1UPQA

Crystal structure of the pleckstrin homology (ph) domain of pepp1
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
107
structure length
107
Chain Sequence
LRRDPNLPVHIRGWLHKQDSSGLRLWKRRWFVLSGHCLFYYKDSREESVLGSVLLPSYNIRPDGPGAPRGRRFTFTAEHPGMRTYVLAADTLEDLRGWLRALGRASR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signal transduction
molecule keywords PEPP1
publication title Crystal Structure of the Pleckstrin Homology Domain of Pepp1
rcsb
source organism Homo sapiens
total genus 20
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 2003-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1upqA00
1LB1A 1SHCA 2KGXB 2HTHB 2I5FA 2BCJA 3A8QA 2CODA 4GMVA 2L1CA 1MAIA 3HK0A 2GS0A 1V89A 1FHOA 2R0DA 1MK9B 5HE2A 5C16A 2YRYA 3M1IB 3VOQA 1XX0A 5J3TA 1K5DB 1GC7A 5JHHA 5CLLB 5D3YA 1RJ2A 2YF0A 2DHKA 2DYQA 3FSSA 2YS5A 3SNHA 4CHJA 1MIXA 1FAOA 1V5UA 3QWMA 2J0KA 1SGHA 3SYXA 3HW2B 1XCGA 1NTVA 2D10A 4CHMA 4DX90 2DLWA 1BTNA 3TVVA 1V5PA 4EKUA 3T06A 2AEHA 3IVFA 2CY4A 1X86A 1PMSA 3KSYA 2Y8GA 2QKMA 4HAXB 4KAXB 4MT7A 5DI9B 3U8ZA 2DX1A 3SO6A 1U5EA 1XKEA 2MWNB 4D0NB 3MPXA 2D9XA 2EMTA 2D9ZA 2OTXA 4KHAA 4A5KA 5HE3A 1MIZB 2HE7A 4KHOA 1I2HA 3AU4A 5LONB 4C0AA 2DN6A 3ZVRA 1UNRA 1PFJA 2DHJA 2YSZA 2RNRB 2ELAA 4K17A 5J3QA 1ISNA 2DTCA 1X1GA 1J0WA 2L2IA 1X11A 2UVMA 2EC1A 1EF1A 4DXAB 1Z87A 2J59M 1XODA 4TYZA 3PSCA 3BINA 2QKLA 4GMXB 1U5DA 2XQNM 4YONA 3ZDTA 4HB0B 4KHBB 1FHWA 3QBVB 2Z0PA 3OANA 1W1HA 4NSWA 1TXDA 2YS1A 1WJMA 4WSFA 4PNKA 2YVCA 3KRWA 2LULA 3GYOA 1U5GA 2W2WA 5FI1A 3AJ4A 3BJIA 1GG3A 4K2OA 2Y8FA 1UNPA 1WI1A 2LG1A 2DYNA 4K81A 2GCJA 4ZRJA 3AU5A 2Z0QA 4L6EA 3TFMA 1DDMA 3D8FA 1U5FA 4KVGB 3WYFB 4GXBA 1WG7A 2D9YA 1M7EA 1DDVA 2GJYA 3TCAA 1ZC3B 4HAUB 3N7CA 1QC6A 3PVLA 4ZRKA 1EAZA 5HE0A 4EMOA 1EVHA 1XD4A 1ZM0A 1E5WA 3DXDA 5KCVA 1Y5OA 1FGZA 2W2XC 4WVFB 1FGYA 4GZUA 1DROA 3V5WA 1WJ1A 3D8DA 2H7DA 2ROVA 4IFSA 4HHVA 1EGXA 2J0JA 3NSUA 1OY2A 2J0MA 4DX8A 2ROZB 5LOPB 2I5CA 2VRWB 5JLJB 4H8SA 3PVUA 2YT1A 1TQZA 3SV1A 1ZVRA 4HB2B 3CIKA 5D3VA 2CRFA 1ZSQA 1BAKA 4Y94A 2D4QA 2V76A 3FM8C 2N0YA 4XWXA 2H7EA 2IYBA 2UZSA 2YS3A 4CYEA 2NZ8B 3QIJA 2MDXA 4DBBA 5C79A 1FB8A 3GYPA 2FJLA 4HAZB 2PZ1A 3PG7A 2VSZA 2DX5A 1NI2A 4NY0A 2P0DA 2K2UA 2Q13A 2LYDA 2RLOA 2Y7BA 1X05A 2COAA 1FHXA 1WVHA 2DKQA 3CXBB 5D3WA 5J3YA 2IFSA 1UEFA 2ELBA 2GCLA 4HB4B 3ODXA 4IAPA 2COFA 3ML4A 4HATB 3FEHA 2OQBA 1W1DA 2G35A 4K2PA 3DXCA 1UPQA 1QQGA 1N3HA 2D9VA 4A6HA 1MKEA 1AWEA 2LOZA 3TO1A 1RRPB 2KUPA 2NMBA 2UZRA 5L81A 3KY9A 1GC6A 3F0WA 2D11A 1KZGA 2P0HA 4HAVB 3X23A 3A8PA 1FOEA 2M38A 3F5RA 3KRXA 2K2JA 1X1FA 1WGQA 4EJNA 4BBKA 3U7DA 4YL8A 4GN1A 1V61A 5FI0A 4GPTB 2DA0A 1V88A 2VKIA 3PVWA 4A6KA 4P7IA 5EFXA 2RVBB 3LJUX 1OMWA 5C5BB 1H10A 3ODWA 2DKPA 1V5MA 4TKNA 3A98B 4HB3B 2M14A 4B6HA 2MKRA 5DHAB 5KQ1A 2ADZA 4IOYX 5JHGA 2I1KA 3ODOA 4F7HA 1U2BA 1Q67A 3O96A 2LOXA 1U29A 5DH9B 1BTKA 1I7AA 5C5BA 3MDBC 3PP2A 1W1GA 1IRSA 2P8VA 3WA0A 3PEGA 1P5TA 2RUKB 