1WI1A

Solution structure of the ph domain of human calcium-dependent activator protein for secretion (caps)
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
126
structure length
126
Chain Sequence
GSSGSSGMKHSGYLWAIGKNVWKRWKKRFFVLVQVSQYTFAMCSYREKKAEPQELLQLDGYTVDYTDPQPGLEGGRAFFNAVKEGDTVIFASDDEQDRILWVQAMYRATGQSHKPVPPTQSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Endocytosis/exocytosis
molecule keywords calcium-dependent activator protein for secretion, CAPS
publication title Solution structure of the PH domain of human calcium-dependent activator protein for secretion (CAPS)
rcsb
source organism Homo sapiens
total genus 14
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2004-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1wi1A01
4TKNA 5C5BB 1KZGA 1XX0A 3DXCA 2HE7A 3PVWA 4KAXB 4HDQA 2L1CA 5D3YA 4F7GA 4KHBB 3ULBA 3LJUX 2D2QA 2W2WA 5HE0A 4HDOA 2GCJA 1UEFA 2COAA 1LW3A 2YT1A 4WJ7A 3SNHA 4K2OA 1DROA 2UZRA 4Z2MB 1Q67A 1U5DA 2LOXA 2ZPYA 5DHAB 1V88A 2N23A 2UVMA 2J59M 1B55A 3U8ZA 4EMOA 4HAXB 4MT7A 1RRPB 2NZ8B 1U27A 4WSFA 1DBHA 3D8DA 4DBBA 1ZSQA 3A8PA 5DHFB 3WYFB 1XR0B 1X05A 5D3WA 1MPHA 1J0WA 1NTYA 2YS3A 3F5RA 4L6EA 1GG3A 3P6AA 1DDVA 1P6SA 4PNKA 3SO6A 1U5FA 4EJNA 1BTKA 2Z0QA 3GYOA 3HW2B 5CLLB 5KQ4A 4HAZB 5LONB 5KQ1A 1W1GA 3KRWA 2RVBB 5FI1A 2J0MA 3P7ZA 4GZUA 5HE1A 1LB1A 2X18A 5JHGA 3BJIA 1E5WA 2Z0OA 2J0JA 2VKIA 1DYNA 2Y8FA 1I2HA 3ODOA 4IFSA 1BTNA 2K2UA 2UZSA 4BBKA 1MKEA 1OQNA 1MK9B 1WVHA 2ROZB 3D8EA 1U29A 2E2XA 1FOEA 5J3QA 3QIJA 2FJLA 3FEHA 1BWNA 3PSCA 2Q13A 3WA0A 2QKLA 1XD4A 2R09A 1WGUA 4F7HA 1M7RA 4C0AA 2YSZA 2DHJA 1GC7A 3UZTA 2MDXA 2P0HA 5DIFB 1U5GA 3KRXA 1KI1B 1RJ2A 3A98B 1V5PA 5JLJB 1V5UA 2DX5A 4A5KA 2M14A 1UNQA 1UNPA 5FI0A 4F7UP 1U2BA 5C79A 4A6KA 2I1JA 2CY4A 4ZRKA 4KVGB 1XODA 2YVCA 2RNRB 2DKPA 2YS1A 4HB2B 4KHOA 3D8FA 4MY6A 2Z0PA 3PG7A 5DH9B 1BAKA 2YRYA 1V5MA 3VOQA 5JHHA 3RCPA 2GJYA 1NU2A 1MIZB 5L81A 1ISNA 3ODXA 2GCLA 2LG1A 4GPTB 3X23A 5LOPB 1P5TA 1UPQA 2DHKA 2XQNM 2YS5A 2K00A 4B6HA 1EGXA 2W2XD 3GYPA 