1UPQA

Crystal structure of the pleckstrin homology (ph) domain of pepp1
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
107
structure length
107
Chain Sequence
LRRDPNLPVHIRGWLHKQDSSGLRLWKRRWFVLSGHCLFYYKDSREESVLGSVLLPSYNIRPDGPGAPRGRRFTFTAEHPGMRTYVLAADTLEDLRGWLRALGRASR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PEPP1
publication title Crystal Structure of the Pleckstrin Homology Domain of Pepp1
rcsb
source organism Homo sapiens
molecule tags Signal transduction
total genus 20
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 2003-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1upqA00
5C6RA 3D8FA 1GG3A 1NI2A 3CXBB 1UNRA 1U5EA 1V5PA 4XWXA 3VOQA 4DXAB 1W1HA 4K81A 4ZRIA 1KZGA 5JHHA 5D3XA 1J0WA 2MFQA 1EGXA 3RCPA 2QKLA 3GYPA 2D4QA 2DHIA 3D8EA 4MT7A 2DTCA 3O96A 2P0FA 2DKQA 3AU5A 2I1JA 4L6EA 1TQZA 2KCJA 2P0DA 4YL8A 2Y7BA 3BINA 2Q13A 3U8ZA 2Z0PA 5JLJB 4F7HA 1Y5OA 2D9VA 2DLWA 3TO1A 2ADZA 4K2OA 2W2XC 2L1CA 3ULBA 4GZUA 4NY0A 4A5KA 1X86A 4KHAA 1OMWA 4EJNA 1DDWA 3DXEA 1XCGA 4HAUB 3A98B 3SYXA 1N3HA 2YSZA 2D9YA 3VIAA 1DDVA 4IFSA 5HE1A 4A6FB 3FSSA 2RVBB 1FGZA 1W1DA 2LOZA 1MKEA 1Z87A 4K2PA 2M14A 3AJ4A 1TXDA 4TKNA 5FI1A 2MWNB 1EF1A 1NTYA 1WGQA 3SV1A 4D0NB 4DX8A 5D3VA 3MDBC 2AL6A 2D9WA 2ROVA 2EMTA 4HDQA 4GPTB 2H7EA 5HE0A 1OY2A 2DKPA 3ZDTA 2RSGA 4CYEA 3A8QA 2COAA 4IOYX 5DHFB 3P7ZA 3MPXA 4F7UP 4HB0B 1UEFA 3HQCA 1B55A 4B6HA 1U5GA 3X23A 2RUKB 1BAKA 1PLSA 3ZVRA 4TYZA 2CY4A 2MDXA 2RNRB 3UZTA 5D3WA 1LB1A 1PFJA 1X05A 4EKUA 4HB3B 2YS3A 5LONB 1XKEA 4EMOA 2DX1A 5LOPB 2G35A 2M38A 2D11A 5D3YA 4MY6A 3U7DA 3PVWA 3T06A 5DH9B 3WYFB 1FAOA 1BTNA 3PG7A 4C0AA 2VSZA 2X18A 2W2XD 1UNPA 2VRWB 4ZRJA 1V5MA 2DYQA 3SNHA 1QC6A 2AEHA 2LG1A 2Z0OA 1WG7A 1MIZB 1P3RA 1GC6A 1P5TA 2RGNB 5C79A 5DHAB 5DI9B 2R09A 3M1IB 1SGHA 3HW2B 2DHKA 4GMVA 3D8DA 5C5BB 1U5DA 1X11A 2DN6A 5JP4A 1AWEA 3CIKA 1DROA 5HE3A 4HB2B 1M7RA 1FHOA 2KGXB 4A6FA 3P6AA 1DBHA 1NU2A 3BJIA 4H8SA 3FEHA 2FJLA 2CY5A 3ODXA 4CHMA 3A8PA 1K5GB 4NSWA 2BCJA 1U29A 1XR0B 1MPHA 3WA0A 2D9XA 4HHVA 3ODWA 5FI0A 1WJ1A 2YS5A 1I2HA 1WVHA 3G9WA 1FHXA 1X1GA 1W1GA 5J3TA 2DFKA 3TVVA 1NTVA 1PMSA 2CRFA 1UPQA 4PQ0A 2I1KA 2GS0A 3QBVB 5J3YA 2IYBA 3KRXA 4WVFB 2CAYA 3GYOA 4Z2MB 2I5FA 1KZ7A 1ZC3B 3PVUA 2LOXA 3PP2A 3KY9A 2EMSA 4HAWB 1IRSA 1RRPB 3QIJA 4HAVB 1U27A 4HAXB 4Y94A 2DHJA 1KI1B 4HDOA 4P7IA 1EVHA 5KQ1A 2ROZB 1FB8A 3TCAA 5EFXA 4ZRKA 2OQBA 2P8VA 2YRYA 2L2IA 1XX0A 1ZC4B 1WI1A 4CHJA 4GXBA 1EAZA 2K00A 2YF0A 2YVCA 1K5DB 5C16A 4DBBA 2YT0A 2LYDA 1J19A 2JP2A 1GC7A 3QWMA 3TW1A 1Y19B 1QQGA 1ZVRA 1MIXA 2EJ8A 1V89A 4GN1A 3DXDA 2Y8GA 2D2QA 3KZ1A 4HAZB 2K2UA 4IAPA 2J0KA 2Y8FA 2QKMA 5C5BA 2NZ8B 1V61A 2YT1A 3PSCA 4YONA 4A6KA 4KVGB 2COFA 1LW3A 1SHCA 4HAYB 1E5WA 1MK7B 2PZ1A 2H7DA 2UZSA 1Q67A 3SUZA 2COCA 3ODOA 3ULCA 2NMBA 3TFMA 1U2BA 2LULA 1DYNA 2D10A 2W2WA 1OQNA 5HE2A 5GOWB 2MKRA 4GMXB 5J3QA 3AU4A 2RLOA 3KRWA 3N7CA 4BBKA 2J59M 2N0YA 4WSFA 1U5FA 3KSYA 3SO6A 