1P6SA 2EJ8A 1PLSA 1AQCA 2CY5A 3VIAA 2JP2A 3D8EA 1Y19B 1XR0B 4HDQA 2COCA 1TJ6A 5D3XA 2W2XD 1M7RA 1P3RA 1BWNA 3ULCA 1MK7B 1LW3A 4HDOA 2RGNB 3DXEA 3RCPA 2D9WA 1MPHA 2CAYA 5DHFB 3P7ZA 1WGUA 2YT0A 1DYNA 1DBHA 1KI1B 5JP4A 3P6AA 2MFQA 4Z2NA 1NTYA 1J19A 2N23A 2ZPYA 5GOWB 5CLQB 1NU2A 3G9WA 1OQNA 2DHIA 4Z2MB 2I1JA 3UZTA 1K5GB 3TW1A 4HAYB 3SUZA 5HE1A 4ZRIA 5KQ4A 2K00A 1KZ7A 3ULBA 3HQCA 2LKOA 2AL6A 2P0FA 2Z0OA 2DFKA 4PQ0A 5DIFB 2KCJA 4A6FB 1DDWA 2EMSA 4MY6A 2RSGA 4F7UP 1H4RA 1U27A 4HAWB 2E2XA 2D2QA 2R09A 1B55A 4MK0A 1UPRA 1ZC4B 2X18A 4WJ7A 5D27A 1UNQA 4A6FA 3PZDA 5C6RA 3KZ1A 4F7GA
chains in the Genus database with same CATH superfamily
1LB1A 1SHCA 2KGXB 2HTHB 2I5FA 2BCJA 3A8QA 2CODA 4GMVA 2L1CA 1MAIA 3HK0A 2GS0A 1V89A 1FHOA 2R0DA 1MK9B 5HE2A 5C16A 2YRYA 3M1IB 3VOQA 1XX0A 5J3TA 1K5DB 1GC7A 5JHHA 5CLLB 5D3YA 1RJ2A 2YF0A 2DHKA 2DYQA 3FSSA 2YS5A 3SNHA 4CHJA 1MIXA 2KIGA 1FAOA 5I2MA 1V5UA 3QWMA 2J0KA 1SGHA 3SYXA 3HW2B 1XCGA 1NTVA 2D10A 4CHMA 4DX90 3NWFA 2DLWA 4L1RA 2Z14A 1BTNA 3TVVA 1V5PA 4EKUA 3T06A 2AEHA 4CSQA 3IVFA 2K49A 4GNKB 2CY4A 1X86A 1PMSA 3KSYA 2Y8GA 2QKMA 4HAXB 4KAXB 4MT7A 5DI9B 3U8ZA 2DX1A 3SO6A 1U5EA 1XKEA 2MWNB 4D0NB 3MPXA 2D9XA 2EMTA 2D9ZA 2OTXA 4KHAA 4A5KA 5HE3A 1MIZB 2HE7A 4KHOA 1I2HA 3AU4A 5LONB 4C0AA 2DN6A 3ZVRA 1UNRA 1PFJA 2DHJA 2YSZA 2RNRB 2ELAA 4K17A 5J3QA 1ISNA 2DTCA 1X1GA 1J0WA 2L2IA 1X11A 2UVMA 2EC1A 4QJ3B 1EF1A 4DXAB 5I2SA 1Z87A 2J59M 1XODA 4TYZA 3PSCA 3BINA 2QKLA 4GMXB 1U5DA 2K8EA 2XQNM 4YONA 3ZDTA 4HB0B 4KHBB 1FHWA 3QBVB 2Z0PA 3OANA 2Z13A 1W1HA 4NSWA 1TXDA 3HSAA 2YS1A 1WJMA 4WSFA 4PNKA 2YVCA 3KRWA 2LULA 3GYOA 1U5GA 2W2WA 5FI1A 3AJ4A 4HSIA 2RRFA 3BJIA 1GG3A 4K2OA 2FJUB 2Y8FA 1UNPA 1WI1A 2LG1A 2DYNA 4K81A 4KHBA 2GCJA 4ZRJA 3AU5A 2Z0QA 4L6EA 1MI1A 3TFMA 1DDMA 3D8FA 1U5FA 4KVGB 3WYFB 4GXBA 1WG7A 2KIEA 2D9YA 1M7EA 1DDVA 2GJYA 3DCXA 3TCAA 1ZC3B 4HAUB 3N7CA 5M4YB 1QC6A 3PVLA 4ZRKA 1EAZA 5HE0A 4EMOA 2R2YA 1EVHA 1XD4A 1ZM0A 3OHMB 1E5WA 3DXDA 5KCVA 1Y5OA 1FGZA 3HIEA 2W2XC 4WVFB 1FGYA 4GZUA 1DROA 3V5WA 1WJ1A 3D8DA 4QJ5B 2H7DA 2ROVA 4IFSA 4HHVA 1EGXA 2J0JA 2Z4DA 3NSUA 5IRSA 1OY2A 5LG4B 2J0MA 4DX8A 2ROZB 5LOPB 2I5CA 2VRWB 5JLJB 4H8SA 3PVUA 2YT1A 1TQZA 3SV1A 3FVCA 1ZVRA 4HB2B 3CIKA 5D3VA 2CRFA 1ZSQA 1BAKA 4Y94A 2D4QA 2V76A 3FM8C 2NBVA 2N0YA 4XWXA 2H7EA 2IYBA 2GUMA 2UZSA 2YS3A 4CYEA 4OSNA 2NZ8B 3QIJA 2MDXA 4DBBA 5C79A 1FB8A 3GYPA 2FJLA 4HAZB 2PZ1A 3PG7A 2VSZA 2DX5A 1NI2A 4NY0A 4QJ4B 2P0DA 2K2UA 2Q13A 2LYDA 2RLOA 2Y7BA 1X05A 2COAA 1FHXA 1WVHA 2DKQA 3CXBB 5D3WA 5J3YA 2IFSA 1UEFA 2ELBA 2GCLA 4HB4B 3ODXA 4IAPA 2COFA 3ML4A 4HATB 3FEHA 2OQBA 1W1DA 2G35A 4K2PA 3DXCA 1UPQA 1QQGA 1N3HA 2D9VA 3NW8A 4A6HA 1MKEA 1AWEA 2LOZA 3TO1A 1RRPB 2KUPA 2NMBA 2UZRA 5L81A 3KY9A 1GC6A 3NWAA 3F0WA 2D11A 4GOUA 1KZGA 2P0HA 4HAVB 3X23A 3A8PA 1FOEA 2M38A 3F5RA 3KRXA 2K2JA 1X1FA 1WGQA 4EJNA 4BBKA 3U7DA 4YL8A 4GN1A 1V61A 5FI0A 4GPTB 2DA0A 1V88A 2VKIA 3PVWA 4A6KA 4P7IA 2ZKMX 2RVBB 