4B 2DYNA 3KRXA 1DYNA 4A5KA 3HK0A 3PSCA 2UVMA 2DLWA 3HSAA 5J3TA 2QKMA 3D8EA 4WJ7A 2DTCA 5D3XA 1ZC3B 1GC6A 5HE3A 1XR0B 2HTHB 1U29A 2GCJA 1LB1A 5LONB 2D4QA 3PG7A 3GYOA 1RJ2A 3M1IB 1TQZA 3KRWA 3A98B 1WI1A 3D8FA 4L6EA 4YL8A 1SGHA 2Z13A 3FVCA 2FJUB 4HAWB 2DKPA 3NW8A 4CSQA 5HE1A 4NY0A 5FI0A 4QJ4B 3QIJA 1V5MA 2V76A 2I1JA 5J3QA 3F0WA 3D8DA 2P0DA 3AJ4A 2RGNB 1WGUA 3ULBA 2X18A 1Q67A 3ULCA 3SUZA 5D3YA 2RVBB 2YVCA 1EF1A 2Z4DA 2Z59A 2AL6A 2IFSA 2KR0A 2ROVA 2MFQA 1DBHA 4CYEA 3DCXA 4HATB 3U8ZA 1MAIA 3VOQA 4P7IA 2D9VA 3QBVB 3U7DA 1UNRA 4H8SA 4HHVA 1NU2A 5DI9B 2DHKA 1PLSA 2KCJA 4Y94A 4HAXB 3NWDA 1DDWA 1M7EA 1XX0A 2R09A 2W2XC 1U5EA 1ZSQA 2PZ1A 2NZ8B 3TVVA 1KZ7A 2UZRA 3PP2A 4IAPA 2L1CA 1B55A 1U5FA 2D9XA 1TXDA 3QWMA 4D6WA 4CHMA 1W1GA 2YS5A 5C5BA 2K2UA 1X1GA 2DFKA 2DX5A 2W2XD 1MK7B 1PMSA 3PZDA 2DN6A 1FOEA 2ROZB 4OSNA 1I7AA 3HW2B 2RLOA 4KVGB 2P8VA 2ZPYA 2IYBA 4YONA 1SHCA 5HE0A 5JLJB 2EMSA 2GUMA 2MKRA 3UZTA 1WG7A 2GJYA 3ODOA 4IOYX 1ZM0A 4HDQA 5D3VA 1XCGA 2Z0QA 1MIXA 4C0AA 3NSUA 4K81A 1H10A 1M7RA 2EC1A 2D9YA 5EFXA 1Y5OA 2Q13A 5KQ1A 2LKOA 5HE2A 3SV1A 4F7GA 2MDXA 4TKNA 2YF0A 1MIZB 2P0FA 2YSZA 3CXBB 2VSZA 2K2JA 2P0HA 4MK0A 1AQCA 4EJNA 1XODA 3TCAA 4F7UP 2LYDA 4HSIA 4DIXA 3SYXA 2LULA 4PNKA 1BWNA 1LW3A 3ML4A 2CY4A 3BJIA 2I5FA 3KSYA 1W1DA 2I1KA 1MPHA 1AWEA 5C5BB 3F5RA 4KHBA 1J0WA 3SNHA 4K2OA 4K17A 5DIFB 3P6AA 4QJ5B 1EAZA 5JP4A 2YRYA 1GC7A 4DX90 1NTYA 1ZYIA 5LOPB 1E5WA 1KZGA 1DDMA 1UNPA 5JHGA 1DROA 2L2IA 4HB0B 3A58A 5CLLB 2COFA 1MKEA 5M4YB 4GNKB 2ELAA 1OQNA 1NTVA 1OMWA 2R2YA 4B6HA 2YT2A 1K5DB 2VRWB 2LOXA 2YS3A 2R0DA 1ZVRA 2M38A 1X86A 2COAA 2DX1A 4K2PA 5D27A 5L81A 1MI1A 3FEHA 4EMOA 1XD4A 3DXDA 3T06A 2Y7BA 4GZUA 2LOZA 1J19A 1V61A 2KIGA 1NI2A 4HDOA 4CHJA 5LG4B 1V5UA 4WSFA 2KGXB 1IRSA 5C6RA 3B77A 1GG3A 1H4RA 2J0MA 2H7EA 4KAXB 2KIEA 2RNRB 2K00A 5DHFB 2CY5A 2D11A 2D2QA 3IVFA 2DHIA 5J3YA 1UPQA 4KHBB 1V89A 1U27A 3VIAA 1V88A 3PEGA 3PVLA 1U5DA 3SO6A 4HAZB 4KHAA 4HB4B 4XWXA 3OANA 1EVHA 3A8PA 5KCVA 2RSGA 1FB8A 1WJMA 4A6HA 4Z2MB 3TW1A 5FI1A 4DBBA 5CLQB 1P3RA 1QQGA 4DX8A 2JP2A 2N23A 2DHJA 1I2HA 5IRSA 2UZSA 2CRFA 5DHAB 2EJ8A 2YT1A 1P5TA 3MPXA 5D3WA 3A8QA 4L1RA 2D10A 2FJLA 3ODXA 2CAYA 2VKIA 4MY6A 2J59M 5GOWB 3MDBC 1QC6A 1UNQA 4D0NB 2EMTA 1K5GB 3G9WA 2NBVA 4GMXB 4A6FA 2J0KA 4Z2NA 3CIKA 1RRPB 1UPRA 2K49A 2ZKMX 3GYPA 4MT7A 1PFJA 2D9ZA 2Y8GA 3FSSA 3ODWA 1FGYA 3OHMB 5JHHA 2XQNM 3N7CA 1X1FA 1KI1B 3NWAA 1X11A 4GXBA 4HAYB 1W1HA 3BINA 1EGXA 1WGQA 3KZ1A