4MK0A 2XQNM 3F5RA 3PZDA 2GJYA 2I5CA 1MK9B 4KHOA 1ISNA 1WJMA 1M7EA 2V76A 2HE7A 2KUPA 2J0MA 5CLQB 4HATB 5D27A 1UPRA 1X1FA 1FOEA 2D9ZA 1FGYA 2Z0QA 2DX5A 1V5UA 1DDMA 2CODA 1UNQA 5CLLB 2ELBA 1BWNA 2UZRA 2YS1A 5KQ4A 2EC1A 1FHWA 4K17A 1ZM0A 1ZSQA 2VKIA 2R0DA 3IVFA 1WGUA 3LJUX 3PVLA 5JHGA 2E2XA 1AQCA 1XD4A 4PNKA 2OTXA 3DXCA 1TJ6A 3OANA 5L81A 4DX90 2N23A 2P0HA 5KCVA 2UVMA 2J0JA 2HTHB 2LKOA 4F7GA 1H10A 1H4RA 1XODA 4Z2NA 2K2JA 1P6SA 2ZPYA 3F0WA 2DYNA 3FM8C 3PEGA 4HB4B 4KAXB 1V88A 2GCLA 1RJ2A 4A6HA 3ML4A 2DA0A 3HK0A 2ELAA 3NSUA 1MAIA 1I7AA 2IFSA 2GCJA 5DIFB 3V5WA 4WJ7A 4KHBB 1BTKA
chains in the Genus database with same CATH superfamily
5C6RA 3D8FA 1GG3A 1NI2A 3CXBB 4QJ3B 1UNRA 1U5EA 1V5PA 4XWXA 3VOQA 4DXAB 1W1HA 4K81A 4ZRIA 4QJ5B 1KZGA 5JHHA 3NWFA 5D3XA 1J0WA 2MFQA 1EGXA 3RCPA 3GYPA 2QKLA 2D4QA 2DHIA 3D8EA 4MT7A 2DTCA 3O96A 2P0FA 3FVCA 2DKQA 3AU5A 2I1JA 4L6EA 2K49A 1TQZA 2KCJA 2P0DA 4YL8A 2Y7BA 3BINA 2Q13A 3U8ZA 2Z0PA 5JLJB 4F7HA 1Y5OA 2D9VA 2DLWA 3TO1A 2ADZA 4DIXA 4K2OA 2W2XC 2L1CA 3ULBA 4GZUA 4NY0A 4A5KA 1X86A 4KHAA 1OMWA 4EJNA 1DDWA 3DXEA 1XCGA 4HAUB 3A98B 3SYXA 1N3HA 2YSZA 2D9YA 3VIAA 1DDVA 4IFSA 2ZKMX 5HE1A 3U12A 4A6FB 3FSSA 2RVBB 1FGZA 1W1DA 2LOZA 1MKEA 1Z87A 4K2PA 2M14A 3AJ4A 1TXDA 4TKNA 5FI1A 4D6WA 2MWNB 1EF1A 1NTYA 1WGQA 3SV1A 4D0NB 4DX8A 5D3VA 3MDBC 2AL6A 2D9WA 2ROVA 2EMTA 4HDQA 4GPTB 2H7EA 5HE0A 1OY2A 3B77A 2DKPA 3ZDTA 2RSGA 4L1RA 4CYEA 3A8QA 2COAA 4IOYX 5DHFB 3P7ZA 3MPXA 4F7UP 4HB0B 1UEFA 3HQCA 1B55A 4B6HA 1U5GA 3X23A 2RUKB 1BAKA 1PLSA 3ZVRA 4TYZA 2CY4A 2MDXA 2RNRB 3UZTA 5D3WA 1LB1A 5I2SA 1PFJA 1X05A 4KHBA 4EKUA 4HB3B 2YS3A 5LONB 1XKEA 4EMOA 2DX1A 4GNKB 5LOPB 2G35A 2M38A 2D11A 5D3YA 4MY6A 3U7DA 3PVWA 3T06A 5DH9B 3WYFB 1FAOA 1BTNA 3PG7A 4QXAB 4C0AA 2VSZA 2X18A 2R2YA 2W2XD 1UNPA 2VRWB 4ZRJA 1V5MA 2DYQA 3SNHA 1QC6A 2AEHA 2LG1A 2Z0OA 1WG7A 1MIZB 1P3RA 1GC6A 1P5TA 2RGNB 5C79A 5DHAB 5DI9B 3NWAA 2R09A 3M1IB 1SGHA 2Z13A 3HW2B 2DHKA 4GMVA 3D8DA 5C5BB 2KIEA 1U5DA 1X11A 2DN6A 5JP4A 1AWEA 3CIKA 1DROA 5HE3A 4HB2B 1M7RA 1T77A 1FHOA 2GUMA 3OHMB 2KGXB 2RRFA 4A6FA 3P6AA 2KR0A 1DBHA 1NU2A 3BJIA 4H8SA 3FEHA 2FJLA 2CY5A 3ODXA 4CHMA 3A8PA 1K5GB 4NSWA 2BCJA 2NBVA 1U29A 2Z59A 1XR0B 1MPHA 3WA0A 2D9XA 4HHVA 3ODWA 5FI0A 4QJ4B 1WJ1A 2YS5A 1I2HA 1WVHA 3G9WA 1FHXA 1X1GA 1W1GA 5J3TA 2DFKA 4GOUA 3TVVA 2YT2A 5IRSA 1NTVA 1PMSA 2CRFA 1UPQA 4PQ0A 2I1KA 2GS0A 3QBVB 5J3YA 2IYBA 3KRXA 4WVFB 2CAYA 3GYOA 4Z2MB 2I5FA 2KIGA 1KZ7A 1ZC3B 3PVUA 2LOXA 2FJUB 3PP2A 3KY9A 2EMSA 4HAWB 1IRSA 1RRPB 3QIJA 4HAVB 1U27A 4HAXB 4Y94A 2DHJA 1KI1B 4HDOA 4P7IA 1EVHA 5KQ1A 2ROZB 1FB8A 3TCAA 5EFXA 4CSQA 4ZRKA 2OQBA 2P8VA 2YRYA 2L2IA 1XX0A 1ZC4B 1WI1A 4CHJA 2Z4DA 1ZYIA 4GXBA 1EAZA 2K00A 2YF0A 2YVCA 1K5DB 5C16A 4DBBA 2YT0A 2LYDA 1J19A 2JP2A 1GC7A 3QWMA 3HIEA 3TW1A 1Y19B 1QQGA 1ZVRA 1MIXA 2EJ8A 1V89A 4GN1A 3DXDA 2Y8GA 2D2QA 3KZ1A 4HAZB 2K2UA 4IAPA 3HSAA 2J0KA 2Y8FA 2QKMA 5C5BA 2NZ8B 1V61A 2YT1A 3PSCA 5M4YB 4YONA 