3LJUX 5EFXA 1OMWA 5C5BB 1H10A 3ODWA 2DKPA 1V5MA 4TKNA 3U12A 3A98B 4HB3B 2M14A 2KUQA 4B6HA 2MKRA 5DHAB 5KQ1A 2ADZA 4IOYX 2Z59A 5JHGA 2I1KA 4DIXA 3ODOA 4QXAB 2YT2A 4F7HA 1U2BA 3A58A 1Q67A 3O96A 2LOXA 1U29A 5DH9B 1BTKA 1I7AA 5C5BA 3MDBC 3PP2A 1W1GA 1IRSA 2P8VA 3WA0A 3PEGA 1P5TA 2RUKB 1P6SA 2EJ8A 1PLSA 1AQCA 2CY5A 3VIAA 2JP2A 3D8EA 1Y19B 4D6WA 1XR0B 4HDQA 2COCA 1TJ6A 3B77A 5D3XA 2W2XD 1M7RA 1P3RA 1BWNA 3ULCA 1MK7B 1LW3A 4HDOA 2RGNB 3DXEA 3RCPA 2D9WA 1MPHA 2CAYA 5DHFB 3NWDA 3P7ZA 1WGUA 2YT0A 1DYNA 1DBHA 1KI1B 5JP4A 2KR0A 3P6AA 2MFQA 4Z2NA 1NTYA 1J19A 2N23A 2ZPYA 5GOWB 5CLQB 1NU2A 3G9WA 1OQNA 2DHIA 4Z2MB 2I1JA 3UZTA 1K5GB 3TW1A 1T77A 4HAYB 3SUZA 5HE1A 4ZRIA 5KQ4A 2K00A 1KZ7A 1ZYIA 4OT1A 3ULBA 3HQCA 2LKOA 2AL6A 2P0FA 2Z0OA 2DFKA 4PQ0A 5DIFB 2KCJA 4A6FB 1DDWA 2EMSA 4MY6A 2RSGA 4F7UP 1H4RA 1U27A 4HAWB 2E2XA 2D2QA 2R09A 1B55A 4MK0A 1UPRA 1ZC4B 2X18A 4WJ7A 5D27A 1UNQA 4A6FA 3PZDA 5C6RA 3KZ1A 4F7GA
chains in the Genus database with same CATH topology
1LB1A 1SHCA 2KGXB 2HTHB 2I5FA 2BCJA 3A8QA 2CODA 4GMVA 2L1CA 1MAIA 3HK0A 2GS0A 1V89A 1FHOA 2R0DA 1MK9B 5HE2A 5C16A 2YRYA 3M1IB 3VOQA 1XX0A 5J3TA 1K5DB 1GC7A 5JHHA 5CLLB 5D3YA 1RJ2A 2YF0A 2DHKA 2DYQA 3FSSA 2YS5A 3SNHA 4CHJA 1MIXA 1FAOA 1V5UA 3QWMA 2J0KA 1SGHA 3SYXA 3HW2B 1XCGA 1NTVA 2D10A 4CHMA 4DX90 2DLWA 1BTNA 3TVVA 1V5PA 4EKUA 3T06A 2AEHA 3IVFA 2CY4A 1X86A 1PMSA 3KSYA 2Y8GA 2QKMA 4HAXB 4KAXB 4MT7A 5DI9B 3U8ZA 2DX1A 3SO6A 1U5EA 1XKEA 2MWNB 4D0NB 3MPXA 2D9XA 2EMTA 2D9ZA 2OTXA 4KHAA 4A5KA 5HE3A 1MIZB 2HE7A 4KHOA 1I2HA 3AU4A 5LONB 4C0AA 2DN6A 3ZVRA 1UNRA 1PFJA 2DHJA 2YSZA 2RNRB 2ELAA 4K17A 5J3QA 1ISNA 2DTCA 1X1GA 1J0WA 2L2IA 1X11A 2UVMA 2EC1A 1EF1A 4DXAB 1Z87A 2J59M 1XODA 4TYZA 3PSCA 3BINA 2QKLA 4GMXB 1U5DA 2XQNM 4YONA 3ZDTA 4HB0B 4KHBB 1FHWA 3QBVB 2Z0PA 3OANA 1W1HA 4NSWA 1TXDA 2YS1A 1WJMA 4WSFA 4PNKA 2YVCA 3KRWA 2LULA 3GYOA 1U5GA 2W2WA 5FI1A 3AJ4A 3BJIA 1GG3A 4K2OA 2Y8FA 1UNPA 1WI1A 2LG1A 2DYNA 4K81A 2GCJA 4ZRJA 3AU5A 2Z0QA 4L6EA 3TFMA 1DDMA 3D8FA 1U5FA 4KVGB 3WYFB 4GXBA 1WG7A 2D9YA 1M7EA 1DDVA 2GJYA 3TCAA 1ZC3B 4HAUB 3N7CA 1QC6A 3PVLA 4ZRKA 1EAZA 5HE0A 4EMOA 1EVHA 1XD4A 1ZM0A 1E5WA 3DXDA 5KCVA 1Y5OA 1FGZA 2W2XC 4WVFB 1FGYA 4GZUA 1DROA 3V5WA 1WJ1A 3D8DA 2H7DA 2ROVA 4IFSA 4HHVA 1EGXA 2J0JA 3NSUA 1OY2A 2J0MA 4DX8A 2ROZB 5LOPB 2I5CA 2VRWB 5JLJB 4H8SA 3PVUA 2YT1A 1TQZA 3SV1A 1ZVRA 4HB2B 3CIKA 5D3VA 2CRFA 1ZSQA 1BAKA 4Y94A 2D4QA 2V76A 3FM8C 2N0YA 4XWXA 2H7EA 2IYBA 2UZSA 2YS3A 4CYEA 2NZ8B 3QIJA 2MDXA 4DBBA 5C79A 1FB8A 3GYPA 2FJLA 4HAZB 2PZ1A 3PG7A 2VSZA 2DX5A 1NI2A 4NY0A 2P0DA 2K2UA 2Q13A 2LYDA 2RLOA 2Y7BA 1X05A 2COAA 1FHXA 1WVHA 2DKQA 3CXBB 5D3WA 5J3YA 2IFSA 1UEFA 2ELBA 2GCLA 4HB4B 3ODXA 4IAPA 2COFA 3ML4A 4HATB 3FEHA 2OQBA 1W1DA 2G35A 4K2PA 3DXCA 1UPQA 1QQGA 1N3HA 2D9VA 4A6HA 1MKEA 1AWEA 2LOZA 3TO1A 1RRPB 2KUPA 2NMBA 2UZRA 5L81A 3KY9A 1GC6A 3F0WA 2D11A 1KZGA 2P0HA 4HAVB 3X23A 3A8PA 1FOEA 2M38A 3F5RA 3KRXA 2K2JA 1X1FA 