chains in the Genus database with same CATH topology
2YT0A 2DA0A 3AU4A 2YS1A 3P7ZA 4IFSA 2I5CA 1FHWA 4ZRKA 2CODA 1U5GA 4HAUB 4ZRJA 4HAVB 4HB2B 4NSWA 3WA0A 4F7HA 3O96A 1Y19B 2M14A 3PVUA 2OTXA 3RCPA 3HQCA 2ELBA 1WJ1A 2BCJA 2DKQA 2W2WA 1FGZA 2AEHA 4GMVA 3WYFB 1OY2A 3V5WA 2DYQA 2D9WA 4KHOA 2MWNB 2KUPA 2GS0A 4TYZA 1X05A 2N0YA 1P6SA 4PQ0A 3TFMA 5C79A 1BAKA 3AU5A 4A6FB 2Y8FA 1WVHA 4ZRIA 4EKUA 4GN1A 3DXCA 4A6KA 2QKLA 2Z0OA 2J0JA 3DXEA 3PVWA 2H7DA 1FHXA 1UEFA 3FM8C 2RUKB 2E2XA 2COCA 2NMBA 4DXAB 2HE7A 1FHOA 5KQ4A 2G35A 2ADZA 1BTKA 3X23A 5C16A 1U2BA 1Z87A 1DDVA 1FAOA 2LG1A 1BTNA 1TJ6A 1XKEA 4WVFB 1V5PA 2Z0PA 4GPTB 3KY9A 5DH9B 4BBKA 3TO1A 1MK9B 4HB3B 1N3HA 2GCLA 3ZDTA 3LJUX 3ZVRA 1ISNA 2OQBA 1ZC4B 2DYNA 3KRXA 1DYNA 4A5KA 3HK0A 3PSCA 2UVMA 2DLWA 5J3TA 2QKMA 3D8EA 4WJ7A 2DTCA 5D3XA 1ZC3B 1GC6A 5HE3A 1XR0B 2HTHB 1U29A 2GCJA 1LB1A 5LONB 2D4QA 3PG7A 3GYOA 1RJ2A 3M1IB 1TQZA 3KRWA 3A98B 1WI1A 3D8FA 4L6EA 4YL8A 1SGHA 4HAWB 2DKPA 5HE1A 4NY0A 5FI0A 3QIJA 1V5MA 2V76A 2I1JA 5J3QA 3F0WA 3D8DA 2P0DA 3AJ4A 2RGNB 1WGUA 3ULBA 2X18A 1Q67A 3ULCA 3SUZA 5D3YA 2RVBB 2YVCA 1EF1A 2AL6A 2IFSA 2ROVA 2MFQA 1DBHA 4CYEA 4HATB 3U8ZA 1MAIA 3VOQA 4P7IA 2D9VA 3QBVB 3U7DA 1UNRA 4H8SA 4HHVA 1NU2A 5DI9B 2DHKA 1PLSA 2KCJA 4Y94A 4HAXB 1DDWA 1M7EA 1XX0A 2R09A 2W2XC 1U5EA 1ZSQA 2PZ1A 2NZ8B 3TVVA 1KZ7A 2UZRA 3PP2A 4IAPA 2L1CA 1B55A 1U5FA 2D9XA 1TXDA 3QWMA 4CHMA 1W1GA 2YS5A 5C5BA 2K2UA 1X1GA 2DFKA 2DX5A 2W2XD 1MK7B 1PMSA 3PZDA 2DN6A 1FOEA 2ROZB 1I7AA 3HW2B 2RLOA 4KVGB 2P8VA 2ZPYA 2IYBA 4YONA 1SHCA 5HE0A 5JLJB 2EMSA 2MKRA 3UZTA 1WG7A 2GJYA 3ODOA 4IOYX 1ZM0A 4HDQA 5D3VA 1XCGA 2Z0QA 1MIXA 4C0AA 3NSUA 4K81A 1H10A 1M7RA 2EC1A 2D9YA 5EFXA 1Y5OA 2Q13A 5KQ1A 2LKOA 5HE2A 3SV1A 4F7GA 2MDXA 4TKNA 2YF0A 1MIZB 2P0FA 2YSZA 3CXBB 2VSZA 2K2JA 2P0HA 4MK0A 1AQCA 4EJNA 1XODA 3TCAA 4F7UP 2LYDA 3SYXA 2LULA 4PNKA 1BWNA 1LW3A 3ML4A 2CY4A 3BJIA 2I5FA 3KSYA 1W1DA 2I1KA 1MPHA 1AWEA 5C5BB 3F5RA 1J0WA 3SNHA 4K2OA 4K17A 5DIFB 3P6AA 1EAZA 5JP4A 2YRYA 1GC7A 4DX90 1NTYA 5LOPB 1E5WA 1KZGA 1DDMA 1UNPA 5JHGA 1DROA 2L2IA 4HB0B 5CLLB 2COFA 1MKEA 2ELAA 1OQNA 1NTVA 1OMWA 4B6HA 1K5DB 2VRWB 2LOXA 2YS3A 2R0DA 1ZVRA 2M38A 1X86A 2COAA 2DX1A 4K2PA 5D27A 5L81A 3FEHA 4EMOA 1XD4A 3DXDA 3T06A 2Y7BA 4GZUA 2LOZA 1J19A 1V61A 1NI2A 4HDOA 4CHJA 1V5UA 4WSFA 2KGXB 1IRSA 5C6RA 1GG3A 