4A6KA 4KVGB 2Z14A 2COFA 1LW3A 1SHCA 4HAYB 1MI1A 1E5WA 1MK7B 2PZ1A 2H7DA 2UZSA 5I2MA 1Q67A 3SUZA 2COCA 3ODOA 3ULCA 2NMBA 3TFMA 1U2BA 2LULA 1DYNA 2D10A 2W2WA 1OQNA 5HE2A 5GOWB 2MKRA 4GMXB 5J3QA 3AU4A 2RLOA 3KRWA 3N7CA 4BBKA 2J59M 2K8EA 2N0YA 4WSFA 1U5FA 3KSYA 3SO6A 4MK0A 2XQNM 3F5RA 3PZDA 2GJYA 2I5CA 1MK9B 2KUQA 4KHOA 1ISNA 1WJMA 1M7EA 2V76A 5LG4B 2HE7A 2KUPA 2J0MA 5CLQB 4HSIA 4HATB 5D27A 3DCXA 1UPRA 1X1FA 4OSNA 1FOEA 2D9ZA 1FGYA 2Z0QA 2DX5A 3NW8A 1V5UA 1DDMA 2CODA 1UNQA 5CLLB 2ELBA 1BWNA 2UZRA 2YS1A 5KQ4A 2EC1A 3NWDA 1FHWA 4K17A 1ZM0A 1ZSQA 2VKIA 2R0DA 3IVFA 1WGUA 3LJUX 3PVLA 5JHGA 2E2XA 4OT1A 1AQCA 1XD4A 4PNKA 2OTXA 3DXCA 1TJ6A 3OANA 5L81A 4DX90 2N23A 2P0HA 5KCVA 2UVMA 2J0JA 2HTHB 2LKOA 4F7GA 1H10A 1H4RA 1XODA 4Z2NA 2K2JA 1P6SA 2ZPYA 3F0WA 3A58A 2DYNA 3FM8C 3PEGA 4HB4B 4KAXB 1V88A 2GCLA 1RJ2A 4A6HA 3ML4A 2DA0A 3HK0A 2ELAA 3NSUA 1MAIA 1I7AA 2IFSA 2GCJA 5DIFB 3V5WA 4WJ7A 4KHBB 1BTKA
chains in the Genus database with same CATH topology
5C6RA 3D8FA 1GG3A 1NI2A 3CXBB 1UNRA 1U5EA 1V5PA 4XWXA 3VOQA 4DXAB 1W1HA 4K81A 4ZRIA 1KZGA 5JHHA 5D3XA 1J0WA 2MFQA 1EGXA 3RCPA 2QKLA 3GYPA 2D4QA 2DHIA 3D8EA 4MT7A 2DTCA 3O96A 2P0FA 2DKQA 3AU5A 2I1JA 4L6EA 1TQZA 2KCJA 2P0DA 4YL8A 2Y7BA 3BINA 2Q13A 3U8ZA 2Z0PA 5JLJB 4F7HA 1Y5OA 2D9VA 2DLWA 3TO1A 2ADZA 4K2OA 2W2XC 2L1CA 3ULBA 4GZUA 4NY0A 4A5KA 1X86A 4KHAA 1OMWA 4EJNA 1DDWA 3DXEA 1XCGA 4HAUB 3A98B 3SYXA 1N3HA 2YSZA 2D9YA 3VIAA 1DDVA 4IFSA 5HE1A 4A6FB 3FSSA 2RVBB 1FGZA 1W1DA 2LOZA 1MKEA 1Z87A 4K2PA 2M14A 3AJ4A 1TXDA 4TKNA 5FI1A 2MWNB 1EF1A 1NTYA 1WGQA 3SV1A 4D0NB 4DX8A 5D3VA 3MDBC 2AL6A 2D9WA 2ROVA 2EMTA 4HDQA 4GPTB 2H7EA 5HE0A 1OY2A 2DKPA 3ZDTA 2RSGA 4CYEA 3A8QA 2COAA 4IOYX 5DHFB 3P7ZA 3MPXA 4F7UP 4HB0B 1UEFA 3HQCA 1B55A 4B6HA 1U5GA 3X23A 2RUKB 1BAKA 1PLSA 3ZVRA 4TYZA 2CY4A 2MDXA 2RNRB 3UZTA 5D3WA 1LB1A 1PFJA 1X05A 4EKUA 4HB3B 2YS3A 5LONB 1XKEA 4EMOA 2DX1A 5LOPB 2G35A 2M38A 2D11A 5D3YA 4MY6A 3U7DA 3PVWA 3T06A 5DH9B 3WYFB 1FAOA 1BTNA 3PG7A 4C0AA 2VSZA 2X18A 2W2XD 1UNPA 2VRWB 4ZRJA 1V5MA 2DYQA 3SNHA 1QC6A 2AEHA 2LG1A 2Z0OA 1WG7A 1MIZB 1P3RA 1GC6A 1P5TA 2RGNB 5C79A 5DHAB 5DI9B 2R09A 3M1IB 1SGHA 3HW2B 2DHKA 4GMVA 3D8DA 5C5BB 1U5DA 1X11A 2DN6A 5JP4A 1AWEA 3CIKA 1DROA 5HE3A 4HB2B 1M7RA 1FHOA 2KGXB 4A6FA 3P6AA 1DBHA 1NU2A 3BJIA 4H8SA 3FEHA 2FJLA 2CY5A 3ODXA 4CHMA 3A8PA 1K5GB 4NSWA 2BCJA 1U29A 1XR0B 1MPHA 3WA0A 2D9XA 4HHVA 3ODWA 5FI0A 1WJ1A 2YS5A 1I2HA 1WVHA 3G9WA 1FHXA 1X1GA 1W1GA 5J3TA 2DFKA 3TVVA 1NTVA 1PMSA 2CRFA 1UPQA 4PQ0A 2I1KA 2GS0A 3QBVB 5J3YA 2IYBA 3KRXA 4WVFB 2CAYA 3GYOA 4Z2MB 2I5FA 1KZ7A 1ZC3B 3PVUA 2LOXA 3PP2A 3KY9A 2EMSA 4HAWB 1IRSA 1RRPB 3QIJA 4HAVB 1U27A 4HAXB 4Y94A 2DHJA 1KI1B 4HDOA 4P7IA 1EVHA 5KQ1A 2ROZB 1FB8A 3TCAA 5EFXA 4ZRKA 2OQBA 2P8VA 2YRYA 2L2IA 1XX0A 1ZC4B 1WI1A 4CHJA 4GXBA 1EAZA 2K00A 2YF0A 2YVCA 1K5DB 5C16A 4DBBA 2YT0A 2LYDA 1J19A 2JP2A 1GC7A 3QWMA 3TW1A 1Y19B 1QQGA 1ZVRA 1MIXA 2EJ8A 1V89A 4GN1A 3DXDA 