1WGQA 4EJNA 4BBKA 3U7DA 4YL8A 4GN1A 1V61A 5FI0A 4GPTB 2DA0A 1V88A 2VKIA 3PVWA 4A6KA 4P7IA 5EFXA 2RVBB 3LJUX 1OMWA 5C5BB 1H10A 3ODWA 2DKPA 1V5MA 4TKNA 3A98B 4HB3B 2M14A 4B6HA 2MKRA 5DHAB 5KQ1A 2ADZA 4IOYX 5JHGA 2I1KA 3ODOA 4F7HA 1U2BA 1Q67A 3O96A 2LOXA 1U29A 5DH9B 1BTKA 1I7AA 5C5BA 3MDBC 3PP2A 1W1GA 1IRSA 2P8VA 3WA0A 3PEGA 1P5TA 2RUKB 1P6SA 2EJ8A 1PLSA 1AQCA 2CY5A 3VIAA 2JP2A 3D8EA 1Y19B 1XR0B 4HDQA 2COCA 1TJ6A 5D3XA 2W2XD 1M7RA 1P3RA 1BWNA 3ULCA 1MK7B 1LW3A 4HDOA 2RGNB 3DXEA 3RCPA 2D9WA 1MPHA 2CAYA 5DHFB 3P7ZA 1WGUA 2YT0A 1DYNA 1DBHA 1KI1B 5JP4A 3P6AA 2MFQA 4Z2NA 1NTYA 1J19A 2N23A 2ZPYA 5GOWB 5CLQB 1NU2A 3G9WA 1OQNA 2DHIA 4Z2MB 2I1JA 3UZTA 1K5GB 3TW1A 4HAYB 3SUZA 5HE1A 4ZRIA 5KQ4A 2K00A 1KZ7A 3ULBA 3HQCA 2LKOA 2AL6A 2P0FA 2Z0OA 2DFKA 4PQ0A 5DIFB 2KCJA 4A6FB 1DDWA 2EMSA 4MY6A 2RSGA 4F7UP 1H4RA 1U27A 4HAWB 2E2XA 2D2QA 2R09A 1B55A 4MK0A 1UPRA 1ZC4B 2X18A 4WJ7A 5D27A 1UNQA 4A6FA 3PZDA 5C6RA 3KZ1A 4F7GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LB1 A;  1SHC A;  2KGX B;  2HTH B;  2I5F A;  2BCJ A;  3A8Q A;  2COD A;  4GMV A;  2L1C A;  1MAI A;  3HK0 A;  2GS0 A;  1V89 A;  1FHO A;  2R0D A;  1MK9 B;  5HE2 A;  5C16 A;  2YRY A;  3M1I B;  3VOQ A;  1XX0 A;  5J3T A;  1K5D B;  1GC7 A;  5JHH A;  5CLL B;  5D3Y A;  1RJ2 A;  2YF0 A;  2DHK A;  2DYQ A;  3FSS A;  2YS5 A;  3SNH A;  4CHJ A;  1MIX A;  1FAO A;  1V5U A;  3QWM A;  2J0K A;  1SGH A;  3SYX A;  3HW2 B;  1XCG A;  1NTV A;  2D10 A;  4CHM A;  4DX9 0;  2DLW A;  1BTN A;  3TVV A;  1V5P A;  4EKU A;  3T06 A;  2AEH A;  3IVF A;  2CY4 A;  1X86 A;  1PMS A;  3KSY A;  2Y8G A;  2QKM A;  4HAX B;  4KAX B;  4MT7 A;  5DI9 B;  3U8Z A;  2DX1 A;  3SO6 A;  1U5E A;  1XKE A;  2MWN B;  4D0N B;  3MPX A;  2D9X A;  2EMT A;  2D9Z A;  2OTX A;  4KHA A;  4A5K A;  5HE3 A;  1MIZ B;  2HE7 A;  4KHO A;  1I2H A;  3AU4 A;  5LON B;  4C0A A;  2DN6 A;  3ZVR A;  1UNR A;  1PFJ A;  2DHJ A;  2YSZ A;  2RNR B;  2ELA A;  4K17 A;  5J3Q A;  1ISN A;  2DTC A;  1X1G A;  1J0W A;  2L2I A;  1X11 A;  2UVM A;  2EC1 A;  1EF1 A;  4DXA B;  1Z87 A;  2J59 M;  1XOD A;  4TYZ A;  3PSC A;  3BIN A;  2QKL A;  4GMX B;  1U5D A;  2XQN M;  4YON A;  3ZDT A;  4HB0 B;  4KHB B;  1FHW A;  3QBV B;  2Z0P A;  3OAN A;  1W1H A;  4NSW A;  1TXD A;  2YS1 A;  1WJM A;  4WSF A;  4PNK A;  2YVC A;  3KRW A;  2LUL A;  3GYO A;  1U5G A;  2W2W A;  5FI1 A;  3AJ4 A;  3BJI A;  1GG3 A;  4K2O A;  2Y8F A;  1UNP A;  1WI1 A;  2LG1 A;  2DYN A;  4K81 A;  2GCJ A;  4ZRJ A;  3AU5 A;  2Z0Q A;  4L6E A;  3TFM A;  1DDM A;  3D8F A;  1U5F A;  4KVG B;  3WYF B;  4GXB A;  1WG7 A;  2D9Y A;  1M7E A;  1DDV A;  2GJY A;  3TCA A;  1ZC3 B;  4HAU B;  3N7C A;  1QC6 A;  3PVL A;  4ZRK A;  1EAZ A;  5HE0 A;  4EMO A;  1EVH A;  1XD4 A;  1ZM0 A;  1E5W A;  3DXD A;  5KCV A;  1Y5O A;  1FGZ A;  2W2X C;  4WVF B;  1FGY A;  4GZU A;  1DRO A;  3V5W A;  1WJ1 A;  3D8D A;  2H7D A;  2ROV A;  4IFS A;  4HHV A;  1EGX A;  2J0J A;  3NSU A;  1OY2 A;  2J0M