3PP2A 3SV1A 4HAWB 3MPXA 5J3YA 3CXBB 4HAYB 2ELBA 2RUKB 3TVVA 1I7AA 2D9VA 1QQGA 4NY0A 2MFQA 2LULA 2I5FA 3IVFA 3U7DA 1OY2A 3SYXA 1WJ1A 2KCJA 4GMXB 3PEGA 2Y8GA 2BCJA 4K17A 1Z87A 2D10A 5D3VA 4DXAB 2IYBA 3A8QA 4K81A 3KY9A 1SHCA 1H4RA 1FAOA 3QWMA 4HATB 1XCGA 3F0WA 1UPRA 5EFXA 4GN1A 2JP2A 4ZRIA 1U5EA 2EJ8A 1J19A 2K2JA 3M1IB 1M7EA 3KZ1A 2P8VA 2IFSA 4HB0B 3VIAA 2HTHB 2KUPA 2MWNB 2CRFA 3TFMA 2ADZA 3SUZA 1EVHA 2DLWA 4DX90 1ZVRA 4GMVA 2DX1A 1X11A 4A6HA 2VSZA 1K5GB 1ZC4B 3TCAA 2OTXA 3FSSA 4DX8A 3V5WA 4KHAA 2MKRA 1FHXA 4IOYX 4K2PA 3ZDTA 4HAVB 2DFKA 2EMTA 1PMSA 1WGQA 5GOWB 2I1KA 2D9ZA 2DHIA 2P0FA 4IAPA 5CLQB 4H8SA 1WJMA 5C6RA 4TYZA 3AU5A 3AU4A 1EAZA 2G35A 2D9WA 5D27A 5C16A 1UNRA 2RGNB 2I5CA 2V76A 2DA0A 1ZM0A 1PLSA 3ULCA 4WVFB 1TXDA 5KCVA 3DXDA 3AJ4A 4CHJA 1MK7B 2NMBA 1X1GA 2LYDA 3PZDA 3PVLA 4PQ0A 1FB8A 1OMWA 2R0DA 2LKOA 3KSYA 2LOZA 3ODWA 1FHOA 1DDWA 2COCA 2D9XA 2ROVA 2CODA 4ZRJA 4MK0A 1MIXA 1FGYA 3ZVRA 1PFJA 3CIKA 4XWXA 1GC6A 4HAUB 4EKUA 4Z2NA 1IRSA 1NI2A 3O96A 2AEHA 1DDMA 1H10A 2DKQA 4A6FA 1NTVA 2H7DA 2D9YA 4HB4B 5HE3A 1TJ6A 4D0NB 2CY5A 1FHWA 1WI1A 2EC1A 3G9WA 2L2IA 1V89A 1P3RA 3HQCA 1Y5OA 1X86A 3TW1A 3PVUA 1AQCA 5DI9B 3ML4A 3NSUA 2J0KA 4HB3B 2Y7BA 1EF1A 1KZ7A 1W1HA 2N0YA 1QC6A 1AWEA 4P7IA 4GXBA 2ELAA 2W2XC 1ZC3B 2QKMA 2DTCA 4YONA 1MAIA 5C5BA 2AL6A 5HE2A 2RLOA 2RSGA 1Y19B 2YT0A 4CYEA 4A6FB 1WG7A 1X1FA 2DN6A 4YL8A 3T06A 2COFA 2H7EA 3OANA 2P0DA 2DYQA 2OQBA 1W1DA 4Y94A 3TO1A 2GS0A 1SGHA 2EMSA 4CHMA 2VRWB 1N3HA 4NSWA 3N7CA 2D4QA 3FM8C 2KGXB 3BINA 1XKEA 2DYNA 3DXEA 2PZ1A 3HK0A 5D3XA 4HHVA 1TQZA 5JP4A 2YF0A 5J3TA 3MDBC 1K5DB 1FGZA 1V61A 2D11A 2M38A 3QBVB 2CAYA
chains in the Genus database with same CATH superfamily
2KUQA 4TKNA 5C5BB 1KZGA 1XX0A 3DXCA 2HE7A 3PVWA 4KAXB 4HDQA 2L1CA 5D3YA 4F7GA 4KHBB 3ULBA 3LJUX 2D2QA 2W2WA 5HE0A 4HDOA 2GCJA 1UEFA 2COAA 1LW3A 2YT1A 4WJ7A 3SNHA 4K2OA 1DROA 2UZRA 3U12A 4Z2MB 1Q67A 1U5DA 2LOXA 2ZPYA 5DHAB 3B77A 1V88A 2N23A 1ZYIA 2UVMA 2J59M 1B55A 3U8ZA 4EMOA 4HAXB 4MT7A 1RRPB 2NZ8B 1U27A 4WSFA 1DBHA 3D8DA 