2Y8GA 2D2QA 3KZ1A 4HAZB 2K2UA 4IAPA 2J0KA 2Y8FA 2QKMA 5C5BA 2NZ8B 1V61A 2YT1A 3PSCA 4YONA 4A6KA 4KVGB 2COFA 1LW3A 1SHCA 4HAYB 1E5WA 1MK7B 2PZ1A 2H7DA 2UZSA 1Q67A 3SUZA 2COCA 3ODOA 3ULCA 2NMBA 3TFMA 1U2BA 2LULA 1DYNA 2D10A 2W2WA 1OQNA 5HE2A 5GOWB 2MKRA 4GMXB 5J3QA 3AU4A 2RLOA 3KRWA 3N7CA 4BBKA 2J59M 2N0YA 4WSFA 1U5FA 3KSYA 3SO6A 4MK0A 2XQNM 3F5RA 3PZDA 2GJYA 2I5CA 1MK9B 4KHOA 1ISNA 1WJMA 1M7EA 2V76A 2HE7A 2KUPA 2J0MA 5CLQB 4HATB 5D27A 1UPRA 1X1FA 1FOEA 2D9ZA 1FGYA 2Z0QA 2DX5A 1V5UA 1DDMA 2CODA 1UNQA 5CLLB 2ELBA 1BWNA 2UZRA 2YS1A 5KQ4A 2EC1A 1FHWA 4K17A 1ZM0A 1ZSQA 2VKIA 2R0DA 3IVFA 1WGUA 3LJUX 3PVLA 5JHGA 2E2XA 1AQCA 1XD4A 4PNKA 2OTXA 3DXCA 1TJ6A 3OANA 5L81A 4DX90 2N23A 2P0HA 5KCVA 2UVMA 2J0JA 2HTHB 2LKOA 4F7GA 1H10A 1H4RA 1XODA 4Z2NA 2K2JA 1P6SA 2ZPYA 3F0WA 2DYNA 3FM8C 3PEGA 4HB4B 4KAXB 1V88A 2GCLA 1RJ2A 4A6HA 3ML4A 2DA0A 3HK0A 2ELAA 3NSUA 1MAIA 1I7AA 2IFSA 2GCJA 5DIFB 3V5WA 4WJ7A 4KHBB 1BTKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C6R A;  3D8F A;  1GG3 A;  1NI2 A;  3CXB B;  1UNR A;  1U5E A;  1V5P A;  4XWX A;  3VOQ A;  4DXA B;  1W1H A;  4K81 A;  4ZRI A;  1KZG A;  5JHH A;  5D3X A;  1J0W A;  2MFQ A;  1EGX A;  3RCP A;  2QKL A;  3GYP A;  2D4Q A;  2DHI A;  3D8E A;  4MT7 A;  2DTC A;  3O96 A;  2P0F A;  2DKQ A;  3AU5 A;  2I1J A;  4L6E A;  1TQZ A;  2KCJ A;  2P0D A;  4YL8 A;  2Y7B A;  3BIN A;  2Q13 A;  3U8Z A;  2Z0P A;  5JLJ B;  4F7H A;  1Y5O A;  2D9V A;  2DLW A;  3TO1 A;  2ADZ A;  4K2O A;  2W2X C;  2L1C A;  3ULB A;  4GZU A;  4NY0 A;  4A5K A;  1X86 A;  4KHA A;  1OMW A;  4EJN A;  1DDW A;  3DXE A;  1XCG A;  4HAU B;  3A98 B;  3SYX A;  1N3H A;  2YSZ A;  2D9Y A;  3VIA A;  1DDV A;  4IFS A;  5HE1 A;  4A6F B;  3FSS A;  2RVB B;  1FGZ A;  1W1D A;  2LOZ A;  1MKE A;  1Z87 A;  4K2P A;  2M14 A;  3AJ4 A;  1TXD A;  4TKN A;  5FI1 A;  2MWN B;  1EF1 A;  1NTY A;  1WGQ A;  3SV1 A;  4D0N B;  4DX8 A;  5D3V A;  3MDB C;  2AL6 A;  2D9W A;  2ROV A;  2EMT A;  4HDQ A;  4GPT B;  2H7E A;  5HE0 A;  1OY2 A;  2DKP A;  3ZDT A;  2RSG A;  4CYE A;  3A8Q A;  2COA A;  4IOY X;  5DHF B;  3P7Z A;  3MPX A;  4F7U P;  4HB0 B;  1UEF A;  3HQC A;  1B55 A;  4B6H A;  1U5G A;  3X23 A;  2RUK B;  1BAK A;  1PLS A;  3ZVR A;  4TYZ A;  2CY4 A;  2MDX A;  2RNR B;  3UZT A;  5D3W A;  1LB1 A;  1PFJ A;  1X05 A;  4EKU A;  4HB3 B;  2YS3 A;  5LON B;  1XKE A;  4EMO A;  2DX1 A;  5LOP B;  2G35 A;  2M38 A;  2D11 A;  5D3Y A;  4MY6 A;  3U7D A;  3PVW A;  3T06 A;  5DH9 B;  3WYF B;  1FAO A;  1BTN A;  3PG7 A;  4C0A A;  2VSZ A;  2X18 A;  2W2X D;  1UNP A;  2VRW B;  4ZRJ A;  1V5M A;  2DYQ A;  3SNH A;  1QC6 A;  2AEH A;  2LG1 A;  2Z0O A;  1WG7 A;  1MIZ B;  1P3R A;  1GC6 A;  1P5T A;  2RGN B;  5C79 A;  5DHA B;  5DI9 B;  2R09 A;  3M1I B;  1SGH A;  3HW2 B;  2DHK A;  4GMV A;  3D8D A;  5C5B B;  1U5D A;  1X11 A;  2DN6 A;  5JP4 A;  1AWE A;  3CIK A;  1DRO A;  5HE3 A;  4HB2 B;  1M7R A;  1FHO A;  2KGX B;  4A6F A;  3P6A A;  1DBH A;  