1H4RA 2J0MA 2H7EA 4KAXB 2RNRB 2K00A 5DHFB 2CY5A 2D11A 2D2QA 3IVFA 2DHIA 5J3YA 1UPQA 4KHBB 1V89A 1U27A 3VIAA 1V88A 3PEGA 3PVLA 1U5DA 3SO6A 4HAZB 4KHAA 4HB4B 4XWXA 3OANA 1EVHA 3A8PA 5KCVA 2RSGA 1FB8A 1WJMA 4A6HA 4Z2MB 3TW1A 5FI1A 4DBBA 5CLQB 1P3RA 1QQGA 4DX8A 2JP2A 2DHJA 2N23A 1I2HA 2UZSA 2CRFA 5DHAB 2EJ8A 2YT1A 1P5TA 3MPXA 5D3WA 3A8QA 2D10A 2FJLA 3ODXA 2CAYA 2VKIA 4MY6A 2J59M 5GOWB 3MDBC 1QC6A 1UNQA 4D0NB 2EMTA 1K5GB 3G9WA 4GMXB 4A6FA 2J0KA 4Z2NA 3CIKA 1RRPB 1UPRA 3GYPA 4MT7A 1PFJA 2D9ZA 2Y8GA 3FSSA 3ODWA 1FGYA 5JHHA 2XQNM 3N7CA 1X1FA 1KI1B 1X11A 4GXBA 4HAYB 1W1HA 3BINA 1EGXA 1WGQA 3KZ1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YT0 A;  2DA0 A;  3AU4 A;  2YS1 A;  3P7Z A;  4IFS A;  2I5C A;  1FHW A;  4ZRK A;  2COD A;  1U5G A;  4HAU B;  4ZRJ A;  4HAV B;  4HB2 B;  4NSW A;  3WA0 A;  4F7H A;  3O96 A;  1Y19 B;  2M14 A;  3PVU A;  2OTX A;  3RCP A;  3HQC A;  2ELB A;  1WJ1 A;  2BCJ A;  2DKQ A;  2W2W A;  1FGZ A;  2AEH A;  4GMV A;  3WYF B;  1OY2 A;  3V5W A;  2DYQ A;  2D9W A;  4KHO A;  2MWN B;  2KUP A;  2GS0 A;  4TYZ A;  1X05 A;  2N0Y A;  1P6S A;  4PQ0 A;  3TFM A;  5C79 A;  1BAK A;  3AU5 A;  4A6F B;  2Y8F A;  1WVH A;  4ZRI A;  4EKU A;  4GN1 A;  3DXC A;  4A6K A;  2QKL A;  2Z0O A;  2J0J A;  3DXE A;  3PVW A;  2H7D A;  1FHX A;  1UEF A;  3FM8 C;  2RUK B;  2E2X A;  2COC A;  2NMB A;  4DXA B;  2HE7 A;  1FHO A;  5KQ4 A;  2G35 A;  2ADZ A;  1BTK A;  3X23 A;  5C16 A;  1U2B A;  1Z87 A;  1DDV A;  1FAO A;  2LG1 A;  1BTN A;  1TJ6 A;  1XKE A;  4WVF B;  1V5P A;  2Z0P A;  4GPT B;  3KY9 A;  5DH9 B;  4BBK A;  3TO1 A;  1MK9 B;  4HB3 B;  1N3H A;  2GCL A;  3ZDT A;  3LJU X;  3ZVR A;  1ISN A;  2OQB A;  1ZC4 B;  2DYN A;  3KRX A;  1DYN A;  4A5K A;  3HK0 A;  3PSC A;  2UVM A;  2DLW A;  5J3T A;  2QKM A;  3D8E A;  4WJ7 A;  2DTC A;  5D3X A;  1ZC3 B;  1GC6 A;  5HE3 A;  1XR0 B;  2HTH B;  1U29 A;  2GCJ A;  1LB1 A;  5LON B;  2D4Q A;  3PG7 A;  3GYO A;  1RJ2 A;  3M1I B;  1TQZ A;  3KRW A;  3A98 B;  1WI1 A;  3D8F A;  4L6E A;  4YL8 A;  1SGH A;  4HAW B;  2DKP A;  5HE1 A;  4NY0 A;  5FI0 A;  3QIJ A;  1V5M A;  2V76 A;  2I1J A;  5J3Q A;  3F0W A;  3D8D A;  2P0D A;  3AJ4 A;  2RGN B;  1WGU A;  3ULB A;  2X18 A;  1Q67 A;  3ULC A;  3SUZ A;  5D3Y A;  2RVB B;  2YVC A;  1EF1 A;  2AL6 A;  2IFS A;  2ROV A;  2MFQ A;  1DBH A;  4CYE A;  4HAT B;  3U8Z A;  1MAI A;  3VOQ A;  4P7I A;  2D9V A;  3QBV B;  3U7D