1UPQA

Crystal structure of the pleckstrin homology (ph) domain of pepp1
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
107
structure length
107
Chain Sequence
b'LRRDPNLPVHIRGWLHKQDSSGLRLWKRRWFVLSGHCLFYYKDSREESVLGSVLLPSYNIRPDGPGAPRGRRFTFTAEHPGMRTYVLAADTLEDLRGWLRALGRASR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PEPP1
publication title Crystal Structure of the Pleckstrin Homology Domain of Pepp1
rcsb
source organism Homo sapiens
molecule tags Signal transduction
total genus 20
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 2003-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1upqA00
5D3WA 4HAYB 1XX0A 2Z0PA 1Y5OA 1P5TA 1FGYA 5D3YA 5KQ4A 1TJ6A 1WJ1A 3DXCA 3CIKA 1DYNA 1V89A 3TW1A 4CYEA 3QBVB 2Z0QA 2X18A 2ROVA 4GPTB 1V88A 2COFA 5D3XA 1SGHA 1W1HA 4ZRJA 2H7EA 4F7UP 2XQNM 3WYFB 2MDXA 1Y19B 4HB2B 1KZ7A 3T06A 1DBHA 4C0AA 4F7HA 1KZGA 4IAPA 4P7IA 4D0NB 2DX1A 2YT1A 2ELBA 3RCPA 4WVFB 3V5WA 1WI1A 5C6RA 1X1GA 4K2OA 2DHJA 1V5UA 2COAA 4A6FA 2DA0A 4GXBA 2J0MA 3SV1A 2AL6A 2I5CA 5DIFB 3ZDTA 3O96A 5FI0A 5KCVA 5JP4A 1EF1A 2BCJA 2D4QA 1GC6A 2W2XC 4YONA 4KHAA 2EMSA 3A98B 2DKPA 1MK7B 2VSZA 5C16A 4DX90 1U27A 3PP2A 2RGNB 2D2QA 4H8SA 1OY2A 2N0YA 2R09A 2DLWA 4HATB 3ZVRA 3KRWA 3SUZA 2EMTA 3HQCA 5J3QA 1X05A 2UZSA 4HB0B 2LG1A 3WA0A 4L6EA 2FJLA 5KQ1A 4WSFA 1AQCA 1NTVA 1U29A 1J0WA 2LYDA 4HHVA 2YS5A 4Y94A 3P7ZA 3UZTA 4B6HA 3TFMA 3AU4A 3PSCA 3X23A 4HAXB 1UNPA 2DFKA 2KCJA 2IFSA 1RJ2A 4TYZA 1MKEA 2W2XD 4A5KA 3AJ4A 4ZRIA 1ZC4B 1MK9B 5D3VA 2VRWB 1U5DA 2P0HA 4K81A 4NY0A 1IRSA 1OMWA 3FSSA 3NSUA 1MPHA 3PVLA 2IYBA 2I1JA 1FAOA 1X11A 2RSGA 2YS3A 1FHXA 2Z0OA 3CXBB 2RUKB 2G35A 3MPXA 4F7GA 1ISNA 5L81A 2UZRA 1M7EA 2CY4A 1N3HA 1Z87A 1WVHA 2MKRA 1W1DA 3M1IB 2L2IA 3F0WA 2CAYA 5J3TA 4PNKA 4DX8A 3PVUA 3D8EA 2D9XA 1BTKA 1LW3A 2KGXB 2DYNA 2GJYA 1H4RA 4GMXB 1EGXA 1DROA 1NTYA 4MY6A 2R0DA 2YRYA 2J59M 2LOXA 1WGUA 2D9WA 3IVFA 1FGZA 4TKNA 4PQ0A 2D9ZA 3ULCA 3HW2B 5DHAB 3N7CA 1MAIA 1V5PA 1UNQA 3KZ1A 3P6AA 4GMVA 2P8VA 5J3YA 2P0DA 4HB4B 1DDMA 3D8DA 4HAWB 4A6HA 1UPQA 2EJ8A 4KVGB 2DKQA 2NMBA 1PLSA 3PEGA 4EJNA 5C5BA 2JP2A 1GG3A 1J19A 2W2WA 2Y8GA 1K5GB 5C5BB 3PG7A 2DHIA 2M14A 1V5MA 1UPRA 2YT0A 2CRFA 2DHKA 4BBKA 1X86A 2J0KA 5JHGA 2I5FA 1EAZA 5HE3A 2HTHB 3ULBA 1U5GA 2MFQA 1NI2A 3MDBC 3PZDA 5HE2A 1ZC3B 3DXDA 2YF0A 1U5FA 1RRPB 3LJUX 2GCLA 5JLJB 1MIZB 4KHBB 1EVHA 3FM8C 3KRXA 2Y8FA 4NSWA 1NU2A 2AEHA 1MIXA 4HAUB 2K2UA 1FOEA 2DYQA 2L1CA 3PVWA 2QKLA 2UVMA 4ZRKA 2OQBA 1E5WA 4IFSA 3GYOA 2GCJA 5LONB 1AWEA 4K2PA 5GOWB 1K5DB 2D11A 1B55A 2PZ1A 1DDWA 3BJIA 3GYPA 3A8PA 1XCGA 3FEHA 3SO6A 3ML4A 2K2JA 4HDQA 1H10A 1SHCA 5DI9B 1BTNA 2KUPA 2HE7A 2ADZA 5CLLB 2I1KA 2YVCA 4YL8A 4Z2MB 2M38A 2QKMA 2RLOA 3SNHA 1M7RA 1PFJA 1WGQA 4EKUA 4KAXB 3KY9A 2CODA 4HDOA 1WJMA 5C79A 3DXEA 4MT7A 4IOYX 4EMOA 1V61A 5HE0A 2DX5A 2VKIA 1XODA 1P6SA 4HAVB 2DTCA 2YSZA 1ZSQA 3QIJA 4GN1A 2RVBB 1ZM0A 1PMSA 1FHWA 2V76A 2P0FA 1I7AA 4XWXA 1KI1B 