A;  4DX8 A;  2ROZ B;  5LOP B;  2I5C A;  2VRW B;  5JLJ B;  4H8S A;  3PVU A;  2YT1 A;  1TQZ A;  3SV1 A;  1ZVR A;  4HB2 B;  3CIK A;  5D3V A;  2CRF A;  1ZSQ A;  1BAK A;  4Y94 A;  2D4Q A;  2V76 A;  3FM8 C;  2N0Y A;  4XWX A;  2H7E A;  2IYB A;  2UZS A;  2YS3 A;  4CYE A;  2NZ8 B;  3QIJ A;  2MDX A;  4DBB A;  5C79 A;  1FB8 A;  3GYP A;  2FJL A;  4HAZ B;  2PZ1 A;  3PG7 A;  2VSZ A;  2DX5 A;  1NI2 A;  4NY0 A;  2P0D A;  2K2U A;  2Q13 A;  2LYD A;  2RLO A;  2Y7B A;  1X05 A;  2COA A;  1FHX A;  1WVH A;  2DKQ A;  3CXB B;  5D3W A;  5J3Y A;  2IFS A;  1UEF A;  2ELB A;  2GCL A;  4HB4 B;  3ODX A;  4IAP A;  2COF A;  3ML4 A;  4HAT B;  3FEH A;  2OQB A;  1W1D A;  2G35 A;  4K2P A;  3DXC A;  1UPQ A;  1QQG A;  1N3H A;  2D9V A;  4A6H A;  1MKE A;  1AWE A;  2LOZ A;  3TO1 A;  1RRP B;  2KUP A;  2NMB A;  2UZR A;  5L81 A;  3KY9 A;  1GC6 A;  3F0W A;  2D11 A;  1KZG A;  2P0H A;  4HAV B;  3X23 A;  3A8P A;  1FOE A;  2M38 A;  3F5R A;  3KRX A;  2K2J A;  1X1F A;  1WGQ A;  4EJN A;  4BBK A;  3U7D A;  4YL8 A;  4GN1 A;  1V61 A;  5FI0 A;  4GPT B;  2DA0 A;  1V88 A;  2VKI A;  3PVW A;  4A6K A;  4P7I A;  5EFX A;  2RVB B;  3LJU X;  1OMW A;  5C5B B;  1H10 A;  3ODW A;  2DKP A;  1V5M A;  4TKN A;  3A98 B;  4HB3 B;  2M14 A;  4B6H A;  2MKR A;  5DHA B;  5KQ1 A;  2ADZ A;  4IOY X;  5JHG A;  2I1K A;  3ODO A;  4F7H A;  1U2B A;  1Q67 A;  3O96 A;  2LOX A;  1U29 A;  5DH9 B;  1BTK A;  1I7A A;  5C5B A;  3MDB C;  3PP2 A;  1W1G A;  1IRS A;  2P8V A;  3WA0 A;  3PEG A;  1P5T A;  2RUK B;  1P6S A;  2EJ8 A;  1PLS A;  1AQC A;  2CY5 A;  3VIA A;  2JP2 A;  3D8E A;  1Y19 B;  1XR0 B;  4HDQ A;  2COC A;  1TJ6 A;  5D3X A;  2W2X D;  1M7R A;  1P3R A;  1BWN A;  3ULC A;  1MK7 B;  1LW3 A;  4HDO A;  2RGN B;  3DXE A;  3RCP A;  2D9W A;  1MPH A;  2CAY A;  5DHF B;  3P7Z A;  1WGU A;  2YT0 A;  1DYN A;  1DBH A;  1KI1 B;  5JP4 A;  3P6A A;  2MFQ A;  4Z2N A;  1NTY A;  1J19 A;  2N23 A;  2ZPY A;  5GOW B;  5CLQ B;  1NU2 A;  3G9W A;  1OQN A;  2DHI A;  4Z2M B;  2I1J A;  3UZT A;  1K5G B;  3TW1 A;  4HAY B;  3SUZ A;  5HE1 A;  4ZRI A;  5KQ4 A;  2K00 A;  1KZ7 A;  3ULB A;  3HQC A;  2LKO A;  2AL6 A;  2P0F A;  2Z0O A;  2DFK A;  4PQ0 A;  5DIF B;  2KCJ A;  4A6F B;  1DDW A;  2EMS A;  4MY6 A;  2RSG A;  4F7U P;  1H4R A;  1U27 A;  4HAW B;  2E2X A;  2D2Q A;  2R09 A;  1B55 A;  4MK0 A;  1UPR A;  1ZC4 B;  2X18 A;  4WJ7 A;  5D27 A;  1UNQ A;  4A6F A;  3PZD A;  5C6R A;  3KZ1 A;  4F7G A; 
#chains in the Genus database with same CATH topology
 1LB1 A;  1SHC A;  2KGX B;  2HTH B;  2I5F A;  2BCJ A;  3A8Q A;  2COD A;  4GMV A;  2L1C A;  1MAI A;  3HK0 A;  2GS0 A;  1V89 A;  1FHO A;  2R0D A;  1MK9 B;  5HE2 A;  5C16 A;  2YRY A;  3M1I B;  3VOQ A;  1XX0 A;  5J3T A;  1K5D B;  1GC7 A;  5JHH A;  5CLL B;  5D3Y A;  1RJ2 A;  2YF0 A;  2DHK A;  2DYQ A;  3FSS A;  2YS5 A;  3SNH A;  4CHJ A;  1MIX A;  2KIG A;  1FAO A;  5I2M A;  1V5U A;  3QWM A;  2J0K A;  1SGH A;  3SYX A;  3HW2 B;  1XCG A;  1NTV A;  