A;  1UNR A;  4H8S A;  4HHV A;  1NU2 A;  5DI9 B;  2DHK A;  1PLS A;  2KCJ A;  4Y94 A;  4HAX B;  1DDW A;  1M7E A;  1XX0 A;  2R09 A;  2W2X C;  1U5E A;  1ZSQ A;  2PZ1 A;  2NZ8 B;  3TVV A;  1KZ7 A;  2UZR A;  3PP2 A;  4IAP A;  2L1C A;  1B55 A;  1U5F A;  2D9X A;  1TXD A;  3QWM A;  4CHM A;  1W1G A;  2YS5 A;  5C5B A;  2K2U A;  1X1G A;  2DFK A;  2DX5 A;  2W2X D;  1MK7 B;  1PMS A;  3PZD A;  2DN6 A;  1FOE A;  2ROZ B;  1I7A A;  3HW2 B;  2RLO A;  4KVG B;  2P8V A;  2ZPY A;  2IYB A;  4YON A;  1SHC A;  5HE0 A;  5JLJ B;  2EMS A;  2MKR A;  3UZT A;  1WG7 A;  2GJY A;  3ODO A;  4IOY X;  1ZM0 A;  4HDQ A;  5D3V A;  1XCG A;  2Z0Q A;  1MIX A;  4C0A A;  3NSU A;  4K81 A;  1H10 A;  1M7R A;  2EC1 A;  2D9Y A;  5EFX A;  1Y5O A;  2Q13 A;  5KQ1 A;  2LKO A;  5HE2 A;  3SV1 A;  4F7G A;  2MDX A;  4TKN A;  2YF0 A;  1MIZ B;  2P0F A;  2YSZ A;  3CXB B;  2VSZ A;  2K2J A;  2P0H A;  4MK0 A;  1AQC A;  4EJN A;  1XOD A;  3TCA A;  4F7U P;  2LYD A;  3SYX A;  2LUL A;  4PNK A;  1BWN A;  1LW3 A;  3ML4 A;  2CY4 A;  3BJI A;  2I5F A;  3KSY A;  1W1D A;  2I1K A;  1MPH A;  1AWE A;  5C5B B;  3F5R A;  1J0W A;  3SNH A;  4K2O A;  4K17 A;  5DIF B;  3P6A A;  1EAZ A;  5JP4 A;  2YRY A;  1GC7 A;  4DX9 0;  1NTY A;  5LOP B;  1E5W A;  1KZG A;  1DDM A;  1UNP A;  5JHG A;  1DRO A;  2L2I A;  4HB0 B;  5CLL B;  2COF A;  1MKE A;  2ELA A;  1OQN A;  1NTV A;  1OMW A;  4B6H A;  1K5D B;  2VRW B;  2LOX A;  2YS3 A;  2R0D A;  1ZVR A;  2M38 A;  1X86 A;  2COA A;  2DX1 A;  4K2P A;  5D27 A;  5L81 A;  3FEH A;  4EMO A;  1XD4 A;  3DXD A;  3T06 A;  2Y7B A;  4GZU A;  2LOZ A;  1J19 A;  1V61 A;  1NI2 A;  4HDO A;  4CHJ A;  1V5U A;  4WSF A;  2KGX B;  1IRS A;  5C6R A;  1GG3 A;  1H4R A;  2J0M A;  2H7E A;  4KAX B;  2RNR B;  2K00 A;  5DHF B;  2CY5 A;  2D11 A;  2D2Q A;  3IVF A;  2DHI A;  5J3Y A;  1UPQ A;  4KHB B;  1V89 A;  1U27 A;  3VIA A;  1V88 A;  3PEG A;  3PVL A;  1U5D A;  3SO6 A;  4HAZ B;  4KHA A;  4HB4 B;  4XWX A;  3OAN A;  1EVH A;  3A8P A;  5KCV A;  2RSG A;  1FB8 A;  1WJM A;  4A6H A;  4Z2M B;  3TW1 A;  5FI1 A;  4DBB A;  5CLQ B;  1P3R A;  1QQG A;  4DX8 A;  2JP2 A;  2DHJ A;  2N23 A;  1I2H A;  2UZS A;  2CRF A;  5DHA B;  2EJ8 A;  2YT1 A;  1P5T A;  3MPX A;  5D3W A;  3A8Q A;  2D10 A;  2FJL A;  3ODX A;  2CAY A;  2VKI A;  4MY6 A;  2J59 M;  5GOW B;  3MDB C;  1QC6 A;  1UNQ A;  4D0N B;  2EMT A;  1K5G B;  3G9W A;  4GMX B;  4A6F A;  2J0K A;  4Z2N A;  3CIK A;  1RRP B;  1UPR A;  3GYP A;  4MT7 A;  1PFJ A;  2D9Z A;  2Y8G A;  3FSS A;  3ODW A;  1FGY A;  5JHH A;  2XQN M;  3N7C A;  1X1F A;  1KI1 B;  1X11 A;  4GXB A;  4HAY B;  1W1H A;  3BIN A;  1EGX A;  1WGQ A;  3KZ1 A; 
