1WI1A

Solution structure of the ph domain of human calcium-dependent activator protein for secretion (caps)
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
126
structure length
126
Chain Sequence
b'GSSGSSGMKHSGYLWAIGKNVWKRWKKRFFVLVQVSQYTFAMCSYREKKAEPQELLQLDGYTVDYTDPQPGLEGGRAFFNAVKEGDTVIFASDDEQDRILWVQAMYRATGQSHKPVPPTQSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords calcium-dependent activator protein for secretion, CAPS
publication title Solution structure of the PH domain of human calcium-dependent activator protein for secretion (CAPS)
rcsb
source organism Homo sapiens
molecule tags Endocytosis/exocytosis
total genus 14
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2004-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1wi1A01
3PP2A 3PG7A 1KZ7A 4KHAA 4K17A 1DYNA 1XD4A 3X23A 3CXBB 3QWMA 4ZRIA 2J0KA 1U5FA 3KRXA 4HAWB 4Y94A 3P6AA 4P7IA 2MDXA 2RGNB 2YVCA 2YS3A 1WJ1A 4HATB 3ULCA 1W1GA 1V5PA 2ZPYA 1NTVA 2YS5A 4HHVA 3SV1A 2L1CA 2LYDA 2D10A 3PVUA 3FM8C 3SYXA 3V5WA 2M14A 2QKLA 1U5EA 3QBVB 2Y8GA 1Y5OA 3F0WA 2D11A 2FJLA 2IFSA 2GJYA 3A8QA 3TFMA 3LJUX 3ODXA 2E2XA 1UNRA 5J3TA 4HDQA 5HE1A 1RJ2A 3ODOA 1X05A 2L2IA 1UPQA 1Z87A 3MDBC 1TQZA 2R09A 1LW3A 4HAXB 4BBKA 1W1DA 2RUKB 2YT1A 1U2BA 1V61A 3DXCA 1MIZB 5DH9B 4KAXB 1SGHA 3TO1A 4K2PA 2LOZA 1AQCA 1PFJA 1EGXA 4XWXA 4KHOA 1LB1A 1X86A 2G35A 1MK9B 1TJ6A 4HAVB 2GS0A 4GMVA 3QIJA 1KI1B 3F5RA 5J3QA 5C16A 1DROA 1EVHA 2DLWA 2D9WA 1NI2A 3RCPA 1GC7A 2QKMA 4CHJA 3BJIA 2HE7A 1K5DB 4IOYX 3DXEA 2DN6A 2D9ZA 1M7EA 3GYPA 1U5DA 3GYOA 1V5MA 4CYEA 1XR0B 2ELBA 2LG1A 1Q67A 3N7CA 3M1IB 4GPTB 2NZ8B 3AU4A 4DX8A 1UNPA 1NU2A 4F7HA 1WG7A 3P7ZA 4HB2B 2AL6A 1H10A 1X11A 4D0NB 5LOPB 3FEHA 2N0YA 3FSSA 5HE3A 2CRFA 4HAZB 1DBHA 4HDOA 2Z0OA 5C5BB 4DXAB 3UZTA 1MPHA 5DHAB 2UZSA 5DHFB 2XQNM 1U27A 3HK0A 3PZDA 2N23A 2RNRB 1FHWA 2P8VA 1XX0A 3BINA 2HTHB 4HB0B 1Y19B 2LKOA 1DDVA 2IYBA 1QQGA 4HB4B 4EMOA 3CIKA 3ZVRA 2LULA 1V89A 3PEGA 2GCJA 2PZ1A 1ISNA 2VSZA 2I5CA 3SUZA 4IFSA 2H7DA 5D3XA 4CHMA 4PNKA 3SNHA 1BTNA 2DX5A 5FI0A 1PMSA 2KCJA 4HAUB 2CODA 3AU5A 4WSFA 2DA0A 2VKIA 3A8PA 3OANA 2I5FA 1ZC3B 4K2OA 3KSYA 3HQCA 4YONA 1E5WA 5C5BA 2Y8FA 2YF0A 5D27A 1P3RA 1J0WA 1QC6A 2KGXB 4IAPA 2EMSA 3PVWA 4NSWA 2J0MA 3TCAA 4MY6A 1PLSA 1KZGA 3O96A 4YL8A 2OQBA 1MKEA 4HAYB 4PQ0A 5JHHA 1ZSQA 4HB3B 1DDWA 2ROVA 3PSCA 1WVHA 4ZRJA 2YRYA 1FGYA 2COAA 4L6EA 2X18A 5JP4A 2P0FA 1FHOA 1UEFA 2JP2A 3VIAA 3AJ4A 4A6HA 1EF1A 2GCLA 2K2JA 4K81A 4TYZA 4C0AA 1XCGA 1V88A 1MK7B 5L81A 5HE0A 5KQ1A 1ZVRA 3KZ1A 1WI1A 3KRWA 5HE2A 2BCJA 2H7EA 3G9WA 3ULBA 5FI1A 2EC1A 3TW1A 2MKRA 4A5KA 5DIFB 2RVBB 5C79A 2YS1A 1RRPB 4F7UP 4B6HA 2J59M 5KCVA 2D4QA 2DFKA 1FHXA 2M38A 5D3VA 2ELAA 2Q13A 2I1JA 1X1GA 4Z2MB 4GN1A 2DTCA 5D3WA 4A6KA 1XODA 2P0HA 4WVFB 1X1FA 1W1HA 1DDMA 5LONB 1WGQA 2EJ8A 1XKEA 2R0DA 2DYNA 4ZRKA 4A6FB 3D8DA 2MFQA 4KHBB 2D9XA 2D9VA 3HW2B 2DKQA 2VRWB 5GOWB 3U7DA 5JLJB 1ZM0A 1I2HA 2AEHA 2I1KA 1GG3A 1OY2A 