2D10 A;  4CHM A;  4DX9 0;  3NWF A;  2DLW A;  4L1R A;  2Z14 A;  1BTN A;  3TVV A;  1V5P A;  4EKU A;  3T06 A;  2AEH A;  4CSQ A;  3IVF A;  2K49 A;  4GNK B;  2CY4 A;  1X86 A;  1PMS A;  3KSY A;  2Y8G A;  2QKM A;  4HAX B;  4KAX B;  4MT7 A;  5DI9 B;  3U8Z A;  2DX1 A;  3SO6 A;  1U5E A;  1XKE A;  2MWN B;  4D0N B;  3MPX A;  2D9X A;  2EMT A;  2D9Z A;  2OTX A;  4KHA A;  4A5K A;  5HE3 A;  1MIZ B;  2HE7 A;  4KHO A;  1I2H A;  3AU4 A;  5LON B;  4C0A A;  2DN6 A;  3ZVR A;  1UNR A;  1PFJ A;  2DHJ A;  2YSZ A;  2RNR B;  2ELA A;  4K17 A;  5J3Q A;  1ISN A;  2DTC A;  1X1G A;  1J0W A;  2L2I A;  1X11 A;  2UVM A;  2EC1 A;  4QJ3 B;  1EF1 A;  4DXA B;  5I2S A;  1Z87 A;  2J59 M;  1XOD A;  4TYZ A;  3PSC A;  3BIN A;  2QKL A;  4GMX B;  1U5D A;  2K8E A;  2XQN M;  4YON A;  3ZDT A;  4HB0 B;  4KHB B;  1FHW A;  3QBV B;  2Z0P A;  3OAN A;  2Z13 A;  1W1H A;  4NSW A;  1TXD A;  3HSA A;  2YS1 A;  1WJM A;  4WSF A;  4PNK A;  2YVC A;  3KRW A;  2LUL A;  3GYO A;  1U5G A;  2W2W A;  5FI1 A;  3AJ4 A;  4HSI A;  2RRF A;  3BJI A;  1GG3 A;  4K2O A;  2FJU B;  2Y8F A;  1UNP A;  1WI1 A;  2LG1 A;  2DYN A;  4K81 A;  4KHB A;  2GCJ A;  4ZRJ A;  3AU5 A;  2Z0Q A;  4L6E A;  1MI1 A;  3TFM A;  1DDM A;  3D8F A;  1U5F A;  4KVG B;  3WYF B;  4GXB A;  1WG7 A;  2KIE A;  2D9Y A;  1M7E A;  1DDV A;  2GJY A;  3DCX A;  3TCA A;  1ZC3 B;  4HAU B;  3N7C A;  5M4Y B;  1QC6 A;  3PVL A;  4ZRK A;  1EAZ A;  5HE0 A;  4EMO A;  2R2Y A;  1EVH A;  1XD4 A;  1ZM0 A;  3OHM B;  1E5W A;  3DXD A;  5KCV A;  1Y5O A;  1FGZ A;  3HIE A;  2W2X C;  4WVF B;  1FGY A;  4GZU A;  1DRO A;  3V5W A;  1WJ1 A;  3D8D A;  4QJ5 B;  2H7D A;  2ROV A;  4IFS A;  4HHV A;  1EGX A;  2J0J A;  2Z4D A;  3NSU A;  5IRS A;  1OY2 A;  5LG4 B;  2J0M A;  4DX8 A;  2ROZ B;  5LOP B;  2I5C A;  2VRW B;  5JLJ B;  4H8S A;  3PVU A;  2YT1 A;  1TQZ A;  3SV1 A;  3FVC A;  1ZVR A;  4HB2 B;  3CIK A;  5D3V A;  2CRF A;  1ZSQ A;  1BAK A;  4Y94 A;  2D4Q A;  2V76 A;  3FM8 C;  2NBV A;  2N0Y A;  4XWX A;  2H7E A;  2IYB A;  2GUM A;  2UZS A;  2YS3 A;  4CYE A;  4OSN A;  2NZ8 B;  3QIJ A;  2MDX A;  4DBB A;  5C79 A;  1FB8 A;  3GYP A;  2FJL A;  4HAZ B;  2PZ1 A;  3PG7 A;  2VSZ A;  2DX5 A;  1NI2 A;  4NY0 A;  4QJ4 B;  2P0D A;  2K2U A;  2Q13 A;  2LYD A;  2RLO A;  2Y7B A;  1X05 A;  2COA A;  1FHX A;  1WVH A;  2DKQ A;  3CXB B;  5D3W A;  5J3Y A;  2IFS A;  1UEF A;  2ELB A;  2GCL A;  4HB4 B;  3ODX A;  4IAP A;  2COF A;  3ML4 A;  4HAT B;  3FEH A;  2OQB A;  1W1D A;  2G35 A;  4K2P A;  3DXC A;  1UPQ A;  1QQG A;  1N3H A;  2D9V A;  3NW8 A;  4A6H A;  1MKE A;  1AWE A;  2LOZ A;  3TO1 A;  1RRP B;  2KUP A;  2NMB A;  2UZR A;  5L81 A;  3KY9 A;  1GC6 A;  3NWA A;  3F0W A;  2D11 A;  4GOU A;  1KZG A;  2P0H A;  4HAV B;  3X23 A;  3A8P A;  1FOE A;  2M38 A;  3F5R A;  3KRX A;  2K2J A;  1X1F A;  1WGQ A;  4EJN A;  4BBK A;  3U7D A;  4YL8 A;  4GN1 A;  1V61 A;  5FI0 A;  4GPT B;  2DA0 A;  1V88 A;  2VKI A;  3PVW A;  4A6K A;  4P7I A;  2ZKM X;  2RVB