4DBBA 1ZSQA 3A8PA 5DHFB 3WYFB 1XR0B 1X05A 5D3WA 1MPHA 1J0WA 1NTYA 2Z14A 2YS3A 3F5RA 4L6EA 1GG3A 3P6AA 1DDVA 1P6SA 1MI1A 4PNKA 3SO6A 1U5FA 4EJNA 1BTKA 2Z0QA 4OSNA 3GYOA 3HW2B 5CLLB 2Z13A 5KQ4A 4HAZB 5LONB 5KQ1A 1W1GA 3KRWA 2RVBB 5FI1A 2J0MA 3P7ZA 4GZUA 5HE1A 1LB1A 3NWAA 2X18A 5JHGA 4HSIA 3BJIA 3NWFA 1E5WA 2Z0OA 3OHMB 2J0JA 2VKIA 1DYNA 2Y8FA 1I2HA 3ODOA 4IFSA 1BTNA 2K2UA 2UZSA 4BBKA 1MKEA 1OQNA 1MK9B 1WVHA 2ROZB 3D8EA 2Z4DA 1U29A 2E2XA 1FOEA 5J3QA 3QIJA 2FJLA 3FEHA 2ZKMX 1BWNA 3PSCA 2Q13A 3WA0A 2FJUB 2QKLA 1XD4A 2R09A 1WGUA 4F7HA 1M7RA 4C0AA 2YSZA 2DHJA 1GC7A 3UZTA 2MDXA 2P0HA 5DIFB 1U5GA 3KRXA 1KI1B 4D6WA 1RJ2A 5IRSA 3A98B 1V5PA 5JLJB 1V5UA 2DX5A 4A5KA 2M14A 1UNQA 1UNPA 5FI0A 4F7UP 4QXAB 1U2BA 3NWDA 5C79A 4GNKB 4A6KA 2I1JA 2CY4A 4ZRKA 4KVGB 1XODA 2YVCA 2RNRB 2DKPA 2YS1A 4HB2B 4KHOA 3D8FA 4MY6A 2Z0PA 3PG7A 5DH9B 1BAKA 2YRYA 1V5MA 3VOQA 5JHHA 3RCPA 2GJYA 1NU2A 1MIZB 5L81A 1ISNA 3ODXA 2KIEA 2GCLA 2LG1A 4GPTB 3X23A 5LOPB 1P5TA 1UPQA 2DHKA 2XQNM 2YS5A 2K00A 4B6HA 4CSQA 1EGXA 4DIXA 2W2XD 3GYPA 3PP2A 3SV1A 4HAWB 3MPXA 5J3YA 3CXBB 4HAYB 2ELBA 2RUKB 3TVVA 1I7AA 2D9VA 1QQGA 4NY0A 2K49A 2MFQA 2LULA 2I5FA 3IVFA 3U7DA 1OY2A 3SYXA 1WJ1A 2KCJA 4GMXB 3PEGA 2Y8GA 2BCJA 4K17A 1Z87A 2D10A 5D3VA 4DXAB 4QJ5B 2IYBA 3A8QA 4K81A 2RRFA 3KY9A 1SHCA 1H4RA 1FAOA 3QWMA 4HATB 1XCGA 3DCXA 3F0WA 2K8EA 5M4YB 1UPRA 5EFXA 4GN1A 5LG4B 2JP2A 4ZRIA 1U5EA 2EJ8A 1J19A 2K2JA 3M1IB 1M7EA 3KZ1A 2P8VA 2IFSA 4HB0B 3VIAA 2HTHB 2KUPA 2MWNB 2CRFA 3TFMA 2ADZA 3SUZA 1EVHA 2GUMA 2DLWA 4DX90 1ZVRA 4GMVA 2DX1A 3FVCA 1X11A 4A6HA 2VSZA 1K5GB 1ZC4B 3NW8A 3TCAA 2OTXA 3FSSA 4DX8A 3V5WA 4KHAA 2MKRA 1FHXA 4IOYX 4K2PA 3ZDTA 4HAVB 5I2SA 2DFKA 2EMTA 1PMSA 1WGQA 5GOWB 2I1KA 2D9ZA 2DHIA 2P0FA 4IAPA 5CLQB 4H8SA 1WJMA 5C6RA 4TYZA 1T77A 3AU5A 3AU4A 1EAZA 2G35A 2D9WA 5D27A 5C16A 3A58A 1UNRA 2RGNB 2I5CA 2V76A 2DA0A 1ZM0A 1PLSA 3ULCA 4WVFB 1TXDA 5KCVA 3DXDA 3AJ4A 4CHJA 1MK7B 2NMBA 1X1GA 2LYDA 3PZDA 3PVLA 5I2MA 4PQ0A 1FB8A 1OMWA 2R0DA 2LKOA 3KSYA 2LOZA 3ODWA 1FHOA 1DDWA 2COCA 2D9XA 2ROVA 