1NU2 A;  3BJI A;  4H8S A;  3FEH A;  2FJL A;  2CY5 A;  3ODX A;  4CHM A;  3A8P A;  1K5G B;  4NSW A;  2BCJ A;  1U29 A;  1XR0 B;  1MPH A;  3WA0 A;  2D9X A;  4HHV A;  3ODW A;  5FI0 A;  1WJ1 A;  2YS5 A;  1I2H A;  1WVH A;  3G9W A;  1FHX A;  1X1G A;  1W1G A;  5J3T A;  2DFK A;  3TVV A;  1NTV A;  1PMS A;  2CRF A;  1UPQ A;  4PQ0 A;  2I1K A;  2GS0 A;  3QBV B;  5J3Y A;  2IYB A;  3KRX A;  4WVF B;  2CAY A;  3GYO A;  4Z2M B;  2I5F A;  1KZ7 A;  1ZC3 B;  3PVU A;  2LOX A;  3PP2 A;  3KY9 A;  2EMS A;  4HAW B;  1IRS A;  1RRP B;  3QIJ A;  4HAV B;  1U27 A;  4HAX B;  4Y94 A;  2DHJ A;  1KI1 B;  4HDO A;  4P7I A;  1EVH A;  5KQ1 A;  2ROZ B;  1FB8 A;  3TCA A;  5EFX A;  4ZRK A;  2OQB A;  2P8V A;  2YRY A;  2L2I A;  1XX0 A;  1ZC4 B;  1WI1 A;  4CHJ A;  4GXB A;  1EAZ A;  2K00 A;  2YF0 A;  2YVC A;  1K5D B;  5C16 A;  4DBB A;  2YT0 A;  2LYD A;  1J19 A;  2JP2 A;  1GC7 A;  3QWM A;  3TW1 A;  1Y19 B;  1QQG A;  1ZVR A;  1MIX A;  2EJ8 A;  1V89 A;  4GN1 A;  3DXD A;  2Y8G A;  2D2Q A;  3KZ1 A;  4HAZ B;  2K2U A;  4IAP A;  2J0K A;  2Y8F A;  2QKM A;  5C5B A;  2NZ8 B;  1V61 A;  2YT1 A;  3PSC A;  4YON A;  4A6K A;  4KVG B;  2COF A;  1LW3 A;  1SHC A;  4HAY B;  1E5W A;  1MK7 B;  2PZ1 A;  2H7D A;  2UZS A;  1Q67 A;  3SUZ A;  2COC A;  3ODO A;  3ULC A;  2NMB A;  3TFM A;  1U2B A;  2LUL A;  1DYN A;  2D10 A;  2W2W A;  1OQN A;  5HE2 A;  5GOW B;  2MKR A;  4GMX B;  5J3Q A;  3AU4 A;  2RLO A;  3KRW A;  3N7C A;  4BBK A;  2J59 M;  2N0Y A;  4WSF A;  1U5F A;  3KSY A;  3SO6 A;  4MK0 A;  2XQN M;  3F5R A;  3PZD A;  2GJY A;  2I5C A;  1MK9 B;  4KHO A;  1ISN A;  1WJM A;  1M7E A;  2V76 A;  2HE7 A;  2KUP A;  2J0M A;  5CLQ B;  4HAT B;  5D27 A;  1UPR A;  1X1F A;  1FOE A;  2D9Z A;  1FGY A;  2Z0Q A;  2DX5 A;  1V5U A;  1DDM A;  2COD A;  1UNQ A;  5CLL B;  2ELB A;  1BWN A;  2UZR A;  2YS1 A;  5KQ4 A;  2EC1 A;  1FHW A;  4K17 A;  1ZM0 A;  1ZSQ A;  2VKI A;  2R0D A;  3IVF A;  1WGU A;  3LJU X;  3PVL A;  5JHG A;  2E2X A;  1AQC A;  1XD4 A;  4PNK A;  2OTX A;  3DXC A;  1TJ6 A;  3OAN A;  5L81 A;  4DX9 0;  2N23 A;  2P0H A;  5KCV A;  2UVM A;  2J0J A;  2HTH B;  2LKO A;  4F7G A;  1H10 A;  1H4R A;  1XOD A;  4Z2N A;  2K2J A;  1P6S A;  2ZPY A;  3F0W A;  2DYN A;  3FM8 C;  3PEG A;  4HB4 B;  4KAX B;  1V88 A;  2GCL A;  1RJ2 A;  4A6H A;  3ML4 A;  2DA0 A;  3HK0 A;  2ELA A;  3NSU A;  1MAI A;  1I7A A;  2IFS A;  2GCJ A;  5DIF B;  3V5W A;  4WJ7 A;  4KHB B;  1BTK A; 
#chains in the Genus database with same CATH topology
 5C6R A;  3D8F A;  1GG3 A;  1NI2 A;  3CXB B;  4QJ3 B;  1UNR A;  1U5E A;  1V5P A;  4XWX A;  3VOQ A;  4DXA B;  1W1H A;  4K81 A;  4ZRI A;  4QJ5 B;  1KZG A;  5JHH A;  3NWF A;  5D3X A;  1J0W A;  2MFQ A;  1EGX A;  3RCP A;  3GYP A;  2QKL A;  2D4Q A;  2DHI A;  3D8E A;  4MT7 A;  2DTC A;  3O96 A;  2P0F A;  3FVC A;  2DKQ A;  3AU5 A;  2I1J A;  4L6E A;  2K49 A;  1TQZ A;  2KCJ A;  2P0D A;  4YL8 A;  2Y7B A;  3BIN A;  2Q13 A;  3U8Z A;  2Z0P A;  5JLJ B;  4F7H