B;  3LJU X;  5EFX A;  1OMW A;  5C5B B;  1H10 A;  3ODW A;  2DKP A;  1V5M A;  4TKN A;  3U12 A;  3A98 B;  4HB3 B;  2M14 A;  2KUQ A;  4B6H A;  2MKR A;  5DHA B;  5KQ1 A;  2ADZ A;  4IOY X;  2Z59 A;  5JHG A;  2I1K A;  4DIX A;  3ODO A;  4QXA B;  2YT2 A;  4F7H A;  1U2B A;  3A58 A;  1Q67 A;  3O96 A;  2LOX A;  1U29 A;  5DH9 B;  1BTK A;  1I7A A;  5C5B A;  3MDB C;  3PP2 A;  1W1G A;  1IRS A;  2P8V A;  3WA0 A;  3PEG A;  1P5T A;  2RUK B;  1P6S A;  2EJ8 A;  1PLS A;  1AQC A;  2CY5 A;  3VIA A;  2JP2 A;  3D8E A;  1Y19 B;  4D6W A;  1XR0 B;  4HDQ A;  2COC A;  1TJ6 A;  3B77 A;  5D3X A;  2W2X D;  1M7R A;  1P3R A;  1BWN A;  3ULC A;  1MK7 B;  1LW3 A;  4HDO A;  2RGN B;  3DXE A;  3RCP A;  2D9W A;  1MPH A;  2CAY A;  5DHF B;  3NWD A;  3P7Z A;  1WGU A;  2YT0 A;  1DYN A;  1DBH A;  1KI1 B;  5JP4 A;  2KR0 A;  3P6A A;  2MFQ A;  4Z2N A;  1NTY A;  1J19 A;  2N23 A;  2ZPY A;  5GOW B;  5CLQ B;  1NU2 A;  3G9W A;  1OQN A;  2DHI A;  4Z2M B;  2I1J A;  3UZT A;  1K5G B;  3TW1 A;  1T77 A;  4HAY B;  3SUZ A;  5HE1 A;  4ZRI A;  5KQ4 A;  2K00 A;  1KZ7 A;  1ZYI A;  4OT1 A;  3ULB A;  3HQC A;  2LKO A;  2AL6 A;  2P0F A;  2Z0O A;  2DFK A;  4PQ0 A;  5DIF B;  2KCJ A;  4A6F B;  1DDW A;  2EMS A;  4MY6 A;  2RSG A;  4F7U P;  1H4R A;  1U27 A;  4HAW B;  2E2X A;  2D2Q A;  2R09 A;  1B55 A;  4MK0 A;  1UPR A;  1ZC4 B;  2X18 A;  4WJ7 A;  5D27 A;  1UNQ A;  4A6F A;  3PZD A;  5C6R A;  3KZ1 A;  4F7G A; 
#chains in the Genus database with same CATH homology
 1LB1 A;  1SHC A;  2KGX B;  2HTH B;  2I5F A;  2BCJ A;  3A8Q A;  2COD A;  4GMV A;  2L1C A;  1MAI A;  3HK0 A;  2GS0 A;  1V89 A;  1FHO A;  2R0D A;  1MK9 B;  5HE2 A;  5C16 A;  2YRY A;  3M1I B;  3VOQ A;  1XX0 A;  5J3T A;  1K5D B;  1GC7 A;  5JHH A;  5CLL B;  5D3Y A;  1RJ2 A;  2YF0 A;  2DHK A;  2DYQ A;  3FSS A;  2YS5 A;  3SNH A;  4CHJ A;  1MIX A;  1FAO A;  1V5U A;  3QWM A;  2J0K A;  1SGH A;  3SYX A;  3HW2 B;  1XCG A;  1NTV A;  2D10 A;  4CHM A;  4DX9 0;  2DLW A;  1BTN A;  3TVV A;  1V5P A;  4EKU A;  3T06 A;  2AEH A;  3IVF A;  2CY4 A;  1X86 A;  1PMS A;  3KSY A;  2Y8G A;  2QKM A;  4HAX B;  4KAX B;  4MT7 A;  5DI9 B;  3U8Z A;  2DX1 A;  3SO6 A;  1U5E A;  1XKE A;  2MWN B;  4D0N B;  3MPX A;  2D9X A;  2EMT A;  2D9Z A;  2OTX A;  4KHA A;  4A5K A;  5HE3 A;  1MIZ B;  2HE7 A;  4KHO A;  1I2H A;  3AU4 A;  5LON B;  4C0A A;  2DN6 A;  3ZVR A;  1UNR A;  1PFJ A;  2DHJ A;  2YSZ A;  2RNR B;  2ELA A;  4K17 A;  5J3Q A;  1ISN A;  2DTC A;  1X1G A;  1J0W A;  2L2I A;  1X11 A;  2UVM A;  2EC1 A;  1EF1 A;  4DXA B;  1Z87 A;  2J59 M;  1XOD A;  4TYZ A;  3PSC A;  3BIN A;  2QKL A;  4GMX B;  1U5D A;  2XQN M;  4YON A;  3ZDT A;  4HB0 B;  4KHB B;  1FHW A;  3QBV B;  2Z0P A;  3OAN A;  1W1H A;  4NSW A;  1TXD A;  2YS1 A;  1WJM A;  4WSF A;  4PNK A;  2YVC A;  3KRW A;  2LUL A;  3GYO A;  1U5G A;  2W2W A;  5FI1 A;  3AJ4 A;  3BJI A;  1GG3 A;  4K2O A;  2Y8F A;  1UNP A;  1WI1 A;  2LG1 A;  2DYN A;  4K81 A;  2GCJ A;  4ZRJ A;  