5JHHA 3G9WA 1BWNA 3QWMA 5DHFB 1U2BA 1TQZA 4MK0A 1XR0B 2OTXA 4A6FB 3ODOA 4GZUA 1BAKA 3A8QA 4Z2NA 3TVVA 1XD4A 5HE1A 2D10A 3BINA 2YS1A 3VOQA 1XKEA 4CHJA 2EC1A 4KHOA 3ODXA 2ROZB 3KSYA 2H7DA 1Q67A 2NZ8B 5DH9B 2K00A 5EFXA 5D27A 3HK0A 4DXAB 2J0JA 1UNRA 1WG7A 4A6KA 2COCA 3F5RA 2D9YA 2D9VA 5FI1A 2ELAA 1TXDA 1OQNA 1W1GA 3AU5A 3OANA 2RNRB 2N23A 3D8FA 2ZPYA 1FB8A 4HAZB 2E2XA 5CLQB 2DN6A 1UEFA 4HB3B 1I2HA 1ZVRA 3VIAA 2LKOA 4CHMA 1LB1A 1GC7A 1FHOA 1P3RA 4K17A 1QC6A 3TO1A 2MWNB 3ODWA 1DDVA 4WJ7A 3U7DA 1X1FA 1U5EA 3SYXA 2Q13A 5LOPB 3U8ZA 2LULA 2Y7BA 1QQGA 2CY5A 2LOZA 4DBBA 2GS0A 3TCAA
chains in the Genus database with same CATH superfamily
5D3WA 4HAYB 2FJUB 1XX0A 2Z0PA 1Y5OA 1P5TA 1FGYA 5D3YA 5KQ4A 1TJ6A 1WJ1A 3DXCA 3CIKA 1DYNA 1V89A 3TW1A 4CYEA 3QBVB 2Z0QA 2X18A 2ROVA 4GPTB 1V88A 2COFA 5D3XA 1SGHA 2K8EA 5IRSA 2Z13A 1W1HA 4ZRJA 2H7EA 4CSQA 4F7UP 2XQNM 3WYFB 2MDXA 1Y19B 4HB2B 1KZ7A 3NWAA 4HSIA 3T06A 1DBHA 4C0AA 4F7HA 1KZGA 3NW8A 4IAPA 2Z4DA 4P7IA 4D0NB 2DX1A 2YT1A 2ELBA 4DIXA 3RCPA 4L1RA 4WVFB 3V5WA 1WI1A 5C6RA 2Z59A 1X1GA 4K2OA 2DHJA 1V5UA 2COAA 4A6FA 2DA0A 4GXBA 2J0MA 4QXAB 3SV1A 1T77A 2AL6A 2I5CA 5DIFB 3ZDTA 3O96A 1ZYIA 5FI0A 5KCVA 3U12A 4OT1A 3B77A 5JP4A 1EF1A 2RRFA 2BCJA 2D4QA 1GC6A 2W2XC 4YONA 4KHAA 2EMSA 3A98B 2DKPA 1MK7B 2GUMA 2VSZA 5C16A 4DX90 1U27A 3PP2A 2RGNB 2D2QA 4H8SA 1OY2A 2N0YA 2R09A 2DLWA 4GNKB 4HATB 3NWDA 5I2SA 3ZVRA 4QJ4B 3KRWA 3SUZA 2EMTA 3HQCA 5J3QA 1X05A 2UZSA 4HB0B 2LG1A 3HIEA 3WA0A 1MI1A 4L6EA 2FJLA 3OHMB 5KQ1A 4WSFA 1AQCA 1NTVA 1U29A 1J0WA 2LYDA 3FVCA 4HHVA 2YS5A 4Y94A 3P7ZA 3UZTA 3DCXA 4B6HA 3TFMA 3AU4A 3PSCA 3X23A 4HAXB 1UNPA 2DFKA 2KCJA 2IFSA 1RJ2A 4TYZA 1MKEA 2W2XD 2KIEA 4A5KA 3AJ4A 4ZRIA 1ZC4B 1MK9B 5D3VA 2VRWB 1U5DA 2P0HA 4K81A 4NY0A 1IRSA 1OMWA 3FSSA 3NSUA 1MPHA 3PVLA 2IYBA 2I1JA 1FAOA 1X11A 2RSGA 2YS3A 1FHXA 2Z0OA 3CXBB 2RUKB 2NBVA 2G35A 3MPXA 4F7GA 1ISNA 5L81A 2UZRA 1M7EA 2CY4A 1N3HA 1Z87A 1WVHA 2MKRA 1W1DA 3M1IB 2L2IA 3F0WA 2CAYA 5J3TA 4PNKA 4DX8A 3PVUA 3D8EA 2D9XA 1BTKA 1LW3A 2KGXB 3A58A 2DYNA 2GJYA 1H4RA 4GMXB 1EGXA 1DROA 1NTYA 4MY6A 2R0DA 2YRYA 2J59M 2LOXA 1WGUA 2D9WA 2K49A 3IVFA 1FGZA 4TKNA 4PQ0A 2D9ZA 4GOUA 3ULCA 3HW2B 5DHAB 3N7CA 1MAIA 1V5PA 2YT2A 1UNQA 3KZ1A 3P6AA 4GMVA 2P8VA 5J3YA 2P0DA 4HB4B 1DDMA 3D8DA 4HAWB 4A6HA 1UPQA 2EJ8A 4KVGB 2DKQA 2NMBA 1PLSA 3PEGA 4EJNA 5C5BA 2R2YA 2JP2A 1GG3A 1J19A 2W2WA 2Y8GA 1K5GB 5C5BB 3PG7A 2DHIA 2M14A 1V5MA 1UPRA 2YT0A 2CRFA 2DHKA 4BBKA 1X86A 2J0KA 5JHGA 2I5FA 1EAZA 5HE3A 2HTHB 3ULBA 1U5GA 2MFQA 4OSNA 1NI2A 3MDBC 3PZDA 5HE2A 1ZC3B 3DXDA 2YF0A 1U5FA 1RRPB 4KHBA 2KIGA 3LJUX 2GCLA 5JLJB 1MIZB 4KHBB 1EVHA 3FM8C 3KRXA 2Y8FA 4NSWA 1NU2A 2AEHA 1MIXA 4HAUB 2K2UA 1FOEA 2DYQA 2L1CA 5I2MA 3PVWA 2QKLA 4D6WA 2UVMA 4ZRKA 2OQBA 1E5WA 4IFSA 3GYOA 2GCJA 5LONB 4QJ5B 1AWEA 4K2PA 5GOWB 1K5DB 2D11A 1B55A 2PZ1A 1DDWA 3BJIA 3GYPA 3A8PA 1XCGA 3FEHA 3SO6A 3ML4A 2K2JA 4HDQA 1H10A 1SHCA 5DI9B 1BTNA 2KUPA 2HE7A 