A;  1Y5O A;  2D9V A;  2DLW A;  3TO1 A;  2ADZ A;  4DIX A;  4K2O A;  2W2X C;  2L1C A;  3ULB A;  4GZU A;  4NY0 A;  4A5K A;  1X86 A;  4KHA A;  1OMW A;  4EJN A;  1DDW A;  3DXE A;  1XCG A;  4HAU B;  3A98 B;  3SYX A;  1N3H A;  2YSZ A;  2D9Y A;  3VIA A;  1DDV A;  4IFS A;  2ZKM X;  5HE1 A;  3U12 A;  4A6F B;  3FSS A;  2RVB B;  1FGZ A;  1W1D A;  2LOZ A;  1MKE A;  1Z87 A;  4K2P A;  2M14 A;  3AJ4 A;  1TXD A;  4TKN A;  5FI1 A;  4D6W A;  2MWN B;  1EF1 A;  1NTY A;  1WGQ A;  3SV1 A;  4D0N B;  4DX8 A;  5D3V A;  3MDB C;  2AL6 A;  2D9W A;  2ROV A;  2EMT A;  4HDQ A;  4GPT B;  2H7E A;  5HE0 A;  1OY2 A;  3B77 A;  2DKP A;  3ZDT A;  2RSG A;  4L1R A;  4CYE A;  3A8Q A;  2COA A;  4IOY X;  5DHF B;  3P7Z A;  3MPX A;  4F7U P;  4HB0 B;  1UEF A;  3HQC A;  1B55 A;  4B6H A;  1U5G A;  3X23 A;  2RUK B;  1BAK A;  1PLS A;  3ZVR A;  4TYZ A;  2CY4 A;  2MDX A;  2RNR B;  3UZT A;  5D3W A;  1LB1 A;  5I2S A;  1PFJ A;  1X05 A;  4KHB A;  4EKU A;  4HB3 B;  2YS3 A;  5LON B;  1XKE A;  4EMO A;  2DX1 A;  4GNK B;  5LOP B;  2G35 A;  2M38 A;  2D11 A;  5D3Y A;  4MY6 A;  3U7D A;  3PVW A;  3T06 A;  5DH9 B;  3WYF B;  1FAO A;  1BTN A;  3PG7 A;  4QXA B;  4C0A A;  2VSZ A;  2X18 A;  2R2Y A;  2W2X D;  1UNP A;  2VRW B;  4ZRJ A;  1V5M A;  2DYQ A;  3SNH A;  1QC6 A;  2AEH A;  2LG1 A;  2Z0O A;  1WG7 A;  1MIZ B;  1P3R A;  1GC6 A;  1P5T A;  2RGN B;  5C79 A;  5DHA B;  5DI9 B;  3NWA A;  2R09 A;  3M1I B;  1SGH A;  2Z13 A;  3HW2 B;  2DHK A;  4GMV A;  3D8D A;  5C5B B;  2KIE A;  1U5D A;  1X11 A;  2DN6 A;  5JP4 A;  1AWE A;  3CIK A;  1DRO A;  5HE3 A;  4HB2 B;  1M7R A;  1T77 A;  1FHO A;  2GUM A;  3OHM B;  2KGX B;  2RRF A;  4A6F A;  3P6A A;  2KR0 A;  1DBH A;  1NU2 A;  3BJI A;  4H8S A;  3FEH A;  2FJL A;  2CY5 A;  3ODX A;  4CHM A;  3A8P A;  1K5G B;  4NSW A;  2BCJ A;  2NBV A;  1U29 A;  2Z59 A;  1XR0 B;  1MPH A;  3WA0 A;  2D9X A;  4HHV A;  3ODW A;  5FI0 A;  4QJ4 B;  1WJ1 A;  2YS5 A;  1I2H A;  1WVH A;  3G9W A;  1FHX A;  1X1G A;  1W1G A;  5J3T A;  2DFK A;  4GOU A;  3TVV A;  2YT2 A;  5IRS A;  1NTV A;  1PMS A;  2CRF A;  1UPQ A;  4PQ0 A;  2I1K A;  2GS0 A;  3QBV B;  5J3Y A;  2IYB A;  3KRX A;  4WVF B;  2CAY A;  3GYO A;  4Z2M B;  2I5F A;  2KIG A;  1KZ7 A;  1ZC3 B;  3PVU A;  2LOX A;  2FJU B;  3PP2 A;  3KY9 A;  2EMS A;  4HAW B;  1IRS A;  1RRP B;  3QIJ A;  4HAV B;  1U27 A;  4HAX B;  4Y94 A;  2DHJ A;  1KI1 B;  4HDO A;  4P7I A;  1EVH A;  5KQ1 A;  2ROZ B;  1FB8 A;  3TCA A;  5EFX A;  4CSQ A;  4ZRK A;  2OQB A;  2P8V A;  2YRY A;  2L2I A;  1XX0 A;  1ZC4 B;  1WI1 A;  4CHJ A;  2Z4D A;  1ZYI A;  4GXB A;  1EAZ A;  2K00 A;  2YF0 A;  2YVC A;  1K5D B;  5C16 A;  4DBB A;  2YT0 A;  2LYD A;  1J19 A;  2JP2 A;  1GC7 A;  3QWM A;  3HIE A;  3TW1 A;  1Y19 B;  1QQG A;  1ZVR A;  1MIX A;  2EJ8 A;  1V89 A;  4GN1 A;  3DXD A;  2Y8G A;  2D2Q A;  3KZ1 A;  4HAZ B;  2K2U A;  4IAP A;  3HSA A;  2J0K A;  2Y8F A;  2QKM A;  5C5B A;  2NZ8 B;  1V61 A;  2YT1 A;  3PSC A;  5M4Y B;  