#chains in the Genus database with same CATH topology
 2YT0 A;  2DA0 A;  3AU4 A;  2YS1 A;  3P7Z A;  5I2S A;  4IFS A;  2I5C A;  1FHW A;  4ZRK A;  2COD A;  1U5G A;  4HAU B;  4ZRJ A;  4HAV B;  4HB2 B;  4NSW A;  3WA0 A;  2KUQ A;  4F7H A;  3O96 A;  1Y19 B;  2M14 A;  3PVU A;  2OTX A;  2K8E A;  3HQC A;  3RCP A;  2ELB A;  1WJ1 A;  2BCJ A;  2DKQ A;  2W2W A;  1FGZ A;  2AEH A;  4GMV A;  3WYF B;  1OY2 A;  4GOU A;  3V5W A;  2DYQ A;  2D9W A;  4KHO A;  2MWN B;  2KUP A;  1T77 A;  2GS0 A;  4TYZ A;  1X05 A;  2N0Y A;  1P6S A;  4PQ0 A;  3TFM A;  5C79 A;  1BAK A;  3AU5 A;  4A6F B;  2Y8F A;  1WVH A;  4ZRI A;  4EKU A;  4QJ3 B;  4GN1 A;  3DXC A;  4A6K A;  2QKL A;  2Z0O A;  2J0J A;  3DXE A;  3PVW A;  2H7D A;  1FHX A;  1UEF A;  3FM8 C;  3NWF A;  2RUK B;  2E2X A;  2COC A;  2NMB A;  4DXA B;  2HE7 A;  1FHO A;  5KQ4 A;  2G35 A;  3U12 A;  2ADZ A;  1BTK A;  3X23 A;  5C16 A;  1U2B A;  1Z87 A;  1DDV A;  1FAO A;  2LG1 A;  1BTN A;  1TJ6 A;  1XKE A;  4WVF B;  1V5P A;  2Z0P A;  4GPT B;  2RRF A;  3KY9 A;  5DH9 B;  4BBK A;  3TO1 A;  1MK9 B;  4HB3 B;  4QXA B;  3HIE A;  1N3H A;  2GCL A;  3ZDT A;  3LJU X;  3ZVR A;  2Z14 A;  4OT1 A;  1ISN A;  2OQB A;  5I2M A;  1ZC4 B;  2DYN A;  3KRX A;  1DYN A;  4A5K A;  3HK0 A;  3PSC A;  2UVM A;  2DLW A;  3HSA A;  5J3T A;  2QKM A;  3D8E A;  4WJ7 A;  2DTC A;  5D3X A;  1ZC3 B;  1GC6 A;  5HE3 A;  1XR0 B;  2HTH B;  1U29 A;  2GCJ A;  1LB1 A;  5LON B;  2D4Q A;  3PG7 A;  3GYO A;  1RJ2 A;  3M1I B;  1TQZ A;  3KRW A;  3A98 B;  1WI1 A;  3D8F A;  4L6E A;  4YL8 A;  1SGH A;  2Z13 A;  3FVC A;  2FJU B;  4HAW B;  2DKP A;  3NW8 A;  4CSQ A;  5HE1 A;  4NY0 A;  5FI0 A;  4QJ4 B;  3QIJ A;  1V5M A;  2V76 A;  2I1J A;  5J3Q A;  3F0W A;  3D8D A;  2P0D A;  3AJ4 A;  2RGN B;  1WGU A;  3ULB A;  2X18 A;  1Q67 A;  3ULC A;  3SUZ A;  5D3Y A;  2RVB B;  2YVC A;  1EF1 A;  2Z4D A;  2Z59 A;  2AL6 A;  2IFS A;  2KR0 A;  2ROV A;  2MFQ A;  1DBH A;  4CYE A;  3DCX A;  4HAT B;  3U8Z A;  1MAI A;  3VOQ A;  4P7I A;  2D9V A;  3QBV B;  3U7D A;  1UNR A;  4H8S A;  4HHV A;  1NU2 A;  5DI9 B;  2DHK A;  1PLS A;  2KCJ A;  4Y94 A;  4HAX B;  3NWD A;  1DDW A;  1M7E A;  1XX0 A;  2R09 A;  