2CODA 4ZRJA 4MK0A 1MIXA 1FGYA 3ZVRA 1PFJA 3CIKA 4XWXA 1GC6A 4HAUB 4EKUA 4Z2NA 1IRSA 1NI2A 3O96A 2Z59A 2KIGA 2AEHA 1DDMA 1H10A 2DKQA 4A6FA 1NTVA 2H7DA 2D9YA 4HB4B 5HE3A 2KR0A 1TJ6A 3HSAA 4D0NB 2CY5A 1FHWA 1WI1A 2YT2A 4QJ3B 2EC1A 4QJ4B 3G9WA 2L2IA 1V89A 1P3RA 3HQCA 2NBVA 1Y5OA 1X86A 3TW1A 3PVUA 1AQCA 5DI9B 3ML4A 3NSUA 2R2YA 2J0KA 4HB3B 2Y7BA 1EF1A 1KZ7A 1W1HA 2N0YA 1QC6A 1AWEA 4P7IA 4GXBA 2ELAA 2W2XC 1ZC3B 4OT1A 2QKMA 2DTCA 4YONA 1MAIA 5C5BA 2AL6A 5HE2A 2RLOA 2RSGA 1Y19B 2YT0A 4GOUA 4CYEA 4KHBA 4A6FB 1WG7A 1X1FA 2DN6A 4YL8A 3T06A 2COFA 2H7EA 2P0DA 3OANA 2DYQA 2OQBA 3HIEA 1W1DA 4Y94A 4L1RA 3TO1A 2GS0A 1SGHA 2EMSA 4CHMA 2VRWB 1N3HA 4NSWA 3N7CA 2D4QA 3FM8C 2KGXB 3BINA 1XKEA 2DYNA 3DXEA 2PZ1A 3HK0A 5D3XA 4HHVA 1TQZA 5JP4A 2YF0A 5J3TA 3MDBC 1K5DB 1FGZA 1V61A 2D11A 2M38A 3QBVB 2CAYA
chains in the Genus database with same CATH topology
4TKNA 5C5BB 1KZGA 1XX0A 3DXCA 2HE7A 3PVWA 4KAXB 4HDQA 2L1CA 5D3YA 4F7GA 4KHBB 3ULBA 3LJUX 2D2QA 2W2WA 5HE0A 4HDOA 2GCJA 1UEFA 2COAA 1LW3A 2YT1A 4WJ7A 3SNHA 4K2OA 1DROA 2UZRA 4Z2MB 1Q67A 1U5DA 2LOXA 2ZPYA 5DHAB 1V88A 2N23A 2UVMA 2J59M 1B55A 3U8ZA 4EMOA 4HAXB 4MT7A 1RRPB 2NZ8B 1U27A 4WSFA 1DBHA 3D8DA 4DBBA 1ZSQA 3A8PA 5DHFB 3WYFB 1XR0B 1X05A 5D3WA 1MPHA 1J0WA 1NTYA 2YS3A 3F5RA 4L6EA 1GG3A 3P6AA 1DDVA 1P6SA 4PNKA 3SO6A 1U5FA 4EJNA 1BTKA 2Z0QA 3GYOA 3HW2B 5CLLB 5KQ4A 4HAZB 5LONB 5KQ1A 1W1GA 3KRWA 2RVBB 5FI1A 2J0MA 3P7ZA 4GZUA 5HE1A 1LB1A 2X18A 5JHGA 3BJIA 1E5WA 2Z0OA 2J0JA 2VKIA 1DYNA 2Y8FA 1I2HA 3ODOA 4IFSA 1BTNA 2K2UA 2UZSA 4BBKA 1MKEA 1OQNA 1MK9B 1WVHA 2ROZB 3D8EA 1U29A 2E2XA 1FOEA 5J3QA 3QIJA 2FJLA 3FEHA 1BWNA 3PSCA 2Q13A 3WA0A 2QKLA 1XD4A 2R09A 1WGUA 4F7HA 1M7RA 4C0AA 2YSZA 2DHJA 1GC7A 3UZTA 2MDXA 2P0HA 5DIFB 1U5GA 3KRXA 1KI1B 1RJ2A 3A98B 1V5PA 5JLJB 1V5UA 2DX5A 4A5KA 2M14A 1UNQA 1UNPA 5FI0A 4F7UP 1U2BA 5C79A 4A6KA 2I1JA 2CY4A 4ZRKA 4KVGB 1XODA 2YVCA 2RNRB 2DKPA 2YS1A 4HB2B 4KHOA 3D8FA 4MY6A 2Z0PA 3PG7A 5DH9B 1BAKA 2YRYA 1V5MA 3VOQA 5JHHA 3RCPA 2GJYA 1NU2A 1MIZB 5L81A 1ISNA 3ODXA 2GCLA 