2ADZA 5CLLB 2I1KA 2YVCA 4YL8A 5LG4B 4Z2MB 2M38A 2QKMA 2RLOA 3SNHA 1M7RA 1PFJA 1WGQA 4EKUA 4KAXB 3KY9A 2CODA 4HDOA 1WJMA 5C79A 3DXEA 4MT7A 4IOYX 4EMOA 1V61A 5HE0A 2DX5A 2VKIA 1XODA 1P6SA 4HAVB 2DTCA 2YSZA 1ZSQA 3QIJA 4GN1A 2Z14A 2RVBB 1ZM0A 1PMSA 1FHWA 2V76A 2P0FA 1I7AA 4XWXA 1KI1B 5JHHA 3G9WA 1BWNA 3QWMA 5DHFB 1U2BA 1TQZA 4MK0A 1XR0B 2OTXA 4A6FB 5M4YB 3ODOA 4GZUA 1BAKA 3A8QA 4Z2NA 3TVVA 1XD4A 5HE1A 2D10A 3BINA 2YS1A 3VOQA 1XKEA 4CHJA 2EC1A 4KHOA 3ODXA 2ROZB 3KSYA 2H7DA 1Q67A 2NZ8B 3NWFA 5DH9B 2K00A 5EFXA 5D27A 3HK0A 4DXAB 2J0JA 1UNRA 1WG7A 4A6KA 2COCA 3HSAA 3F5RA 2D9YA 2D9VA 5FI1A 2KR0A 2ELAA 1TXDA 1OQNA 1W1GA 3AU5A 3OANA 2RNRB 2ZKMX 2KUQA 2N23A 3D8FA 2ZPYA 1FB8A 4HAZB 2E2XA 5CLQB 2DN6A 1UEFA 4HB3B 1I2HA 1ZVRA 3VIAA 2LKOA 4CHMA 1LB1A 1GC7A 1FHOA 1P3RA 4K17A 1QC6A 3TO1A 4QJ3B 2MWNB 3ODWA 1DDVA 4WJ7A 3U7DA 1X1FA 1U5EA 3SYXA 2Q13A 5LOPB 3U8ZA 2LULA 2Y7BA 1QQGA 2CY5A 2LOZA 4DBBA 2GS0A 3TCAA
chains in the Genus database with same CATH topology
5D3WA 4HAYB 1XX0A 2Z0PA 1Y5OA 1P5TA 1FGYA 5D3YA 5KQ4A 1TJ6A 1WJ1A 3DXCA 3CIKA 1DYNA 1V89A 3TW1A 4CYEA 3QBVB 2Z0QA 2X18A 2ROVA 4GPTB 1V88A 2COFA 5D3XA 1SGHA 1W1HA 4ZRJA 2H7EA 4F7UP 2XQNM 3WYFB 2MDXA 1Y19B 4HB2B 1KZ7A 3T06A 1DBHA 4C0AA 4F7HA 1KZGA 4IAPA 4P7IA 4D0NB 2DX1A 2YT1A 2ELBA 3RCPA 4WVFB 3V5WA 1WI1A 5C6RA 1X1GA 4K2OA 2DHJA 1V5UA 2COAA 4A6FA 2DA0A 4GXBA 2J0MA 3SV1A 2AL6A 2I5CA 5DIFB 3ZDTA 3O96A 5FI0A 5KCVA 5JP4A 1EF1A 2BCJA 2D4QA 1GC6A 2W2XC 4YONA 4KHAA 2EMSA 3A98B 2DKPA 1MK7B 2VSZA 5C16A 4DX90 1U27A 3PP2A 2RGNB 2D2QA 4H8SA 1OY2A 2N0YA 2R09A 2DLWA 4HATB 3ZVRA 3KRWA 3SUZA 2EMTA 3HQCA 5J3QA 1X05A 2UZSA 4HB0B 2LG1A 3WA0A 4L6EA 2FJLA 5KQ1A 4WSFA 1AQCA 1NTVA 1U29A 1J0WA 2LYDA 4HHVA 2YS5A 4Y94A 3P7ZA 3UZTA 4B6HA 3TFMA 3AU4A 3PSCA 3X23A 4HAXB 1UNPA 2DFKA 2KCJA 2IFSA 1RJ2A 4TYZA 1MKEA 2W2XD 4A5KA 3AJ4A 4ZRIA 1ZC4B 1MK9B 5D3VA 2VRWB 1U5DA 2P0HA 4K81A 4NY0A 1IRSA 1OMWA 3FSSA 3NSUA 1MPHA 3PVLA 2IYBA 2I1JA 1FAOA 1X11A 2RSGA 2YS3A 1FHXA 2Z0OA 3CXBB 2RUKB 2G35A 3MPXA 4F7GA 1ISNA 5L81A 2UZRA 1M7EA 2CY4A 1N3HA 1Z87A 1WVHA 2MKRA 1W1DA 3M1IB 2L2IA 3F0WA 2CAYA 5J3TA 4PNKA 4DX8A 3PVUA 3D8EA 2D9XA 1BTKA 1LW3A 2KGXB 2DYNA 2GJYA 1H4RA 4GMXB 1EGXA 1DROA 1NTYA 4MY6A 2R0DA 2YRYA 2J59M 2LOXA 1WGUA 2D9WA 3IVFA 1FGZA 4TKNA 4PQ0A 2D9ZA 3ULCA 3HW2B 5DHAB 3N7CA 1MAIA 1V5PA 1UNQA 3KZ1A 3P6AA 4GMVA 2P8VA 5J3YA 2P0DA 4HB4B 1DDMA 3D8DA 4HAWB 4A6HA 1UPQA 2EJ8A 4KVGB 2DKQA 2NMBA 1PLSA 3PEGA 4EJNA 5C5BA 2JP2A 1GG3A 1J19A 2W2WA 2Y8GA 1K5GB 5C5BB 3PG7A 2DHIA 2M14A 1V5MA 1UPRA 2YT0A 2CRFA 2DHKA 4BBKA 1X86A 2J0KA 5JHGA 2I5FA 1EAZA 5HE3A 2HTHB 3ULBA 1U5GA 2MFQA 1NI2A 3MDBC 3PZDA 5HE2A 1ZC3B 3DXDA 2YF0A 1U5FA 1RRPB 3LJUX 2GCLA 5JLJB 1MIZB 4KHBB 1EVHA 3FM8C 3KRXA 2Y8FA 4NSWA 1NU2A 2AEHA 1MIXA 4HAUB 2K2UA 1FOEA 2DYQA 2L1CA 3PVWA 2QKLA 2UVMA 4ZRKA 2OQBA 1E5WA 4IFSA 3GYOA 2GCJA 5LONB 1AWEA 4K2PA 5GOWB 1K5DB 2D11A 1B55A 2PZ1A 1DDWA 3BJIA 3GYPA 3A8PA 1XCGA 