2W2X C;  1U5E A;  1ZSQ A;  2PZ1 A;  2NZ8 B;  3TVV A;  1KZ7 A;  2UZR A;  3PP2 A;  4IAP A;  2L1C A;  1B55 A;  1U5F A;  2D9X A;  1TXD A;  3QWM A;  4D6W A;  4CHM A;  1W1G A;  2YS5 A;  5C5B A;  2K2U A;  1X1G A;  2DFK A;  2DX5 A;  2W2X D;  1MK7 B;  1PMS A;  3PZD A;  2DN6 A;  1FOE A;  2ROZ B;  4OSN A;  1I7A A;  3HW2 B;  2RLO A;  4KVG B;  2P8V A;  2ZPY A;  2IYB A;  4YON A;  1SHC A;  5HE0 A;  5JLJ B;  2EMS A;  2GUM A;  2MKR A;  3UZT A;  1WG7 A;  2GJY A;  3ODO A;  4IOY X;  1ZM0 A;  4HDQ A;  5D3V A;  1XCG A;  2Z0Q A;  1MIX A;  4C0A A;  3NSU A;  4K81 A;  1H10 A;  1M7R A;  2EC1 A;  2D9Y A;  5EFX A;  1Y5O A;  2Q13 A;  5KQ1 A;  2LKO A;  5HE2 A;  3SV1 A;  4F7G A;  2MDX A;  4TKN A;  2YF0 A;  1MIZ B;  2P0F A;  2YSZ A;  3CXB B;  2VSZ A;  2K2J A;  2P0H A;  4MK0 A;  1AQC A;  4EJN A;  1XOD A;  3TCA A;  4F7U P;  2LYD A;  4HSI A;  4DIX A;  3SYX A;  2LUL A;  4PNK A;  1BWN A;  1LW3 A;  3ML4 A;  2CY4 A;  3BJI A;  2I5F A;  3KSY A;  1W1D A;  2I1K A;  1MPH A;  1AWE A;  5C5B B;  3F5R A;  4KHB A;  1J0W A;  3SNH A;  4K2O A;  4K17 A;  5DIF B;  3P6A A;  4QJ5 B;  1EAZ A;  5JP4 A;  2YRY A;  1GC7 A;  4DX9 0;  1NTY A;  1ZYI A;  5LOP B;  1E5W A;  1KZG A;  1DDM A;  1UNP A;  5JHG A;  1DRO A;  2L2I A;  4HB0 B;  3A58 A;  5CLL B;  2COF A;  1MKE A;  5M4Y B;  4GNK B;  2ELA A;  1OQN A;  1NTV A;  1OMW A;  2R2Y A;  4B6H A;  2YT2 A;  1K5D B;  2VRW B;  2LOX A;  2YS3 A;  2R0D A;  1ZVR A;  2M38 A;  1X86 A;  2COA A;  2DX1 A;  4K2P A;  5D27 A;  5L81 A;  1MI1 A;  3FEH A;  4EMO A;  1XD4 A;  3DXD A;  3T06 A;  2Y7B A;  4GZU A;  2LOZ A;  1J19 A;  1V61 A;  2KIG A;  1NI2 A;  4HDO A;  4CHJ A;  5LG4 B;  1V5U A;  4WSF A;  2KGX B;  1IRS A;  5C6R A;  3B77 A;  1GG3 A;  1H4R A;  2J0M A;  2H7E A;  4KAX B;  2KIE A;  2RNR B;  2K00 A;  5DHF B;  2CY5 A;  2D11 A;  2D2Q A;  3IVF A;  2DHI A;  5J3Y A;  1UPQ A;  4KHB B;  1V89 A;  1U27 A;  3VIA A;  1V88 A;  3PEG A;  3PVL A;  1U5D A;  3SO6 A;  4HAZ B;  4KHA A;  4HB4 B;  4XWX A;  3OAN A;  1EVH A;  3A8P A;  5KCV A;  2RSG A;  1FB8 A;  1WJM A;  4A6H A;  4Z2M B;  3TW1 A;  5FI1 A;  4DBB A;  5CLQ B;  1P3R A;  1QQG A;  4DX8 A;  2JP2 A;  2N23 A;  2DHJ A;  1I2H A;  5IRS A;  2UZS A;  2CRF A;  5DHA B;  2EJ8 A;  2YT1 A;  1P5T A;  3MPX A;  5D3W A;  3A8Q A;  4L1R A;  2D10 A;  2FJL A;  3ODX A;  2CAY A;  2VKI A;  4MY6 A;  2J59 M;  5GOW B;  3MDB C;  1QC6 A;  1UNQ A;  4D0N B;  2EMT A;  1K5G B;  3G9W A;  2NBV A;  4GMX B;  4A6F A;  2J0K A;  4Z2N A;  3CIK A;  1RRP B;  1UPR A;  2K49 A;  2ZKM X;  3GYP A;  4MT7 A;  1PFJ A;  2D9Z A;  2Y8G A;  3FSS A;  3ODW A;  1FGY A;  3OHM B;  5JHH A;  2XQN M;  3N7C A;  1X1F A;  1KI1 B;  3NWA A;  1X11 A;  4GXB A;  4HAY B;  1W1H A;  3BIN A;  1EGX A;  1WGQ A;  3KZ1 A; 