3PVLA 1U5GA 2K00A 1K5GB 4NY0A 2YT0A 2P0DA 2DYQA 2ADZA 2ROZB 4DX90 2LOXA 3D8EA 1ZC4B 1MIXA 3NSUA 2K2UA 1EAZA 5DI9B 2J0JA 2YSZA 4GXBA 1SHCA 2UVMA 1BWNA 2DHIA 2W2WA 3DXDA 2Z0QA 2W2XD 2DHKA 2EMTA 3MPXA 2UZRA 4WJ7A 2DHJA 2D2QA 1BTKA 4A6FA 3U8ZA 1NTYA 2KUPA 3A98B 4MK0A 4Z2NA 2D9YA 4DBBA 4EKUA 1FGZA 5JHGA 4F7GA 1H4RA 1AWEA 1N3HA 1V5UA 2CY4A 3ZDTA 5J3YA 1M7RA 3VOQA 1IRSA 2V76A 2RSGA 2Z0PA 3WA0A 1FOEA 4TKNA 3ODWA 1WJMA 2RLOA 2DX1A 3KY9A 2CY5A 4KVGB 1UPRA 1FAOA 2COCA 3WYFB 1UNQA 1I7AA 2W2XC 1OMWA 1B55A 4MT7A 5KQ4A 1OQNA 3IVFA 1P6SA 3SO6A 3D8FA 1J19A 1GC6A 1WGUA 2NMBA 2OTXA 2Y7BA 1BAKA 1TXDA 2COFA 1U29A 4GZUA 1P5TA 3TVVA 5EFXA 2MWNB 5CLLB 1FB8A 3T06A 5CLQB 4EJNA 4GMXB 2DKPA 4H8SA 5D3YA 1MAIA 5C6RA 2CAYA 3ML4A
chains in the Genus database with same CATH superfamily
4DIXA 3PP2A 4QXAB 3PG7A 1KZ7A 4KHAA 4K17A 1DYNA 1XD4A 3X23A 3CXBB 3QWMA 4ZRIA 2J0KA 1U5FA 3KRXA 4HAWB 4Y94A 3P6AA 4P7IA 2MDXA 2RGNB 2YVCA 2YS3A 1WJ1A 4HATB 3NWDA 3ULCA 1W1GA 1V5PA 2ZPYA 1NTVA 2YS5A 4HHVA 3SV1A 2L1CA 2LYDA 2D10A 3PVUA 3FM8C 3SYXA 3V5WA 2M14A 4D6WA 2QKLA 1U5EA 1MI1A 3QBVB 2Y8GA 1Y5OA 3F0WA 2D11A 2YT2A 2FJLA 2IFSA 2GJYA 3A8QA 3TFMA 3LJUX 3ODXA 2E2XA 1UNRA 5J3TA 4HDQA 5HE1A 1RJ2A 3ODOA 1X05A 2L2IA 1UPQA 1Z87A 3A58A 3MDBC 1TQZA 2R09A 1LW3A 4HAXB 4BBKA 1W1DA 2RUKB 5I2SA 4CSQA 2YT1A 2FJUB 1U2BA 1V61A 3DXCA 5IRSA 1MIZB 5DH9B 4KAXB 1SGHA 3TO1A 4K2PA 2KIEA 2LOZA 1AQCA 1PFJA 2KUQA 1EGXA 4XWXA 4KHOA 1LB1A 1X86A 2G35A 1MK9B 1TJ6A 4HAVB 2GS0A 4GMVA 2KIGA 3QIJA 1KI1B 3F5RA 4HSIA 5J3QA 5C16A 1DROA 1EVHA 2DLWA 2D9WA 1NI2A 3RCPA 1GC7A 2ZKMX 2QKMA 4CHJA 5I2MA 3BJIA 2HE7A 1K5DB 4IOYX 3DXEA 2DN6A 2D9ZA 1M7EA 3GYPA 1U5DA 3GYOA 1V5MA 4CYEA 1XR0B 2ELBA 2LG1A 1Q67A 3N7CA 3M1IB 2R2YA 4GPTB 2NZ8B 3AU4A 4DX8A 1UNPA 1NU2A 4F7HA 1WG7A 2K49A 3P7ZA 4HB2B 2AL6A 1H10A 1X11A 4D0NB 5LOPB 3FEHA 4GNKB 2N0YA 3FSSA 5HE3A 2CRFA 4HAZB 1DBHA 4HDOA 2Z0OA 5C5BB 4DXAB 3UZTA 1MPHA 5DHAB 2UZSA 3U12A 5DHFB 2XQNM 1U27A 3HK0A 3PZDA 2N23A 2RRFA 2RNRB 1FHWA 2P8VA 1XX0A 3BINA 2HTHB 4HB0B 1Y19B 2LKOA 1DDVA 2IYBA 1QQGA 4HB4B 4OSNA 4EMOA 3CIKA 3ZVRA 2LULA 1V89A 3PEGA 2GCJA 2PZ1A 1ISNA 2VSZA 2I5CA 3SUZA 4IFSA 2H7DA 5D3XA 3OHMB 4CHMA 4PNKA 3SNHA 1BTNA 2DX5A 5FI0A 1PMSA 2KCJA 4HAUB 4QJ5B 2CODA 3AU5A 4WSFA 2DA0A 2VKIA 3A8PA 3OANA 2I5FA 1ZC3B 4K2OA 3KSYA 3HQCA 2Z14A 5M4YB 4YONA 1E5WA 5C5BA 2Y8FA 2YF0A 3FVCA 5D27A 1P3RA 1J0WA 1QC6A 2KGXB 4IAPA 4GOUA 2EMSA 3PVWA 4NSWA 2J0MA 3TCAA 4MY6A 2Z4DA 1PLSA 1KZGA 3O96A 4YL8A 2OQBA 1MKEA 4HAYB 4PQ0A 5JHHA 2Z59A 1ZSQA 4HB3B 4L1RA 1DDWA 2ROVA 3PSCA 1WVHA 4ZRJA 2YRYA 1FGYA 2COAA 4OT1A 4L6EA 2X18A 5JP4A 2P0FA 1FHOA 1UEFA 2JP2A 3VIAA 3AJ4A 4A6HA 1EF1A 2GCLA 2K2JA 4K81A 4TYZA 4C0AA 1XCGA 1V88A 1MK7B 5L81A 5HE0A 5KQ1A 1ZVRA 3HSAA 3KZ1A 1WI1A 3KRWA 5HE2A 2BCJA 2H7EA 3G9WA 3ULBA 3NWFA 5FI1A 2EC1A 3TW1A 2MKRA 4A5KA 5DIFB 2RVBB 5C79A 2YS1A 1RRPB 4F7UP 4B6HA 2J59M 5KCVA 2K8EA 2D4QA 2DFKA 1FHXA 2M38A 5D3VA 2ELAA 2Q13A 2I1JA 1X1GA 4Z2MB 