3FEHA 3SO6A 3ML4A 2K2JA 4HDQA 1H10A 1SHCA 5DI9B 1BTNA 2KUPA 2HE7A 2ADZA 5CLLB 2I1KA 2YVCA 4YL8A 4Z2MB 2M38A 2QKMA 2RLOA 3SNHA 1M7RA 1PFJA 1WGQA 4EKUA 4KAXB 3KY9A 2CODA 4HDOA 1WJMA 5C79A 3DXEA 4MT7A 4IOYX 4EMOA 1V61A 5HE0A 2DX5A 2VKIA 1XODA 1P6SA 4HAVB 2DTCA 2YSZA 1ZSQA 3QIJA 4GN1A 2RVBB 1ZM0A 1PMSA 1FHWA 2V76A 2P0FA 1I7AA 4XWXA 1KI1B 5JHHA 3G9WA 1BWNA 3QWMA 5DHFB 1U2BA 1TQZA 4MK0A 1XR0B 2OTXA 4A6FB 3ODOA 4GZUA 1BAKA 3A8QA 4Z2NA 3TVVA 1XD4A 5HE1A 2D10A 3BINA 2YS1A 3VOQA 1XKEA 4CHJA 2EC1A 4KHOA 3ODXA 2ROZB 3KSYA 2H7DA 1Q67A 2NZ8B 5DH9B 2K00A 5EFXA 5D27A 3HK0A 4DXAB 2J0JA 1UNRA 1WG7A 4A6KA 2COCA 3F5RA 2D9YA 2D9VA 5FI1A 2ELAA 1TXDA 1OQNA 1W1GA 3AU5A 3OANA 2RNRB 2N23A 3D8FA 2ZPYA 1FB8A 4HAZB 2E2XA 5CLQB 2DN6A 1UEFA 4HB3B 1I2HA 1ZVRA 3VIAA 2LKOA 4CHMA 1LB1A 1GC7A 1FHOA 1P3RA 4K17A 1QC6A 3TO1A 2MWNB 3ODWA 1DDVA 4WJ7A 3U7DA 1X1FA 1U5EA 3SYXA 2Q13A 5LOPB 3U8ZA 2LULA 2Y7BA 1QQGA 2CY5A 2LOZA 4DBBA 2GS0A 3TCAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5D3W A;  4HAY B;  1XX0 A;  2Z0P A;  1Y5O A;  1P5T A;  1FGY A;  5D3Y A;  5KQ4 A;  1TJ6 A;  1WJ1 A;  3DXC A;  3CIK A;  1DYN A;  1V89 A;  3TW1 A;  4CYE A;  3QBV B;  2Z0Q A;  2X18 A;  2ROV A;  4GPT B;  1V88 A;  2COF A;  5D3X A;  1SGH A;  1W1H A;  4ZRJ A;  2H7E A;  4F7U P;  2XQN M;  3WYF B;  2MDX A;  1Y19 B;  4HB2 B;  1KZ7 A;  3T06 A;  1DBH A;  4C0A A;  4F7H A;  1KZG A;  4IAP A;  4P7I A;  4D0N B;  2DX1 A;  2YT1 A;  2ELB A;  3RCP A;  4WVF B;  3V5W A;  1WI1 A;  5C6R A;  1X1G A;  4K2O A;  2DHJ A;  1V5U A;  2COA A;  4A6F A;  2DA0 A;  4GXB A;  2J0M A;  3SV1 A;  2AL6 A;  2I5C A;  5DIF B;  3ZDT A;  3O96 A;  5FI0 A;  5KCV A;  5JP4 A;  1EF1 A;  2BCJ A;  2D4Q A;  1GC6 A;  2W2X C;  4YON A;  4KHA A;  2EMS A;  3A98 B;  2DKP A;  1MK7 B;  2VSZ A;  5C16 A;  4DX9 0;  1U27 A;  3PP2 A;  2RGN B;  2D2Q A;  4H8S A;  1OY2 A;  2N0Y A;  2R09 A;  2DLW A;  4HAT B;  3ZVR A;  3KRW A;  3SUZ A;  2EMT A;  3HQC A;  5J3Q A;  1X05 A;  2UZS A;  4HB0 B;  2LG1 A;  3WA0 A;  4L6E A;  2FJL A;  5KQ1 A;  4WSF A;  1AQC A;  1NTV A;  1U29 A;  1J0W A;  2LYD A;  4HHV A;  2YS5 A;  4Y94 A;  3P7Z A;  3UZT A;  4B6H A;  3TFM A;  3AU4 A;  3PSC A;  3X23 A;  4HAX B;  1UNP A;  2DFK A;  2KCJ A;  2IFS A;  1RJ2 A;  4TYZ A;  1MKE A;  2W2X D;  4A5K A;  3AJ4 A;  4ZRI A;  1ZC4 B;  1MK9 B;  5D3V A;  2VRW B;  1U5D A;  2P0H A;  4K81 A;  4NY0 A;  1IRS A;  1OMW A;  3FSS A;  3NSU A;  1MPH A;  3PVL A;  2IYB A;  2I1J A;  1FAO A;  1X11 A;  2RSG A;  2YS3 A;  1FHX A;  2Z0O A;  3CXB B;  2RUK B;  2G35 A;  3MPX A;  4F7G A;  1ISN A;  5L81 A;  2UZR A;  1M7E A;  2CY4 A;  1N3H A;  1Z87 A;  1WVH A;  2MKR A;  1W1D A;  3M1I B;  2L2I A;  3F0W A;  2CAY A;  5J3T A;  4PNK A;  4DX8 A;  3PVU A;  3D8E A;  2D9X A;  1BTK A;  1LW3 A;  2KGX B;  2DYN A;  2GJY A;  1H4R A;  4GMX B;  1EGX A;  1DRO A;  1NTY A;  4MY6 A;  2R0D A;  2YRY A;  2J59 M;  2LOX A;  1WGU A;  2D9W A;  3IVF A;  1FGZ A;  4TKN A;  4PQ0 