4YON A;  4A6K A;  4KVG B;  2Z14 A;  2COF A;  1LW3 A;  1SHC A;  4HAY B;  1MI1 A;  1E5W A;  1MK7 B;  2PZ1 A;  2H7D A;  2UZS A;  5I2M A;  1Q67 A;  3SUZ A;  2COC A;  3ODO A;  3ULC A;  2NMB A;  3TFM A;  1U2B A;  2LUL A;  1DYN A;  2D10 A;  2W2W A;  1OQN A;  5HE2 A;  5GOW B;  2MKR A;  4GMX B;  5J3Q A;  3AU4 A;  2RLO A;  3KRW A;  3N7C A;  4BBK A;  2J59 M;  2K8E A;  2N0Y A;  4WSF A;  1U5F A;  3KSY A;  3SO6 A;  4MK0 A;  2XQN M;  3F5R A;  3PZD A;  2GJY A;  2I5C A;  1MK9 B;  2KUQ A;  4KHO A;  1ISN A;  1WJM A;  1M7E A;  2V76 A;  5LG4 B;  2HE7 A;  2KUP A;  2J0M A;  5CLQ B;  4HSI A;  4HAT B;  5D27 A;  3DCX A;  1UPR A;  1X1F A;  4OSN A;  1FOE A;  2D9Z A;  1FGY A;  2Z0Q A;  2DX5 A;  3NW8 A;  1V5U A;  1DDM A;  2COD A;  1UNQ A;  5CLL B;  2ELB A;  1BWN A;  2UZR A;  2YS1 A;  5KQ4 A;  2EC1 A;  3NWD A;  1FHW A;  4K17 A;  1ZM0 A;  1ZSQ A;  2VKI A;  2R0D A;  3IVF A;  1WGU A;  3LJU X;  3PVL A;  5JHG A;  2E2X A;  4OT1 A;  1AQC A;  1XD4 A;  4PNK A;  2OTX A;  3DXC A;  1TJ6 A;  3OAN A;  5L81 A;  4DX9 0;  2N23 A;  2P0H A;  5KCV A;  2UVM A;  2J0J A;  2HTH B;  2LKO A;  4F7G A;  1H10 A;  1H4R A;  1XOD A;  4Z2N A;  2K2J A;  1P6S A;  2ZPY A;  3F0W A;  3A58 A;  2DYN A;  3FM8 C;  3PEG A;  4HB4 B;  4KAX B;  1V88 A;  2GCL A;  1RJ2 A;  4A6H A;  3ML4 A;  2DA0 A;  3HK0 A;  2ELA A;  3NSU A;  1MAI A;  1I7A A;  2IFS A;  2GCJ A;  5DIF B;  3V5W A;  4WJ7 A;  4KHB B;  1BTK A; 
#chains in the Genus database with same CATH homology
 5C6R A;  3D8F A;  1GG3 A;  1NI2 A;  3CXB B;  1UNR A;  1U5E A;  1V5P A;  4XWX A;  3VOQ A;  4DXA B;  1W1H A;  4K81 A;  4ZRI A;  1KZG A;  5JHH A;  5D3X A;  1J0W A;  2MFQ A;  1EGX A;  3RCP A;  2QKL A;  3GYP A;  2D4Q A;  2DHI A;  3D8E A;  4MT7 A;  2DTC A;  3O96 A;  2P0F A;  2DKQ A;  3AU5 A;  2I1J A;  4L6E A;  1TQZ A;  2KCJ A;  2P0D A;  4YL8 A;  2Y7B A;  3BIN A;  2Q13 A;  3U8Z A;  2Z0P A;  5JLJ B;  4F7H A;  1Y5O A;  2D9V A;  2DLW A;  3TO1 A;  2ADZ A;  4K2O A;  2W2X C;  2L1C A;  3ULB A;  4GZU A;  4NY0 A;  4A5K A;  1X86 A;  4KHA A;  1OMW A;  4EJN A;  1DDW A;  3DXE A;  1XCG A;  4HAU B;  3A98 B;  3SYX A;  1N3H A;  2YSZ A;  2D9Y A;  3VIA A;  1DDV A;  4IFS A;  5HE1 A;  4A6F B;  3FSS A;  2RVB B;  1FGZ A;  1W1D A;  2LOZ A;  1MKE A;  1Z87 A;  4K2P A;  2M14 A;  3AJ4 A;  1TXD A;  4TKN A;  5FI1 A;  2MWN B;  1EF1 A;  1NTY A;  1WGQ A;  3SV1 A;  4D0N B;  4DX8 A;  5D3V A;  3MDB C;  2AL6 A;  2D9W A;  2ROV A;  2EMT A;  4HDQ A;  4GPT B;  2H7E A;  5HE0 A;  1OY2 A;  2DKP A;  3ZDT A;  2RSG A;  4CYE A;  3A8Q A;  2COA A;  4IOY X;  5DHF B;  3P7Z A;  3MPX A;  4F7U P;  4HB0 B;  1UEF A;  3HQC A;  1B55 A;  4B6H A;  1U5G A;  3X23 A;  2RUK B;  1BAK A;  1PLS A;  3ZVR A;  4TYZ A;  2CY4 A;  2MDX A;  2RNR B;  3UZT A;  5D3W A;  1LB1 A;  1PFJ A;  1X05 A;  4EKU A;  4HB3 B;  2YS3 A;  5LON B;  1XKE A;  4EMO A;  2DX1 A;  5LOP B;  2G35 A;  2M38 A;  2D11 A;  5D3Y A;  4MY6 A;  3U7D A;  3PVW A;  3T06 A;  5DH9 B;  