4GN1A 2DTCA 5D3WA 4A6KA 1XODA 2P0HA 3NWAA 4WVFB 1X1FA 2Z13A 1W1HA 1DDMA 5LONB 1WGQA 2EJ8A 1XKEA 2R0DA 2DYNA 4ZRKA 4A6FB 3D8DA 2MFQA 4KHBB 2D9XA 2D9VA 2KR0A 2DKQA 3HW2B 2VRWB 5GOWB 3U7DA 5JLJB 1ZM0A 1I2HA 2AEHA 2I1KA 1GG3A 1OY2A 4QJ3B 3PVLA 1U5GA 2K00A 1K5GB 4NY0A 2YT0A 2P0DA 2GUMA 2DYQA 2ADZA 2ROZB 4DX90 2LOXA 3D8EA 1ZC4B 1MIXA 3NSUA 2K2UA 1EAZA 5DI9B 2J0JA 2YSZA 4GXBA 1SHCA 2UVMA 1BWNA 3DCXA 2DHIA 2W2WA 3DXDA 2Z0QA 2W2XD 1T77A 2DHKA 2EMTA 3MPXA 2UZRA 4WJ7A 2DHJA 2D2QA 1BTKA 4A6FA 3U8ZA 1NTYA 2KUPA 4KHBA 3A98B 4MK0A 4Z2NA 2D9YA 4DBBA 4EKUA 1FGZA 5JHGA 4F7GA 1H4RA 1AWEA 1N3HA 1V5UA 2CY4A 1ZYIA 3ZDTA 5J3YA 1M7RA 4QJ4B 3VOQA 1IRSA 2V76A 2RSGA 2Z0PA 3WA0A 1FOEA 4TKNA 3ODWA 1WJMA 2RLOA 2DX1A 3KY9A 2CY5A 4KVGB 1UPRA 1FAOA 5LG4B 2COCA 3WYFB 1UNQA 2NBVA 1I7AA 2W2XC 1OMWA 1B55A 4MT7A 5KQ4A 1OQNA 3IVFA 1P6SA 3SO6A 3D8FA 1J19A 1GC6A 1WGUA 2NMBA 2OTXA 2Y7BA 1BAKA 1TXDA 2COFA 1U29A 4GZUA 1P5TA 3B77A 3TVVA 5EFXA 2MWNB 3NW8A 1FB8A 3T06A 5CLLB 5CLQB 4EJNA 4GMXB 2DKPA 4H8SA 3HIEA 5D3YA 1MAIA 5C6RA 2CAYA 3ML4A
chains in the Genus database with same CATH topology
3PP2A 3PG7A 1KZ7A 4KHAA 4K17A 1DYNA 1XD4A 3X23A 3CXBB 3QWMA 4ZRIA 2J0KA 1U5FA 3KRXA 4HAWB 4Y94A 3P6AA 4P7IA 2MDXA 2RGNB 2YVCA 2YS3A 1WJ1A 4HATB 3ULCA 1W1GA 1V5PA 2ZPYA 1NTVA 2YS5A 4HHVA 3SV1A 2L1CA 2LYDA 2D10A 3PVUA 3FM8C 3SYXA 3V5WA 2M14A 2QKLA 1U5EA 3QBVB 2Y8GA 1Y5OA 3F0WA 2D11A 2FJLA 2IFSA 2GJYA 3A8QA 3TFMA 3LJUX 3ODXA 2E2XA 1UNRA 5J3TA 4HDQA 5HE1A 1RJ2A 3ODOA 1X05A 2L2IA 1UPQA 1Z87A 3MDBC 1TQZA 2R09A 1LW3A 4HAXB 4BBKA 1W1DA 2RUKB 2YT1A 1U2BA 1V61A 3DXCA 1MIZB 5DH9B 4KAXB 1SGHA 3TO1A 4K2PA 2LOZA 1AQCA 1PFJA 1EGXA 4XWXA 4KHOA 1LB1A 1X86A 2G35A 1MK9B 1TJ6A 4HAVB 2GS0A 4GMVA 3QIJA 1KI1B 3F5RA 5J3QA 5C16A 1DROA 1EVHA 2DLWA 2D9WA 1NI2A 3RCPA 1GC7A 2QKMA 4CHJA 3BJIA 2HE7A 1K5DB 4IOYX 3DXEA 2DN6A 2D9ZA 1M7EA 3GYPA 1U5DA 3GYOA 1V5MA 4CYEA 1XR0B 2ELBA 2LG1A 1Q67A 3N7CA 3M1IB 4GPTB 2NZ8B 3AU4A 4DX8A 1UNPA 1NU2A 4F7HA 1WG7A 3P7ZA 4HB2B 2AL6A 1H10A 1X11A 4D0NB 5LOPB 3FEHA 2N0YA 3FSSA 5HE3A 2CRFA 4HAZB 1DBHA 4HDOA 2Z0OA 5C5BB 4DXAB 3UZTA 1MPHA 5DHAB 2UZSA 5DHFB 2XQNM 1U27A 3HK0A 3PZDA 2N23A 2RNRB 1FHWA 2P8VA 1XX0A 3BINA 2HTHB 4HB0B 1Y19B 2LKOA 1DDVA 2IYBA 1QQGA 4HB4B 4EMOA 3CIKA 3ZVRA 2LULA 1V89A 3PEGA 2GCJA 2PZ1A 1ISNA 2VSZA 2I5CA 3SUZA 4IFSA 2H7DA 5D3XA 4CHMA 4PNKA 3SNHA 1BTNA 2DX5A 5FI0A 1PMSA 2KCJA 4HAUB 2CODA 3AU5A 4WSFA 2DA0A 2VKIA 3A8PA 3OANA 2I5FA 1ZC3B 4K2OA 3KSYA 3HQCA 4YONA 1E5WA 5C5BA 2Y8FA 2YF0A 5D27A 1P3RA 1J0WA 1QC6A 2KGXB 4IAPA 2EMSA 3PVWA 4NSWA 2J0MA 3TCAA 4MY6A 1PLSA 1KZGA 3O96A 4YL8A 2OQBA 1MKEA 4HAYB 4PQ0A 5JHHA 1ZSQA 4HB3B 1DDWA 2ROVA 3PSCA 1WVHA 4ZRJA 2YRYA 1FGYA 2COAA 4L6EA 2X18A 5JP4A 2P0FA 1FHOA 1UEFA 2JP2A 3VIAA 3AJ4A 4A6HA 1EF1A 2GCLA 2K2JA 4K81A 4TYZA 4C0AA 1XCGA 1V88A 1MK7B 5L81A 5HE0A 5KQ1A 1ZVRA 3KZ1A 1WI1A 3KRWA 5HE2A 2BCJA 2H7EA 3G9WA 3ULBA 5FI1A 2EC1A 3TW1A 2MKRA 4A5KA 5DIFB 2RVBB 5C79A 2YS1A 1RRPB 