A;  2D9Z A;  3ULC A;  3HW2 B;  5DHA B;  3N7C A;  1MAI A;  1V5P A;  1UNQ A;  3KZ1 A;  3P6A A;  4GMV A;  2P8V A;  5J3Y A;  2P0D A;  4HB4 B;  1DDM A;  3D8D A;  4HAW B;  4A6H A;  1UPQ A;  2EJ8 A;  4KVG B;  2DKQ A;  2NMB A;  1PLS A;  3PEG A;  4EJN A;  5C5B A;  2JP2 A;  1GG3 A;  1J19 A;  2W2W A;  2Y8G A;  1K5G B;  5C5B B;  3PG7 A;  2DHI A;  2M14 A;  1V5M A;  1UPR A;  2YT0 A;  2CRF A;  2DHK A;  4BBK A;  1X86 A;  2J0K A;  5JHG A;  2I5F A;  1EAZ A;  5HE3 A;  2HTH B;  3ULB A;  1U5G A;  2MFQ A;  1NI2 A;  3MDB C;  3PZD A;  5HE2 A;  1ZC3 B;  3DXD A;  2YF0 A;  1U5F A;  1RRP B;  3LJU X;  2GCL A;  5JLJ B;  1MIZ B;  4KHB B;  1EVH A;  3FM8 C;  3KRX A;  2Y8F A;  4NSW A;  1NU2 A;  2AEH A;  1MIX A;  4HAU B;  2K2U A;  1FOE A;  2DYQ A;  2L1C A;  3PVW A;  2QKL A;  2UVM A;  4ZRK A;  2OQB A;  1E5W A;  4IFS A;  3GYO A;  2GCJ A;  5LON B;  1AWE A;  4K2P A;  5GOW B;  1K5D B;  2D11 A;  1B55 A;  2PZ1 A;  1DDW A;  3BJI A;  3GYP A;  3A8P A;  1XCG A;  3FEH A;  3SO6 A;  3ML4 A;  2K2J A;  4HDQ A;  1H10 A;  1SHC A;  5DI9 B;  1BTN A;  2KUP A;  2HE7 A;  2ADZ A;  5CLL B;  2I1K A;  2YVC A;  4YL8 A;  4Z2M B;  2M38 A;  2QKM A;  2RLO A;  3SNH A;  1M7R A;  1PFJ A;  1WGQ A;  4EKU A;  4KAX B;  3KY9 A;  2COD A;  4HDO A;  1WJM A;  5C79 A;  3DXE A;  4MT7 A;  4IOY X;  4EMO A;  1V61 A;  5HE0 A;  2DX5 A;  2VKI A;  1XOD A;  1P6S A;  4HAV B;  2DTC A;  2YSZ A;  1ZSQ A;  3QIJ A;  4GN1 A;  2RVB B;  1ZM0 A;  1PMS A;  1FHW A;  2V76 A;  2P0F A;  1I7A A;  4XWX A;  1KI1 B;  5JHH A;  3G9W A;  1BWN A;  3QWM A;  5DHF B;  1U2B A;  1TQZ A;  4MK0 A;  1XR0 B;  2OTX A;  4A6F B;  3ODO A;  4GZU A;  1BAK A;  3A8Q A;  4Z2N A;  3TVV A;  1XD4 A;  5HE1 A;  2D10 A;  3BIN A;  2YS1 A;  3VOQ A;  1XKE A;  4CHJ A;  2EC1 A;  4KHO A;  3ODX A;  2ROZ B;  3KSY A;  2H7D A;  1Q67 A;  2NZ8 B;  5DH9 B;  2K00 A;  5EFX A;  5D27 A;  3HK0 A;  4DXA B;  2J0J A;  1UNR A;  1WG7 A;  4A6K A;  2COC A;  3F5R A;  2D9Y A;  2D9V A;  5FI1 A;  2ELA A;  1TXD A;  1OQN A;  1W1G A;  3AU5 A;  3OAN A;  2RNR B;  2N23 A;  3D8F A;  2ZPY A;  1FB8 A;  4HAZ B;  2E2X A;  5CLQ B;  2DN6 A;  1UEF A;  4HB3 B;  1I2H A;  1ZVR A;  3VIA A;  2LKO A;  4CHM A;  1LB1 A;  1GC7 A;  1FHO A;  1P3R A;  4K17 A;  1QC6 A;  3TO1 A;  2MWN B;  3ODW A;  1DDV A;  4WJ7 A;  3U7D A;  1X1F A;  1U5E A;  3SYX A;  2Q13 A;  5LOP B;  3U8Z A;  2LUL A;  2Y7B A;  1QQG A;  2CY5 A;  2LOZ A;  4DBB A;  2GS0 A;  3TCA A; 
#chains in the Genus database with same CATH topology
 5D3W A;  4HAY B;  2FJU B;  1XX0 A;  2Z0P A;  1Y5O A;  1P5T A;  1FGY A;  5D3Y A;  5KQ4 A;  1TJ6 A;  1WJ1 A;  3DXC A;  3CIK A;  1DYN A;  1V89 A;  3TW1 A;  4CYE A;  3QBV B;  2Z0Q A;  2X18 A;  2ROV A;  4GPT B;  1V88 A;  2COF A;  5D3X A;  1SGH A;  2K8E A;  5IRS A;  2Z13 A;  1W1H A;  4ZRJ A;  2H7E A;  4CSQ A;  4F7U P;  2XQN M;  3WYF B;  2MDX A;  1Y19 B;  4HB2 B;  1KZ7 A;  3NWA A;  4HSI A;  3T06 A;  1DBH A;  4C0A A;  4F7H A;  1KZG A;  3NW8 A;  