2LG1A 4GPTB 3X23A 5LOPB 1P5TA 1UPQA 2DHKA 2XQNM 2YS5A 2K00A 4B6HA 1EGXA 2W2XD 3GYPA 3PP2A 3SV1A 4HAWB 3MPXA 5J3YA 3CXBB 4HAYB 2ELBA 2RUKB 3TVVA 1I7AA 2D9VA 1QQGA 4NY0A 2MFQA 2LULA 2I5FA 3IVFA 3U7DA 1OY2A 3SYXA 1WJ1A 2KCJA 4GMXB 3PEGA 2Y8GA 2BCJA 4K17A 1Z87A 2D10A 5D3VA 4DXAB 2IYBA 3A8QA 4K81A 3KY9A 1SHCA 1H4RA 1FAOA 3QWMA 4HATB 1XCGA 3F0WA 1UPRA 5EFXA 4GN1A 2JP2A 4ZRIA 1U5EA 2EJ8A 1J19A 2K2JA 3M1IB 1M7EA 3KZ1A 2P8VA 2IFSA 4HB0B 3VIAA 2HTHB 2KUPA 2MWNB 2CRFA 3TFMA 2ADZA 3SUZA 1EVHA 2DLWA 4DX90 1ZVRA 4GMVA 2DX1A 1X11A 4A6HA 2VSZA 1K5GB 1ZC4B 3TCAA 2OTXA 3FSSA 4DX8A 3V5WA 4KHAA 2MKRA 1FHXA 4IOYX 4K2PA 3ZDTA 4HAVB 2DFKA 2EMTA 1PMSA 1WGQA 5GOWB 2I1KA 2D9ZA 2DHIA 2P0FA 4IAPA 5CLQB 4H8SA 1WJMA 5C6RA 4TYZA 3AU5A 3AU4A 1EAZA 2G35A 2D9WA 5D27A 5C16A 1UNRA 2RGNB 2I5CA 2V76A 2DA0A 1ZM0A 1PLSA 3ULCA 4WVFB 1TXDA 5KCVA 3DXDA 3AJ4A 4CHJA 1MK7B 2NMBA 1X1GA 2LYDA 3PZDA 3PVLA 4PQ0A 1FB8A 1OMWA 2R0DA 2LKOA 3KSYA 2LOZA 3ODWA 1FHOA 1DDWA 2COCA 2D9XA 2ROVA 2CODA 4ZRJA 4MK0A 1MIXA 1FGYA 3ZVRA 1PFJA 3CIKA 4XWXA 1GC6A 4HAUB 4EKUA 4Z2NA 1IRSA 1NI2A 3O96A 2AEHA 1DDMA 1H10A 2DKQA 4A6FA 1NTVA 2H7DA 2D9YA 4HB4B 5HE3A 1TJ6A 4D0NB 2CY5A 1FHWA 1WI1A 2EC1A 3G9WA 2L2IA 1V89A 1P3RA 3HQCA 1Y5OA 1X86A 3TW1A 3PVUA 1AQCA 5DI9B 3ML4A 3NSUA 2J0KA 4HB3B 2Y7BA 1EF1A 1KZ7A 1W1HA 2N0YA 1QC6A 1AWEA 4P7IA 4GXBA 2ELAA 2W2XC 1ZC3B 2QKMA 2DTCA 4YONA 1MAIA 5C5BA 2AL6A 5HE2A 2RLOA 2RSGA 1Y19B 2YT0A 4CYEA 4A6FB 1WG7A 1X1FA 2DN6A 4YL8A 3T06A 2COFA 2H7EA 3OANA 2P0DA 2DYQA 2OQBA 1W1DA 4Y94A 3TO1A 2GS0A 1SGHA 2EMSA 4CHMA 2VRWB 1N3HA 4NSWA 3N7CA 2D4QA 3FM8C 2KGXB 3BINA 1XKEA 2DYNA 3DXEA 2PZ1A 3HK0A 5D3XA 4HHVA 1TQZA 5JP4A 2YF0A 5J3TA 3MDBC 1K5DB 1FGZA 1V61A 2D11A 2M38A 3QBVB 2CAYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4TKN A;  5C5B B;  1KZG A;  1XX0 A;  3DXC A;  2HE7 A;  3PVW A;  4KAX B;  4HDQ A;  2L1C A;  5D3Y A;  4F7G A;  4KHB B;  3ULB A;  3LJU X;  2D2Q A;  2W2W A;  5HE0 A;  4HDO A;  2GCJ A;  1UEF A;  2COA A;  1LW3 A;  2YT1 A;  4WJ7 A;  3SNH A;  4K2O A;  1DRO