3AU5 A;  2Z0Q A;  4L6E A;  3TFM A;  1DDM A;  3D8F A;  1U5F A;  4KVG B;  3WYF B;  4GXB A;  1WG7 A;  2D9Y A;  1M7E A;  1DDV A;  2GJY A;  3TCA A;  1ZC3 B;  4HAU B;  3N7C A;  1QC6 A;  3PVL A;  4ZRK A;  1EAZ A;  5HE0 A;  4EMO A;  1EVH A;  1XD4 A;  1ZM0 A;  1E5W A;  3DXD A;  5KCV A;  1Y5O A;  1FGZ A;  2W2X C;  4WVF B;  1FGY A;  4GZU A;  1DRO A;  3V5W A;  1WJ1 A;  3D8D A;  2H7D A;  2ROV A;  4IFS A;  4HHV A;  1EGX A;  2J0J A;  3NSU A;  1OY2 A;  2J0M A;  4DX8 A;  2ROZ B;  5LOP B;  2I5C A;  2VRW B;  5JLJ B;  4H8S A;  3PVU A;  2YT1 A;  1TQZ A;  3SV1 A;  1ZVR A;  4HB2 B;  3CIK A;  5D3V A;  2CRF A;  1ZSQ A;  1BAK A;  4Y94 A;  2D4Q A;  2V76 A;  3FM8 C;  2N0Y A;  4XWX A;  2H7E A;  2IYB A;  2UZS A;  2YS3 A;  4CYE A;  2NZ8 B;  3QIJ A;  2MDX A;  4DBB A;  5C79 A;  1FB8 A;  3GYP A;  2FJL A;  4HAZ B;  2PZ1 A;  3PG7 A;  2VSZ A;  2DX5 A;  1NI2 A;  4NY0 A;  2P0D A;  2K2U A;  2Q13 A;  2LYD A;  2RLO A;  2Y7B A;  1X05 A;  2COA A;  1FHX A;  1WVH A;  2DKQ A;  3CXB B;  5D3W A;  5J3Y A;  2IFS A;  1UEF A;  2ELB A;  2GCL A;  4HB4 B;  3ODX A;  4IAP A;  2COF A;  3ML4 A;  4HAT B;  3FEH A;  2OQB A;  1W1D A;  2G35 A;  4K2P A;  3DXC A;  1UPQ A;  1QQG A;  1N3H A;  2D9V A;  4A6H A;  1MKE A;  1AWE A;  2LOZ A;  3TO1 A;  1RRP B;  2KUP A;  2NMB A;  2UZR A;  5L81 A;  3KY9 A;  1GC6 A;  3F0W A;  2D11 A;  1KZG A;  2P0H A;  4HAV B;  3X23 A;  3A8P A;  1FOE A;  2M38 A;  3F5R A;  3KRX A;  2K2J A;  1X1F A;  1WGQ A;  4EJN A;  4BBK A;  3U7D A;  4YL8 A;  4GN1 A;  1V61 A;  5FI0 A;  4GPT B;  2DA0 A;  1V88 A;  2VKI A;  3PVW A;  4A6K A;  4P7I A;  5EFX A;  2RVB B;  3LJU X;  1OMW A;  5C5B B;  1H10 A;  3ODW A;  2DKP A;  1V5M A;  4TKN A;  3A98 B;  4HB3 B;  2M14 A;  4B6H A;  2MKR A;  5DHA B;  5KQ1 A;  2ADZ A;  4IOY X;  5JHG A;  2I1K A;  3ODO A;  4F7H A;  1U2B A;  1Q67 A;  3O96 A;  2LOX A;  1U29 A;  5DH9 B;  1BTK A;  1I7A A;  5C5B A;  3MDB C;  3PP2 A;  1W1G A;  1IRS A;  2P8V A;  3WA0 A;  3PEG A;  1P5T A;  2RUK B;  1P6S A;  2EJ8 A;  1PLS A;  1AQC A;  2CY5 A;  3VIA A;  2JP2 A;  3D8E A;  1Y19 B;  1XR0 B;  4HDQ A;  2COC A;  1TJ6 A;  5D3X A;  2W2X D;  1M7R A;  1P3R A;  1BWN A;  3ULC A;  1MK7 B;  1LW3 A;  4HDO A;  2RGN B;  3DXE A;  3RCP A;  2D9W A;  1MPH A;  2CAY A;  5DHF B;  3P7Z A;  1WGU A;  2YT0 A;  1DYN A;  1DBH A;  1KI1 B;  5JP4 A;  3P6A A;  2MFQ A;  4Z2N A;  1NTY A;  1J19 A;  2N23 A;  2ZPY A;  5GOW B;  5CLQ B;  1NU2 A;  3G9W A;  1OQN A;  2DHI A;  4Z2M B;  2I1J A;  3UZT A;  1K5G B;  3TW1 A;  4HAY B;  3SUZ A;  5HE1 A;  4ZRI A;  5KQ4 A;  2K00 A;  1KZ7 A;  3ULB A;  3HQC A;  2LKO A;  2AL6 A;  2P0F A;  2Z0O A;  2DFK A;  4PQ0 A;  5DIF B;  2KCJ A;  4A6F B;  1DDW A;  2EMS A;  4MY6 A;  2RSG A;  4F7U P;  1H4R A;  1U27 A;  4HAW B;  2E2X A;  2D2Q A;  2R09 A;  1B55 A;  4MK0 A;  1UPR A;  1ZC4 B;  2X18 A;  4WJ7 A;  5D27 A;  1UNQ A;  4A6F A;  3PZD A;  5C6R A;  3KZ1 A;  4F7G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...