4IAP A;  2Z4D A;  4P7I A;  4D0N B;  2DX1 A;  2YT1 A;  2ELB A;  4DIX A;  3RCP A;  4L1R A;  4WVF B;  3V5W A;  1WI1 A;  5C6R A;  2Z59 A;  1X1G A;  4K2O A;  2DHJ A;  1V5U A;  2COA A;  4A6F A;  2DA0 A;  4GXB A;  2J0M A;  4QXA B;  3SV1 A;  1T77 A;  2AL6 A;  2I5C A;  5DIF B;  3ZDT A;  3O96 A;  1ZYI A;  5FI0 A;  5KCV A;  3U12 A;  4OT1 A;  3B77 A;  5JP4 A;  1EF1 A;  2RRF A;  2BCJ A;  2D4Q A;  1GC6 A;  2W2X C;  4YON A;  4KHA A;  2EMS A;  3A98 B;  2DKP A;  1MK7 B;  2GUM A;  2VSZ A;  5C16 A;  4DX9 0;  1U27 A;  3PP2 A;  2RGN B;  2D2Q A;  4H8S A;  1OY2 A;  2N0Y A;  2R09 A;  2DLW A;  4GNK B;  4HAT B;  3NWD A;  5I2S A;  3ZVR A;  4QJ4 B;  3KRW A;  3SUZ A;  2EMT A;  3HQC A;  5J3Q A;  1X05 A;  2UZS A;  4HB0 B;  2LG1 A;  3HIE A;  3WA0 A;  1MI1 A;  4L6E A;  2FJL A;  3OHM B;  5KQ1 A;  4WSF A;  1AQC A;  1NTV A;  1U29 A;  1J0W A;  2LYD A;  3FVC A;  4HHV A;  2YS5 A;  4Y94 A;  3P7Z A;  3UZT A;  3DCX A;  4B6H A;  3TFM A;  3AU4 A;  3PSC A;  3X23 A;  4HAX B;  1UNP A;  2DFK A;  2KCJ A;  2IFS A;  1RJ2 A;  4TYZ A;  1MKE A;  2W2X D;  2KIE A;  4A5K A;  3AJ4 A;  4ZRI A;  1ZC4 B;  1MK9 B;  5D3V A;  2VRW B;  1U5D A;  2P0H A;  4K81 A;  4NY0 A;  1IRS A;  1OMW A;  3FSS A;  3NSU A;  1MPH A;  3PVL A;  2IYB A;  2I1J A;  1FAO A;  1X11 A;  2RSG A;  2YS3 A;  1FHX A;  2Z0O A;  3CXB B;  2RUK B;  2NBV A;  2G35 A;  3MPX A;  4F7G A;  1ISN A;  5L81 A;  2UZR A;  1M7E A;  2CY4 A;  1N3H A;  1Z87 A;  1WVH A;  2MKR A;  1W1D A;  3M1I B;  2L2I A;  3F0W A;  2CAY A;  5J3T A;  4PNK A;  4DX8 A;  3PVU A;  3D8E A;  2D9X A;  1BTK A;  1LW3 A;  2KGX B;  3A58 A;  2DYN A;  2GJY A;  1H4R A;  4GMX B;  1EGX A;  1DRO A;  1NTY A;  4MY6 A;  2R0D A;  2YRY A;  2J59 M;  2LOX A;  1WGU A;  2D9W A;  2K49 A;  3IVF A;  1FGZ A;  4TKN A;  4PQ0 A;  2D9Z A;  4GOU A;  3ULC A;  3HW2 B;  5DHA B;  3N7C A;  1MAI A;  1V5P A;  2YT2 A;  1UNQ A;  3KZ1 A;  3P6A A;  4GMV A;  2P8V A;  5J3Y A;  2P0D A;  4HB4 B;  1DDM A;  3D8D A;  4HAW B;  4A6H A;  1UPQ A;  2EJ8 A;  4KVG B;  2DKQ A;  2NMB A;  1PLS A;  3PEG A;  4EJN A;  5C5B A;  2R2Y A;  2JP2 A;  1GG3 A;  1J19 A;  2W2W A;  2Y8G A;  1K5G B;  5C5B B;  3PG7 A;  2DHI A;  2M14 A;  1V5M A;  1UPR A;  2YT0 A;  2CRF A;  2DHK A;  4BBK A;  1X86 A;  2J0K A;  5JHG A;  2I5F A;  1EAZ A;  5HE3 A;  2HTH B;  3ULB A;  1U5G A;  2MFQ A;  4OSN A;  1NI2 A;  3MDB C;  3PZD A;  5HE2 A;  1ZC3 B;  3DXD A;  2YF0 A;  1U5F A;  1RRP B;  4KHB A;  2KIG A;  3LJU X;  2GCL A;  5JLJ B;  1MIZ B;  4KHB B;  1EVH A;  3FM8 C;  3KRX A;  2Y8F A;  4NSW A;  1NU2 A;  2AEH A;  1MIX A;  4HAU B;  2K2U A;  1FOE A;  2DYQ A;  2L1C A;  5I2M A;  3PVW A;  2QKL A;  4D6W A;  2UVM A;  4ZRK A;  2OQB A;  1E5W A;  4IFS A;  3GYO A;  2GCJ A;  5LON B;  4QJ5 B;  1AWE A;  4K2P A;  5GOW B;  1K5D B;  2D11 A;  1B55 A;  2PZ1 A;  1DDW A;  3BJI A;  3GYP A;  3A8P A;  1XCG A;  3FEH A;  3SO6 A;  3ML4 A;  2K2J A;  4HDQ A;  1H10 A;  1SHC A;  5DI9 B;  1BTN A;  2KUP A;  2HE7 