4F7UP 4B6HA 2J59M 5KCVA 2D4QA 2DFKA 1FHXA 2M38A 5D3VA 2ELAA 2Q13A 2I1JA 1X1GA 4Z2MB 4GN1A 2DTCA 5D3WA 4A6KA 1XODA 2P0HA 4WVFB 1X1FA 1W1HA 1DDMA 5LONB 1WGQA 2EJ8A 1XKEA 2R0DA 2DYNA 4ZRKA 4A6FB 3D8DA 2MFQA 4KHBB 2D9XA 2D9VA 3HW2B 2DKQA 2VRWB 5GOWB 3U7DA 5JLJB 1ZM0A 1I2HA 2AEHA 2I1KA 1GG3A 1OY2A 3PVLA 1U5GA 2K00A 1K5GB 4NY0A 2YT0A 2P0DA 2DYQA 2ADZA 2ROZB 4DX90 2LOXA 3D8EA 1ZC4B 1MIXA 3NSUA 2K2UA 1EAZA 5DI9B 2J0JA 2YSZA 4GXBA 1SHCA 2UVMA 1BWNA 2DHIA 2W2WA 3DXDA 2Z0QA 2W2XD 2DHKA 2EMTA 3MPXA 2UZRA 4WJ7A 2DHJA 2D2QA 1BTKA 4A6FA 3U8ZA 1NTYA 2KUPA 3A98B 4MK0A 4Z2NA 2D9YA 4DBBA 4EKUA 1FGZA 5JHGA 4F7GA 1H4RA 1AWEA 1N3HA 1V5UA 2CY4A 3ZDTA 5J3YA 1M7RA 3VOQA 1IRSA 2V76A 2RSGA 2Z0PA 3WA0A 1FOEA 4TKNA 3ODWA 1WJMA 2RLOA 2DX1A 3KY9A 2CY5A 4KVGB 1UPRA 1FAOA 2COCA 3WYFB 1UNQA 1I7AA 2W2XC 1OMWA 1B55A 4MT7A 5KQ4A 1OQNA 3IVFA 1P6SA 3SO6A 3D8FA 1J19A 1GC6A 1WGUA 2NMBA 2OTXA 2Y7BA 1BAKA 1TXDA 2COFA 1U29A 4GZUA 1P5TA 3TVVA 5EFXA 2MWNB 5CLLB 1FB8A 3T06A 5CLQB 4EJNA 4GMXB 2DKPA 4H8SA 5D3YA 1MAIA 5C6RA 2CAYA 3ML4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PP2 A;  3PG7 A;  1KZ7 A;  4KHA A;  4K17 A;  1DYN A;  1XD4 A;  3X23 A;  3CXB B;  3QWM A;  4ZRI A;  2J0K A;  1U5F A;  3KRX A;  4HAW B;  4Y94 A;  3P6A A;  4P7I A;  2MDX A;  2RGN B;  2YVC A;  2YS3 A;  1WJ1 A;  4HAT B;  3ULC A;  1W1G A;  1V5P A;  2ZPY A;  1NTV A;  2YS5 A;  4HHV A;  3SV1 A;  2L1C A;  2LYD A;  2D10 A;  3PVU A;  3FM8 C;  3SYX A;  3V5W A;  2M14 A;  2QKL A;  1U5E A;  3QBV B;  2Y8G A;  1Y5O A;  3F0W A;  2D11 A;  2FJL A;  2IFS A;  2GJY A;  3A8Q A;  3TFM A;  3LJU X;  3ODX A;  2E2X A;  1UNR A;  5J3T A;  4HDQ A;  5HE1 A;  1RJ2 A;  3ODO A;  1X05 A;  2L2I A;  1UPQ A;  1Z87 A;  3MDB C;  1TQZ A;  2R09 A;  1LW3 A;  4HAX B;  4BBK A;  1W1D A;  2RUK B;  2YT1 A;  1U2B A;  1V61 A;  3DXC A;  1MIZ B;  5DH9 B;  4KAX B;  1SGH A;  3TO1 A;  4K2P A;  2LOZ A;  1AQC A;  1PFJ A;  1EGX A;  4XWX A;  4KHO A;  1LB1 A;  1X86 A;  2G35 A;  1MK9 B;  1TJ6 A;  4HAV B;  2GS0 A;  4GMV A;  3QIJ A;  1KI1 B;  3F5R A;  5J3Q A;  5C16 A;  1DRO A;  1EVH A;  2DLW A;  2D9W A;  1NI2 A;  3RCP A;  1GC7 A;  2QKM A;  4CHJ A;  3BJI A;  2HE7 A;  1K5D B;  4IOY X;  3DXE A;  2DN6 A;  2D9Z A;  1M7E A;  3GYP A;  1U5D A;  3GYO A;  1V5M A;  4CYE A;  1XR0 B;  2ELB A;  2LG1 A;  1Q67 A;  3N7C A;  3M1I B;  4GPT B;  2NZ8 B;  3AU4 A;  4DX8 A;  1UNP A;  1NU2 A;  4F7H A;  1WG7 A;  3P7Z A;  4HB2 B;  2AL6 A;  1H10 A;  1X11 A;  4D0N B;  5LOP B;  3FEH A;  2N0Y A;  3FSS A;  5HE3 A;  2CRF A;  4HAZ B;  1DBH A;  4HDO A;  2Z0O A;  5C5B B;  4DXA B;  3UZT A;  1MPH A;  5DHA B;  2UZS A;  5DHF B;  2XQN M;  1U27 A;  3HK0 A;  3PZD A;  2N23 A;  2RNR B;  1FHW A;  2P8V A;  1XX0 A;  3BIN A;  2HTH B;  4HB0 B;  1Y19 B;  2LKO A;  1DDV A;  2IYB A;  1QQG A;  4HB4 B;  4EMO A;  3CIK A;  3ZVR A;  2LUL A;  1V89 A;  3PEG A;  2GCJ A;  2PZ1 A;  1ISN A;  2VSZ A;  2I5C A;  3SUZ A;  4IFS A;  2H7D A;  5D3X A;  4CHM A;  4PNK