3WYF B;  1FAO A;  1BTN A;  3PG7 A;  4C0A A;  2VSZ A;  2X18 A;  2W2X D;  1UNP A;  2VRW B;  4ZRJ A;  1V5M A;  2DYQ A;  3SNH A;  1QC6 A;  2AEH A;  2LG1 A;  2Z0O A;  1WG7 A;  1MIZ B;  1P3R A;  1GC6 A;  1P5T A;  2RGN B;  5C79 A;  5DHA B;  5DI9 B;  2R09 A;  3M1I B;  1SGH A;  3HW2 B;  2DHK A;  4GMV A;  3D8D A;  5C5B B;  1U5D A;  1X11 A;  2DN6 A;  5JP4 A;  1AWE A;  3CIK A;  1DRO A;  5HE3 A;  4HB2 B;  1M7R A;  1FHO A;  2KGX B;  4A6F A;  3P6A A;  1DBH A;  1NU2 A;  3BJI A;  4H8S A;  3FEH A;  2FJL A;  2CY5 A;  3ODX A;  4CHM A;  3A8P A;  1K5G B;  4NSW A;  2BCJ A;  1U29 A;  1XR0 B;  1MPH A;  3WA0 A;  2D9X A;  4HHV A;  3ODW A;  5FI0 A;  1WJ1 A;  2YS5 A;  1I2H A;  1WVH A;  3G9W A;  1FHX A;  1X1G A;  1W1G A;  5J3T A;  2DFK A;  3TVV A;  1NTV A;  1PMS A;  2CRF A;  1UPQ A;  4PQ0 A;  2I1K A;  2GS0 A;  3QBV B;  5J3Y A;  2IYB A;  3KRX A;  4WVF B;  2CAY A;  3GYO A;  4Z2M B;  2I5F A;  1KZ7 A;  1ZC3 B;  3PVU A;  2LOX A;  3PP2 A;  3KY9 A;  2EMS A;  4HAW B;  1IRS A;  1RRP B;  3QIJ A;  4HAV B;  1U27 A;  4HAX B;  4Y94 A;  2DHJ A;  1KI1 B;  4HDO A;  4P7I A;  1EVH A;  5KQ1 A;  2ROZ B;  1FB8 A;  3TCA A;  5EFX A;  4ZRK A;  2OQB A;  2P8V A;  2YRY A;  2L2I A;  1XX0 A;  1ZC4 B;  1WI1 A;  4CHJ A;  4GXB A;  1EAZ A;  2K00 A;  2YF0 A;  2YVC A;  1K5D B;  5C16 A;  4DBB A;  2YT0 A;  2LYD A;  1J19 A;  2JP2 A;  1GC7 A;  3QWM A;  3TW1 A;  1Y19 B;  1QQG A;  1ZVR A;  1MIX A;  2EJ8 A;  1V89 A;  4GN1 A;  3DXD A;  2Y8G A;  2D2Q A;  3KZ1 A;  4HAZ B;  2K2U A;  4IAP A;  2J0K A;  2Y8F A;  2QKM A;  5C5B A;  2NZ8 B;  1V61 A;  2YT1 A;  3PSC A;  4YON A;  4A6K A;  4KVG B;  2COF A;  1LW3 A;  1SHC A;  4HAY B;  1E5W A;  1MK7 B;  2PZ1 A;  2H7D A;  2UZS A;  1Q67 A;  3SUZ A;  2COC A;  3ODO A;  3ULC A;  2NMB A;  3TFM A;  1U2B A;  2LUL A;  1DYN A;  2D10 A;  2W2W A;  1OQN A;  5HE2 A;  5GOW B;  2MKR A;  4GMX B;  5J3Q A;  3AU4 A;  2RLO A;  3KRW A;  3N7C A;  4BBK A;  2J59 M;  2N0Y A;  4WSF A;  1U5F A;  3KSY A;  3SO6 A;  4MK0 A;  2XQN M;  3F5R A;  3PZD A;  2GJY A;  2I5C A;  1MK9 B;  4KHO A;  1ISN A;  1WJM A;  1M7E A;  2V76 A;  2HE7 A;  2KUP A;  2J0M A;  5CLQ B;  4HAT B;  5D27 A;  1UPR A;  1X1F A;  1FOE A;  2D9Z A;  1FGY A;  2Z0Q A;  2DX5 A;  1V5U A;  1DDM A;  2COD A;  1UNQ A;  5CLL B;  2ELB A;  1BWN A;  2UZR A;  2YS1 A;  5KQ4 A;  2EC1 A;  1FHW A;  4K17 A;  1ZM0 A;  1ZSQ A;  2VKI A;  2R0D A;  3IVF A;  1WGU A;  3LJU X;  3PVL A;  5JHG A;  2E2X A;  1AQC A;  1XD4 A;  4PNK A;  2OTX A;  3DXC A;  1TJ6 A;  3OAN A;  5L81 A;  4DX9 0;  2N23 A;  2P0H A;  5KCV A;  2UVM A;  2J0J A;  2HTH B;  2LKO A;  4F7G A;  1H10 A;  1H4R A;  1XOD A;  4Z2N A;  2K2J A;  1P6S A;  2ZPY A;  3F0W A;  2DYN A;  3FM8 C;  3PEG A;  4HB4 B;  4KAX B;  1V88 A;  2GCL A;  1RJ2 A;  4A6H A;  3ML4 A;  2DA0 A;  3HK0 A;  2ELA A;  3NSU A;  1MAI A;  1I7A A;  2IFS A;  2GCJ A;  5DIF B;  3V5W A;  4WJ7 A;  4KHB B;  1BTK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...