#chains in the Genus database with same CATH homology
 2YT0 A;  2DA0 A;  3AU4 A;  2YS1 A;  3P7Z A;  4IFS A;  2I5C A;  1FHW A;  4ZRK A;  2COD A;  1U5G A;  4HAU B;  4ZRJ A;  4HAV B;  4HB2 B;  4NSW A;  3WA0 A;  4F7H A;  3O96 A;  1Y19 B;  2M14 A;  3PVU A;  2OTX A;  3RCP A;  3HQC A;  2ELB A;  1WJ1 A;  2BCJ A;  2DKQ A;  2W2W A;  1FGZ A;  2AEH A;  4GMV A;  3WYF B;  1OY2 A;  3V5W A;  2DYQ A;  2D9W A;  4KHO A;  2MWN B;  2KUP A;  2GS0 A;  4TYZ A;  1X05 A;  2N0Y A;  1P6S A;  4PQ0 A;  3TFM A;  5C79 A;  1BAK A;  3AU5 A;  4A6F B;  2Y8F A;  1WVH A;  4ZRI A;  4EKU A;  4GN1 A;  3DXC A;  4A6K A;  2QKL A;  2Z0O A;  2J0J A;  3DXE A;  3PVW A;  2H7D A;  1FHX A;  1UEF A;  3FM8 C;  2RUK B;  2E2X A;  2COC A;  2NMB A;  4DXA B;  2HE7 A;  1FHO A;  5KQ4 A;  2G35 A;  2ADZ A;  1BTK A;  3X23 A;  5C16 A;  1U2B A;  1Z87 A;  1DDV A;  1FAO A;  2LG1 A;  1BTN A;  1TJ6 A;  1XKE A;  4WVF B;  1V5P A;  2Z0P A;  4GPT B;  3KY9 A;  5DH9 B;  4BBK A;  3TO1 A;  1MK9 B;  4HB3 B;  1N3H A;  2GCL A;  3ZDT A;  3LJU X;  3ZVR A;  1ISN A;  2OQB A;  1ZC4 B;  2DYN A;  3KRX A;  1DYN A;  4A5K A;  3HK0 A;  3PSC A;  2UVM A;  2DLW A;  5J3T A;  2QKM A;  3D8E A;  4WJ7 A;  2DTC A;  5D3X A;  1ZC3 B;  1GC6 A;  5HE3 A;  1XR0 B;  2HTH B;  1U29 A;  2GCJ A;  1LB1 A;  5LON B;  2D4Q A;  3PG7 A;  3GYO A;  1RJ2 A;  3M1I B;  1TQZ A;  3KRW A;  3A98 B;  1WI1 A;  3D8F A;  4L6E A;  4YL8 A;  1SGH A;  4HAW B;  2DKP A;  5HE1 A;  4NY0 A;  5FI0 A;  3QIJ A;  1V5M A;  2V76 A;  2I1J A;  5J3Q A;  3F0W A;  3D8D A;  2P0D A;  3AJ4 A;  2RGN B;  1WGU A;  3ULB A;  2X18 A;  1Q67 A;  3ULC A;  3SUZ A;  5D3Y A;  2RVB B;  2YVC A;  1EF1 A;  2AL6 A;  2IFS A;  2ROV A;  2MFQ A;  1DBH A;  4CYE A;  4HAT B;  3U8Z A;  1MAI A;  3VOQ A;  4P7I A;  2D9V A;  3QBV B;  3U7D A;  1UNR A;  4H8S A;  4HHV A;  1NU2 A;  5DI9 B;  2DHK A;  1PLS A;  2KCJ A;  4Y94 A;  4HAX B;  1DDW A;  1M7E A;  1XX0 A;  2R09 A;  2W2X C;  1U5E A;  1ZSQ A;  2PZ1 A;  2NZ8 B;  3TVV A;  1KZ7 A;  2UZR A;  3PP2 A;  4IAP A;  2L1C A;  1B55 A;  1U5F A;  2D9X A;  1TXD A;  3QWM A;  