A;  3SNH A;  1BTN A;  2DX5 A;  5FI0 A;  1PMS A;  2KCJ A;  4HAU B;  2COD A;  3AU5 A;  4WSF A;  2DA0 A;  2VKI A;  3A8P A;  3OAN A;  2I5F A;  1ZC3 B;  4K2O A;  3KSY A;  3HQC A;  4YON A;  1E5W A;  5C5B A;  2Y8F A;  2YF0 A;  5D27 A;  1P3R A;  1J0W A;  1QC6 A;  2KGX B;  4IAP A;  2EMS A;  3PVW A;  4NSW A;  2J0M A;  3TCA A;  4MY6 A;  1PLS A;  1KZG A;  3O96 A;  4YL8 A;  2OQB A;  1MKE A;  4HAY B;  4PQ0 A;  5JHH A;  1ZSQ A;  4HB3 B;  1DDW A;  2ROV A;  3PSC A;  1WVH A;  4ZRJ A;  2YRY A;  1FGY A;  2COA A;  4L6E A;  2X18 A;  5JP4 A;  2P0F A;  1FHO A;  1UEF A;  2JP2 A;  3VIA A;  3AJ4 A;  4A6H A;  1EF1 A;  2GCL A;  2K2J A;  4K81 A;  4TYZ A;  4C0A A;  1XCG A;  1V88 A;  1MK7 B;  5L81 A;  5HE0 A;  5KQ1 A;  1ZVR A;  3KZ1 A;  1WI1 A;  3KRW A;  5HE2 A;  2BCJ A;  2H7E A;  3G9W A;  3ULB A;  5FI1 A;  2EC1 A;  3TW1 A;  2MKR A;  4A5K A;  5DIF B;  2RVB B;  5C79 A;  2YS1 A;  1RRP B;  4F7U P;  4B6H A;  2J59 M;  5KCV A;  2D4Q A;  2DFK A;  1FHX A;  2M38 A;  5D3V A;  2ELA A;  2Q13 A;  2I1J A;  1X1G A;  4Z2M B;  4GN1 A;  2DTC A;  5D3W A;  4A6K A;  1XOD A;  2P0H A;  4WVF B;  1X1F A;  1W1H A;  1DDM A;  5LON B;  1WGQ A;  2EJ8 A;  1XKE A;  2R0D A;  2DYN A;  4ZRK A;  4A6F B;  3D8D A;  2MFQ A;  4KHB B;  2D9X A;  2D9V A;  3HW2 B;  2DKQ A;  2VRW B;  5GOW B;  3U7D A;  5JLJ B;  1ZM0 A;  1I2H A;  2AEH A;  2I1K A;  1GG3 A;  1OY2 A;  3PVL A;  1U5G A;  2K00 A;  1K5G B;  4NY0 A;  2YT0 A;  2P0D A;  2DYQ A;  2ADZ A;  2ROZ B;  4DX9 0;  2LOX A;  3D8E A;  1ZC4 B;  1MIX A;  3NSU A;  2K2U A;  1EAZ A;  5DI9 B;  2J0J A;  2YSZ A;  4GXB A;  1SHC A;  2UVM A;  1BWN A;  2DHI A;  2W2W A;  3DXD A;  2Z0Q A;  2W2X D;  2DHK A;  2EMT A;  3MPX A;  2UZR A;  4WJ7 A;  2DHJ A;  2D2Q A;  1BTK A;  4A6F A;  3U8Z A;  1NTY A;  2KUP A;  3A98 B;  4MK0 A;  4Z2N A;  2D9Y A;  4DBB A;  4EKU A;  1FGZ A;  5JHG A;  4F7G A;  1H4R A;  1AWE A;  1N3H A;  1V5U A;  2CY4 A;  3ZDT A;  5J3Y A;  1M7R A;  3VOQ A;  1IRS A;  2V76 A;  2RSG A;  2Z0P A;  3WA0 A;  1FOE A;  4TKN A;  3ODW A;  1WJM A;  2RLO A;  2DX1 A;  3KY9 A;  2CY5 A;  4KVG B;  1UPR A;  1FAO A;  2COC A;  3WYF B;  1UNQ A;  1I7A A;  2W2X C;  1OMW A;  1B55 A;  4MT7 A;  5KQ4 A;  1OQN A;  3IVF A;  1P6S A;  3SO6 A;  3D8F A;  1J19 A;  1GC6 A;  1WGU A;  2NMB A;  2OTX A;  2Y7B A;  1BAK A;  1TXD A;  2COF A;  1U29 A;  4GZU A;  1P5T A;  3TVV A;  5EFX A;  2MWN B;  5CLL B;  1FB8 A;  3T06 A;  5CLQ B;  4EJN A;  4GMX B;  2DKP A;  4H8S A;  5D3Y A;  1MAI A;  5C6R A;  2CAY A;  3ML4 A; 
#chains in the Genus database with same CATH topology