A;  2ADZ A;  5CLL B;  2I1K A;  2YVC A;  4YL8 A;  5LG4 B;  4Z2M B;  2M38 A;  2QKM A;  2RLO A;  3SNH A;  1M7R A;  1PFJ A;  1WGQ A;  4EKU A;  4KAX B;  3KY9 A;  2COD A;  4HDO A;  1WJM A;  5C79 A;  3DXE A;  4MT7 A;  4IOY X;  4EMO A;  1V61 A;  5HE0 A;  2DX5 A;  2VKI A;  1XOD A;  1P6S A;  4HAV B;  2DTC A;  2YSZ A;  1ZSQ A;  3QIJ A;  4GN1 A;  2Z14 A;  2RVB B;  1ZM0 A;  1PMS A;  1FHW A;  2V76 A;  2P0F A;  1I7A A;  4XWX A;  1KI1 B;  5JHH A;  3G9W A;  1BWN A;  3QWM A;  5DHF B;  1U2B A;  1TQZ A;  4MK0 A;  1XR0 B;  2OTX A;  4A6F B;  5M4Y B;  3ODO A;  4GZU A;  1BAK A;  3A8Q A;  4Z2N A;  3TVV A;  1XD4 A;  5HE1 A;  2D10 A;  3BIN A;  2YS1 A;  3VOQ A;  1XKE A;  4CHJ A;  2EC1 A;  4KHO A;  3ODX A;  2ROZ B;  3KSY A;  2H7D A;  1Q67 A;  2NZ8 B;  3NWF A;  5DH9 B;  2K00 A;  5EFX A;  5D27 A;  3HK0 A;  4DXA B;  2J0J A;  1UNR A;  1WG7 A;  4A6K A;  2COC A;  3HSA A;  3F5R A;  2D9Y A;  2D9V A;  5FI1 A;  2KR0 A;  2ELA A;  1TXD A;  1OQN A;  1W1G A;  3AU5 A;  3OAN A;  2RNR B;  2ZKM X;  2KUQ A;  2N23 A;  3D8F A;  2ZPY A;  1FB8 A;  4HAZ B;  2E2X A;  5CLQ B;  2DN6 A;  1UEF A;  4HB3 B;  1I2H A;  1ZVR A;  3VIA A;  2LKO A;  4CHM A;  1LB1 A;  1GC7 A;  1FHO A;  1P3R A;  4K17 A;  1QC6 A;  3TO1 A;  4QJ3 B;  2MWN B;  3ODW A;  1DDV A;  4WJ7 A;  3U7D A;  1X1F A;  1U5E A;  3SYX A;  2Q13 A;  5LOP B;  3U8Z A;  2LUL A;  2Y7B A;  1QQG A;  2CY5 A;  2LOZ A;  4DBB A;  2GS0 A;  3TCA A; 
#chains in the Genus database with same CATH homology
 5D3W A;  4HAY B;  1XX0 A;  2Z0P A;  1Y5O A;  1P5T A;  1FGY A;  5D3Y A;  5KQ4 A;  1TJ6 A;  1WJ1 A;  3DXC A;  3CIK A;  1DYN A;  1V89 A;  3TW1 A;  4CYE A;  3QBV B;  2Z0Q A;  2X18 A;  2ROV A;  4GPT B;  1V88 A;  2COF A;  5D3X A;  1SGH A;  1W1H A;  4ZRJ A;  2H7E A;  4F7U P;  2XQN M;  3WYF B;  2MDX A;  1Y19 B;  4HB2 B;  1KZ7 A;  3T06 A;  1DBH A;  4C0A A;  4F7H A;  1KZG A;  4IAP A;  4P7I A;  4D0N B;  2DX1 A;  2YT1 A;  2ELB A;  3RCP A;  4WVF B;  3V5W A;  1WI1 A;  5C6R A;  1X1G A;  4K2O A;  2DHJ A;  1V5U A;  2COA A;  4A6F A;  2DA0 A;  4GXB A;  2J0M A;  3SV1 A;  2AL6 A;  2I5C A;  5DIF B;  3ZDT A;  3O96 A;  5FI0 A;  5KCV A;  5JP4 A;  1EF1 A;  2BCJ A;  2D4Q A;  1GC6 A;  2W2X C;  4YON A;  4KHA A;  2EMS A;  3A98 B;  2DKP A;  1MK7 B;  2VSZ A;  5C16 A;  4DX9 0;  1U27 A;  3PP2 A;  2RGN B;  2D2Q A;  4H8S A;  1OY2 A;  2N0Y A;  2R09 A;  2DLW A;  4HAT B;  3ZVR A;  3KRW A;  3SUZ A;  2EMT A;  3HQC A;  5J3Q A;  1X05 A;  2UZS A;  4HB0 B;  2LG1 A;  3WA0 A;  4L6E A;  2FJL A;  5KQ1 A;  4WSF A;  1AQC A;  1NTV A;  1U29 A;  1J0W A;  2LYD A;  4HHV A;  2YS5 A;  4Y94 A;  3P7Z A;  3UZT A;  4B6H A;  3TFM A;  3AU4 A;  3PSC A;  3X23 A;  4HAX B;  1UNP A;  2DFK A;  2KCJ A;  2IFS A;  1RJ2 A;  4TYZ A;  1MKE A;  2W2X D;  4A5K A;  3AJ4 A;  4ZRI A;  1ZC4 B;  1MK9 B;  5D3V A;  2VRW B;  1U5D A;  2P0H A;  4K81 A;  4NY0 A;  1IRS A;  1OMW A;  3FSS A;  3NSU A;  1MPH A;  3PVL A;  2IYB A;  2I1J A;  1FAO A;  1X11 A;  2RSG A;  2YS3 A;  1FHX A;  2Z0O A;  3CXB B;  2RUK B;  2G35 A;  3MPX A;  4F7G A;  1ISN A;  5L81 A;  2UZR A;  1M7E A;  2CY4 A;  1N3H A;  1Z87 A;  1WVH A;  2MKR A;  1W1D A;  3M1I B;  2L2I A;  3F0W A;  2CAY A;  5J3T A;  4PNK A;  4DX8 A;  3PVU A;  3D8E A;  2D9X A;  1BTK A;  1LW3 A;  2KGX B;  2DYN A;  2GJY A;  1H4R A;  4GMX B;  1EGX A;  1DRO A;  1NTY A;  4MY6 A;  2R0D A;  2YRY A;  2J59 M;  2LOX A;  1WGU A;  2D9W A;  3IVF A;  1FGZ A;  4TKN A;  4PQ0 A;  2D9Z A;  3ULC A;  3HW2 B;  5DHA B;  3N7C A;  1MAI A;  1V5P A;  1UNQ A;  3KZ1 A;  3P6A A;  4GMV A;  2P8V A;  5J3Y A;  2P0D A;  4HB4 B;  1DDM A;  3D8D A;  4HAW B;  4A6H A;  1UPQ A;  2EJ8 A;  4KVG B;  2DKQ A;  2NMB A;  1PLS A;  3PEG A;  4EJN A;  5C5B A;  2JP2 A;  1GG3 A;  1J19 A;  2W2W A;  2Y8G A;  1K5G B;  5C5B B;  3PG7 A;  2DHI A;  2M14 A;  1V5M A;  1UPR A;  2YT0 A;  2CRF A;  2DHK A;  4BBK A;  1X86 A;  2J0K A;  5JHG A;  2I5F A;  1EAZ A;  5HE3 A;  2HTH B;  3ULB A;  1U5G A;  2MFQ A;  1NI2 A;  3MDB C;  3PZD A;  5HE2 A;  1ZC3 B;  3DXD A;  2YF0 A;  1U5F A;  1RRP B;  3LJU X;  2GCL A;  5JLJ B;  1MIZ B;  4KHB B;  1EVH A;  3FM8 C;  3KRX A;  2Y8F A;  4NSW A;  1NU2 A;  2AEH A;  1MIX A;  4HAU B;  2K2U A;  1FOE A;  2DYQ A;  2L1C A;  3PVW A;  2QKL A;  2UVM A;  4ZRK A;  2OQB A;  1E5W A;  4IFS A;  3GYO A;  2GCJ A;  5LON B;  1AWE A;  4K2P A;  5GOW B;  1K5D B;  2D11 A;  1B55 A;  2PZ1 A;  1DDW A;  3BJI A;  3GYP A;  3A8P A;  1XCG A;  3FEH A;  3SO6 A;  3ML4 A;  2K2J A;  4HDQ A;  1H10 A;  1SHC A;  5DI9 B;  1BTN A;  2KUP A;  2HE7 A;  2ADZ A;  5CLL B;  2I1K A;  2YVC A;  4YL8 A;  4Z2M B;  2M38 A;  2QKM A;  2RLO A;  3SNH A;  1M7R A;  1PFJ A;  1WGQ A;  4EKU A;  4KAX B;  3KY9 A;  2COD A;  4HDO A;  1WJM A;  5C79 A;  3DXE A;  4MT7 A;  4IOY X;  4EMO A;  1V61 A;  5HE0 A;  2DX5 A;  2VKI A;  1XOD A;  1P6S A;  4HAV B;  2DTC A;  2YSZ A;  1ZSQ A;  3QIJ A;  4GN1 A;  2RVB B;  1ZM0 A;  1PMS A;  1FHW A;  2V76 A;  2P0F A;  1I7A A;  4XWX A;  1KI1 B;  5JHH A;  3G9W A;  1BWN A;  3QWM A;  5DHF B;  1U2B A;  1TQZ A;  4MK0 A;  1XR0 B;  2OTX A;  4A6F B;  3ODO A;  4GZU A;  1BAK A;  3A8Q A;  4Z2N A;  3TVV A;  1XD4 A;  5HE1 A;  2D10 A;  3BIN A;  2YS1 A;  3VOQ A;  1XKE A;  4CHJ A;  2EC1 A;  4KHO A;  3ODX A;  2ROZ B;  3KSY A;  2H7D A;  1Q67 A;  2NZ8 B;  5DH9 B;  2K00 A;  5EFX A;  5D27 A;  3HK0 A;  4DXA B;  2J0J A;  1UNR A;  1WG7 A;  4A6K A;  2COC A;  3F5R A;  2D9Y A;  2D9V A;  5FI1 A;  2ELA A;  1TXD A;  1OQN A;  1W1G A;  3AU5 A;  3OAN A;  2RNR B;  2N23 A;  3D8F A;  2ZPY A;  1FB8 A;  4HAZ B;  2E2X A;  5CLQ B;  2DN6 A;  1UEF A;  4HB3 B;  1I2H A;  1ZVR A;  3VIA A;  2LKO A;  4CHM A;  1LB1 A;  1GC7 A;  1FHO A;  1P3R A;  4K17 A;  1QC6 A;  3TO1 A;  2MWN B;  3ODW A;  1DDV A;  4WJ7 A;  3U7D A;  1X1F A;  1U5E A;  3SYX A;  2Q13 A;  5LOP B;  3U8Z A;  2LUL A;  2Y7B A;  1QQG A;  2CY5 A;  2LOZ A;  4DBB A;  2GS0 A;  3TCA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...