4CHM A;  1W1G A;  2YS5 A;  5C5B A;  2K2U A;  1X1G A;  2DFK A;  2DX5 A;  2W2X D;  1MK7 B;  1PMS A;  3PZD A;  2DN6 A;  1FOE A;  2ROZ B;  1I7A A;  3HW2 B;  2RLO A;  4KVG B;  2P8V A;  2ZPY A;  2IYB A;  4YON A;  1SHC A;  5HE0 A;  5JLJ B;  2EMS A;  2MKR A;  3UZT A;  1WG7 A;  2GJY A;  3ODO A;  4IOY X;  1ZM0 A;  4HDQ A;  5D3V A;  1XCG A;  2Z0Q A;  1MIX A;  4C0A A;  3NSU A;  4K81 A;  1H10 A;  1M7R A;  2EC1 A;  2D9Y A;  5EFX A;  1Y5O A;  2Q13 A;  5KQ1 A;  2LKO A;  5HE2 A;  3SV1 A;  4F7G A;  2MDX A;  4TKN A;  2YF0 A;  1MIZ B;  2P0F A;  2YSZ A;  3CXB B;  2VSZ A;  2K2J A;  2P0H A;  4MK0 A;  1AQC A;  4EJN A;  1XOD A;  3TCA A;  4F7U P;  2LYD A;  3SYX A;  2LUL A;  4PNK A;  1BWN A;  1LW3 A;  3ML4 A;  2CY4 A;  3BJI A;  2I5F A;  3KSY A;  1W1D A;  2I1K A;  1MPH A;  1AWE A;  5C5B B;  3F5R A;  1J0W A;  3SNH A;  4K2O A;  4K17 A;  5DIF B;  3P6A A;  1EAZ A;  5JP4 A;  2YRY A;  1GC7 A;  4DX9 0;  1NTY A;  5LOP B;  1E5W A;  1KZG A;  1DDM A;  1UNP A;  5JHG A;  1DRO A;  2L2I A;  4HB0 B;  5CLL B;  2COF A;  1MKE A;  2ELA A;  1OQN A;  1NTV A;  1OMW A;  4B6H A;  1K5D B;  2VRW B;  2LOX A;  2YS3 A;  2R0D A;  1ZVR A;  2M38 A;  1X86 A;  2COA A;  2DX1 A;  4K2P A;  5D27 A;  5L81 A;  3FEH A;  4EMO A;  1XD4 A;  3DXD A;  3T06 A;  2Y7B A;  4GZU A;  2LOZ A;  1J19 A;  1V61 A;  1NI2 A;  4HDO A;  4CHJ A;  1V5U A;  4WSF A;  2KGX B;  1IRS A;  5C6R A;  1GG3 A;  1H4R A;  2J0M A;  2H7E A;  4KAX B;  2RNR B;  2K00 A;  5DHF B;  2CY5 A;  2D11 A;  2D2Q A;  3IVF A;  2DHI A;  5J3Y A;  1UPQ A;  4KHB B;  1V89 A;  1U27 A;  3VIA A;  1V88 A;  3PEG A;  3PVL A;  1U5D A;  3SO6 A;  4HAZ B;  4KHA A;  4HB4 B;  4XWX A;  3OAN A;  1EVH A;  3A8P A;  5KCV A;  2RSG A;  1FB8 A;  1WJM A;  4A6H A;  4Z2M B;  3TW1 A;  5FI1 A;  4DBB A;  5CLQ B;  1P3R A;  1QQG A;  4DX8 A;  2JP2 A;  2DHJ A;  2N23 A;  1I2H A;  2UZS A;  2CRF A;  5DHA B;  2EJ8 A;  2YT1 A;  1P5T A;  3MPX A;  5D3W A;  3A8Q A;  2D10 A;  2FJL A;  3ODX A;  2CAY A;  2VKI A;  4MY6 A;  2J59 M;  5GOW B;  3MDB C;  1QC6 A;  1UNQ A;  4D0N B;  2EMT A;  1K5G B;  3G9W A;  4GMX B;  4A6F A;  2J0K A;  4Z2N A;  3CIK A;  1RRP B;  1UPR A;  3GYP A;  4MT7 A;  1PFJ A;  2D9Z A;  2Y8G A;  3FSS A;  3ODW A;  1FGY A;  5JHH A;  2XQN M;  3N7C A;  1X1F A;  1KI1 B;  1X11 A;  4GXB A;  4HAY B;  1W1H A;  3BIN A;  1EGX A;  1WGQ A;  3KZ1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...