 4DIX A;  3PP2 A;  4QXA B;  3PG7 A;  1KZ7 A;  4KHA A;  4K17 A;  1DYN A;  1XD4 A;  3X23 A;  3CXB B;  3QWM A;  4ZRI A;  2J0K A;  1U5F A;  3KRX A;  4HAW B;  4Y94 A;  3P6A A;  4P7I A;  2MDX A;  2RGN B;  2YVC A;  2YS3 A;  1WJ1 A;  4HAT B;  3NWD A;  3ULC A;  1W1G A;  1V5P A;  2ZPY A;  1NTV A;  2YS5 A;  4HHV A;  3SV1 A;  2L1C A;  2LYD A;  2D10 A;  3PVU A;  3FM8 C;  3SYX A;  3V5W A;  2M14 A;  4D6W A;  2QKL A;  1U5E A;  1MI1 A;  3QBV B;  2Y8G A;  1Y5O A;  3F0W A;  2D11 A;  2YT2 A;  2FJL A;  2IFS A;  2GJY A;  3A8Q A;  3TFM A;  3LJU X;  3ODX A;  2E2X A;  1UNR A;  5J3T A;  4HDQ A;  5HE1 A;  1RJ2 A;  3ODO A;  1X05 A;  2L2I A;  1UPQ A;  1Z87 A;  3A58 A;  3MDB C;  1TQZ A;  2R09 A;  1LW3 A;  4HAX B;  4BBK A;  1W1D A;  2RUK B;  5I2S A;  4CSQ A;  2YT1 A;  2FJU B;  1U2B A;  1V61 A;  3DXC A;  5IRS A;  1MIZ B;  5DH9 B;  4KAX B;  1SGH A;  3TO1 A;  4K2P A;  2KIE A;  2LOZ A;  1AQC A;  1PFJ A;  2KUQ A;  1EGX A;  4XWX A;  4KHO A;  1LB1 A;  1X86 A;  2G35 A;  1MK9 B;  1TJ6 A;  4HAV B;  2GS0 A;  4GMV A;  2KIG A;  3QIJ A;  1KI1 B;  3F5R A;  4HSI A;  5J3Q A;  5C16 A;  1DRO A;  1EVH A;  2DLW A;  2D9W A;  1NI2 A;  3RCP A;  1GC7 A;  2ZKM X;  2QKM A;  4CHJ A;  5I2M A;  3BJI A;  2HE7 A;  1K5D B;  4IOY X;  3DXE A;  2DN6 A;  2D9Z A;  1M7E A;  3GYP A;  1U5D A;  3GYO A;  1V5M A;  4CYE A;  1XR0 B;  2ELB A;  2LG1 A;  1Q67 A;  3N7C A;  3M1I B;  2R2Y A;  4GPT B;  2NZ8 B;  3AU4 A;  4DX8 A;  1UNP A;  1NU2 A;  4F7H A;  1WG7 A;  2K49 A;  3P7Z A;  4HB2 B;  2AL6 A;  1H10 A;  1X11 A;  4D0N B;  5LOP B;  3FEH A;  4GNK B;  2N0Y A;  3FSS A;  5HE3 A;  2CRF A;  4HAZ B;  1DBH A;  4HDO A;  2Z0O A;  5C5B B;  4DXA B;  3UZT A;  1MPH A;  5DHA B;  2UZS A;  3U12 A;  5DHF B;  2XQN M;  1U27 A;  3HK0 A;  3PZD A;  2N23 A;  2RRF A;  2RNR B;  1FHW A;  2P8V A;  1XX0 A;  3BIN A;  2HTH B;  4HB0 B;  1Y19 B;  2LKO A;  1DDV A;  2IYB A;  1QQG A;  4HB4 B;  4OSN A;  4EMO A;  3CIK A;  3ZVR A;  2LUL A;  1V89 A;  3PEG A;  2GCJ A;  2PZ1 A;  1ISN A;  2VSZ A;  2I5C A;  3SUZ A;  4IFS A;  2H7D A;  5D3X A;  3OHM B;  4CHM A;  4PNK A;  3SNH A;  1BTN A;  2DX5 A;  5FI0 A;  1PMS A;  2KCJ A;  4HAU B;  4QJ5 B;  2COD A;  3AU5 A;  4WSF A;  2DA0 A;  2VKI A;  3A8P A;  3OAN A;  2I5F A;  1ZC3 B;  4K2O A;  3KSY A;  3HQC A;  2Z14 A;  5M4Y B;  4YON A;  1E5W A;  5C5B A;  2Y8F A;  2YF0 A;  3FVC A;  5D27 A;  1P3R A;  1J0W A;  1QC6 A;  2KGX B;  4IAP A;  4GOU A;  2EMS A;  3PVW A;  4NSW A;  2J0M A;  3TCA A;  4MY6 A;  2Z4D A;  1PLS A;  1KZG A;  3O96 A;  4YL8 A;  2OQB A;  1MKE A;  4HAY B;  4PQ0 A;  5JHH A;  2Z59 A;  1ZSQ A;  4HB3 B;  4L1R A;  1DDW A;  2ROV A;  3PSC A;  1WVH A;  4ZRJ A;  2YRY A;  1FGY A;  2COA A;  4OT1 A;  4L6E A;  2X18 A;  5JP4 A;  2P0F A;  1FHO A;  1UEF A;  2JP2 A;  3VIA A;  3AJ4 A;  4A6H A;  1EF1 A;  2GCL A;  2K2J A;  4K81 A;  4TYZ A;  4C0A A;  1XCG A;  1V88 A;  1MK7 B;  5L81 A;  5HE0 A;  5KQ1 A;  1ZVR A;  3HSA A;  3KZ1 A;  1WI1 A;  3KRW A;  5HE2 A;  2BCJ A;  2H7E A;  3G9W A;  3ULB A;  3NWF A;  5FI1 A;  2EC1 A;  3TW1 A;  2MKR A;  4A5K A;  5DIF B;  2RVB B;  5C79 A;  2YS1 A;  1RRP B;  4F7U P;  4B6H A;  2J59 M;  5KCV A;  2K8E A;  2D4Q A;  2DFK A;  1FHX A;  2M38 A;  5D3V A;  2ELA A;  2Q13 A;  2I1J A;  1X1G A;  4Z2M B;  4GN1 A;  2DTC A;  5D3W A;  4A6K A;  1XOD A;  2P0H A;  3NWA A;  4WVF B;  1X1F A;  2Z13 A;  1W1H A;  1DDM A;  5LON B;  1WGQ A;  2EJ8 A;  1XKE A;  2R0D A;  2DYN A;  4ZRK A;  4A6F B;  3D8D A;  2MFQ A;  4KHB B;  2D9X A;  2D9V A;  2KR0 A;  2DKQ A;  3HW2 B;  2VRW B;  5GOW B;  3U7D A;  5JLJ B;  1ZM0 A;  1I2H A;  2AEH A;  2I1K A;  1GG3 A;  1OY2 A;  4QJ3 B;  3PVL A;  1U5G A;  2K00 A;  1K5G B;  4NY0 A;  2YT0 A;  2P0D A;  2GUM A;  2DYQ A;  2ADZ A;  2ROZ B;  4DX9 0;  2LOX A;  3D8E A;  1ZC4 B;  1MIX A;  3NSU A;  2K2U A;  1EAZ A;  5DI9 B;  2J0J A;  2YSZ A;  4GXB A;  1SHC A;  2UVM A;  1BWN A;  3DCX A;  2DHI A;  2W2W A;  3DXD A;  2Z0Q A;  2W2X D;  1T77 A;  2DHK A;  2EMT A;  3MPX A;  2UZR A;  4WJ7 A;  2DHJ A;  2D2Q A;  1BTK A;  4A6F A;  3U8Z A;  1NTY A;  2KUP A;  4KHB A;  3A98 B;  4MK0 A;  4Z2N A;  2D9Y A;  4DBB A;  4EKU A;  1FGZ A;  5JHG A;  4F7G A;  1H4R A;  1AWE A;  1N3H A;  1V5U A;  2CY4 A;  1ZYI A;  3ZDT A;  5J3Y A;  1M7R A;  4QJ4 B;  3VOQ A;  1IRS A;  2V76 A;  2RSG A;  2Z0P A;  3WA0 A;  1FOE A;  4TKN A;  3ODW A;  1WJM A;  2RLO A;  2DX1 A;  3KY9 A;  2CY5 A;  4KVG B;  1UPR A;  1FAO A;  5LG4 B;  2COC A;  3WYF B;  1UNQ A;  2NBV A;  1I7A A;  2W2X C;  1OMW A;  1B55 A;  4MT7 A;  5KQ4 A;  1OQN A;  3IVF A;  1P6S A;  3SO6 A;  3D8F A;  1J19 A;  1GC6 A;  1WGU A;  2NMB A;  2OTX A;  2Y7B A;  1BAK A;  1TXD A;  2COF A;  1U29 A;  4GZU A;  1P5T A;  3B77 A;  3TVV A;  5EFX A;  2MWN B;  3NW8 A;  1FB8 A;  3T06 A;  5CLL B;  5CLQ B;  4EJN A;  4GMX B;  2DKP A;  4H8S A;  3HIE A;  5D3Y A;  1MAI A;  5C6R A;  2CAY A;  3ML4 A; 
#chains in the Genus database with same CATH homology
 3PP2 A;  3PG7 A;  1KZ7 A;  4KHA A;  4K17 A;  1DYN A;  1XD4 A;  3X23 A;  3CXB B;  3QWM A;  4ZRI A;  2J0K A;  1U5F A;  3KRX A;  4HAW B;  4Y94 A;  3P6A A;  4P7I A;  2MDX A;  2RGN B;  2YVC A;  2YS3 A;  1WJ1 A;  4HAT B;  3ULC A;  1W1G A;  1V5P A;  2ZPY A;  1NTV A;  2YS5 A;  4HHV A;  3SV1 A;  2L1C A;  2LYD A;  2D10 A;  3PVU A;  3FM8 C;  3SYX A;  3V5W A;  2M14 A;  2QKL A;  1U5E A;  3QBV B;  2Y8G A;  1Y5O A;  3F0W A;  2D11 A;  2FJL A;  2IFS A;  2GJY A;  3A8Q A;  3TFM A;  3LJU X;  3ODX A;  2E2X A;  1UNR A;  5J3T A;  4HDQ A;  5HE1 A;  1RJ2 A;  3ODO A;  1X05 A;  2L2I A;  1UPQ A;  1Z87 A;  3MDB C;  1TQZ A;  2R09 A;  1LW3 A;  4HAX B;  4BBK A;  1W1D A;  2RUK B;  2YT1 A;  1U2B A;  1V61 A;  3DXC A;  1MIZ B;  5DH9 B;  4KAX B;  1SGH A;  3TO1 A;  4K2P A;  2LOZ A;  1AQC A;  1PFJ A;  1EGX A;  4XWX A;  4KHO A;  1LB1 A;  1X86 A;  2G35 A;  1MK9 B;  1TJ6 A;  4HAV B;  2GS0 A;  4GMV A;  3QIJ A;  1KI1 B;  3F5R A;  5J3Q A;  5C16 A;  1DRO A;  1EVH A;  2DLW A;  2D9W A;  1NI2 A;  3RCP A;  1GC7 A;  2QKM A;  4CHJ A;  3BJI A;  2HE7 A;  1K5D B;  4IOY X;  3DXE A;  2DN6 A;  2D9Z A;  1M7E A;  3GYP A;  1U5D A;  3GYO A;  1V5M A;  4CYE A;  1XR0 B;  2ELB A;  2LG1 A;  1Q67 A;  3N7C A;  3M1I B;  4GPT B;  2NZ8 B;  3AU4 A;  4DX8 A;  1UNP A;  1NU2 A;  4F7H A;  1WG7 A;  3P7Z A;  4HB2 B;  2AL6 A;  1H10 A;  1X11 A;  4D0N B;  5LOP B;  3FEH A;  2N0Y A;  3FSS A;  5HE3 A;  2CRF A;  4HAZ B;  1DBH A;  4HDO A;  2Z0O A;  5C5B B;  4DXA B;  3UZT A;  1MPH A;  5DHA B;  2UZS A;  5DHF B;  2XQN M;  1U27 A;  3HK0 A;  3PZD A;  2N23 A;  2RNR B;  1FHW A;  2P8V A;  1XX0 A;  3BIN A;  2HTH B;  4HB0 B;  1Y19 B;  2LKO A;  1DDV A;  2IYB A;  1QQG A;  4HB4 B;  4EMO A;  3CIK A;  3ZVR A;  2LUL A;  1V89 A;  3PEG A;  2GCJ A;  2PZ1 A;  1ISN A;  2VSZ A;  2I5C A;  3SUZ A;  4IFS A;  2H7D A;  5D3X A;  4CHM A;  4PNK A;  3SNH A;  1BTN A;  2DX5 A;  5FI0 A;  1PMS A;  2KCJ A;  4HAU B;  2COD A;  3AU5 A;  4WSF A;  2DA0 A;  2VKI A;  3A8P A;  3OAN A;  2I5F A;  1ZC3 B;  4K2O A;  3KSY A;  3HQC A;  4YON A;  1E5W A;  5C5B A;  2Y8F A;  2YF0 A;  5D27 A;  1P3R A;  1J0W A;  1QC6 A;  2KGX B;  4IAP A;  2EMS A;  3PVW A;  4NSW A;  2J0M A;  3TCA A;  4MY6 A;  1PLS A;  1KZG A;  3O96 A;  4YL8 A;  2OQB A;  1MKE A;  4HAY B;  4PQ0 A;  5JHH A;  1ZSQ A;  4HB3 B;  1DDW A;  2ROV A;  3PSC A;  1WVH A;  4ZRJ A;  2YRY A;  1FGY A;  2COA A;  4L6E A;  2X18 A;  5JP4 A;  2P0F A;  1FHO A;  1UEF A;  2JP2 A;  3VIA A;  3AJ4 A;  4A6H A;  1EF1 A;  2GCL A;  2K2J A;  4K81 A;  4TYZ A;  4C0A A;  1XCG A;  1V88 A;  1MK7 B;  5L81 A;  5HE0 A;  5KQ1 A;  1ZVR A;  3KZ1 A;  1WI1 A;  3KRW A;  5HE2 A;  2BCJ A;  2H7E A;  3G9W A;  3ULB A;  5FI1 A;  2EC1 A;  3TW1 A;  2MKR A;  4A5K A;  5DIF B;  2RVB B;  5C79 A;  2YS1 A;  1RRP B;  4F7U P;  4B6H A;  2J59 M;  5KCV A;  2D4Q A;  2DFK A;  1FHX A;  2M38 A;  5D3V A;  2ELA A;  2Q13 A;  2I1J A;  1X1G A;  4Z2M B;  4GN1 A;  2DTC A;  5D3W A;  4A6K A;  1XOD A;  2P0H A;  4WVF B;  1X1F A;  1W1H A;  1DDM A;  5LON B;  1WGQ A;  2EJ8 A;  1XKE A;  2R0D A;  2DYN A;  4ZRK A;  4A6F B;  3D8D A;  2MFQ A;  4KHB B;  2D9X A;  2D9V A;  3HW2 B;  2DKQ A;  2VRW B;  5GOW B;  3U7D A;  5JLJ B;  1ZM0 A;  1I2H A;  2AEH A;  2I1K A;  1GG3 A;  1OY2 A;  3PVL A;  1U5G A;  2K00 A;  1K5G B;  4NY0 A;  2YT0 A;  2P0D A;  2DYQ A;  2ADZ A;  2ROZ B;  4DX9 0;  2LOX A;  3D8E A;  1ZC4 B;  1MIX A;  3NSU A;  2K2U A;  1EAZ A;  5DI9 B;  2J0J A;  2YSZ A;  4GXB A;  1SHC A;  2UVM A;  1BWN A;  2DHI A;  2W2W A;  3DXD A;  2Z0Q A;  2W2X D;  2DHK A;  2EMT A;  3MPX A;  2UZR A;  4WJ7 A;  2DHJ A;  2D2Q A;  1BTK A;  4A6F A;  3U8Z A;  1NTY A;  2KUP A;  3A98 B;  4MK0 A;  4Z2N A;  2D9Y A;  4DBB A;  4EKU A;  1FGZ A;  5JHG A;  4F7G A;  1H4R A;  1AWE A;  1N3H A;  1V5U A;  2CY4 A;  3ZDT A;  5J3Y A;  1M7R A;  3VOQ A;  1IRS A;  2V76 A;  2RSG A;  2Z0P A;  3WA0 A;  1FOE A;  4TKN A;  3ODW A;  1WJM A;  2RLO A;  2DX1 A;  3KY9 A;  2CY5 A;  4KVG B;  1UPR A;  1FAO A;  2COC A;  3WYF B;  1UNQ A;  1I7A A;  2W2X C;  1OMW A;  1B55 A;  4MT7 A;  5KQ4 A;  1OQN A;  3IVF A;  1P6S A;  3SO6 A;  3D8F A;  1J19 A;  1GC6 A;  1WGU A;  2NMB A;  2OTX A;  2Y7B A;  1BAK A;  1TXD A;  2COF A;  1U29 A;  4GZU A;  1P5T A;  3TVV A;  5EFX A;  2MWN B;  5CLL B;  1FB8 A;  3T06 A;  5CLQ B;  4EJN A;  4GMX B;  2DKP A;  4H8S A;  5D3Y A;  1MAI A;  5C6R A;  2CAY A;  3ML4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...