A;  2UZR A;  4Z2M B;  1Q67 A;  1U5D A;  2LOX A;  2ZPY A;  5DHA B;  1V88 A;  2N23 A;  2UVM A;  2J59 M;  1B55 A;  3U8Z A;  4EMO A;  4HAX B;  4MT7 A;  1RRP B;  2NZ8 B;  1U27 A;  4WSF A;  1DBH A;  3D8D A;  4DBB A;  1ZSQ A;  3A8P A;  5DHF B;  3WYF B;  1XR0 B;  1X05 A;  5D3W A;  1MPH A;  1J0W A;  1NTY A;  2YS3 A;  3F5R A;  4L6E A;  1GG3 A;  3P6A A;  1DDV A;  1P6S A;  4PNK A;  3SO6 A;  1U5F A;  4EJN A;  1BTK A;  2Z0Q A;  3GYO A;  3HW2 B;  5CLL B;  5KQ4 A;  4HAZ B;  5LON B;  5KQ1 A;  1W1G A;  3KRW A;  2RVB B;  5FI1 A;  2J0M A;  3P7Z A;  4GZU A;  5HE1 A;  1LB1 A;  2X18 A;  5JHG A;  3BJI A;  1E5W A;  2Z0O A;  2J0J A;  2VKI A;  1DYN A;  2Y8F A;  1I2H A;  3ODO A;  4IFS A;  1BTN A;  2K2U A;  2UZS A;  4BBK A;  1MKE A;  1OQN A;  1MK9 B;  1WVH A;  2ROZ B;  3D8E A;  1U29 A;  2E2X A;  1FOE A;  5J3Q A;  3QIJ A;  2FJL A;  3FEH A;  1BWN A;  3PSC A;  2Q13 A;  3WA0 A;  2QKL A;  1XD4 A;  2R09 A;  1WGU A;  4F7H A;  1M7R A;  4C0A A;  2YSZ A;  2DHJ A;  1GC7 A;  3UZT A;  2MDX A;  2P0H A;  5DIF B;  1U5G A;  3KRX A;  1KI1 B;  1RJ2 A;  3A98 B;  1V5P A;  5JLJ B;  1V5U A;  2DX5 A;  4A5K A;  2M14 A;  1UNQ A;  1UNP A;  5FI0 A;  4F7U P;  1U2B A;  5C79 A;  4A6K A;  2I1J A;  2CY4 A;  4ZRK A;  4KVG B;  1XOD A;  2YVC A;  2RNR B;  2DKP A;  2YS1 A;  4HB2 B;  4KHO A;  3D8F A;  4MY6 A;  2Z0P A;  3PG7 A;  5DH9 B;  1BAK A;  2YRY A;  1V5M A;  3VOQ A;  5JHH A;  3RCP A;  2GJY A;  1NU2 A;  1MIZ B;  5L81 A;  1ISN A;  3ODX A;  2GCL A;  2LG1 A;  4GPT B;  3X23 A;  5LOP B;  1P5T A;  1UPQ A;  2DHK A;  2XQN M;  2YS5 A;  2K00 A;  4B6H A;  1EGX A;  2W2X D;  3GYP A;  3PP2 A;  3SV1 A;  4HAW B;  3MPX A;  5J3Y A;  3CXB B;  4HAY B;  2ELB A;  2RUK B;  3TVV A;  1I7A A;  2D9V A;  1QQG A;  4NY0 A;  2MFQ A;  2LUL A;  2I5F A;  3IVF A;  3U7D A;  1OY2 A;  3SYX A;  1WJ1 A;  2KCJ A;  4GMX B;  3PEG A;  2Y8G A;  2BCJ A;  4K17 A;  1Z87 A;  2D10 A;  5D3V A;  4DXA B;  2IYB A;  3A8Q A;  4K81 A;  3KY9 A;  1SHC A;  1H4R A;  1FAO A;  3QWM A;  4HAT B;  1XCG A;  3F0W A;  1UPR A;  5EFX A;  4GN1 A;  2JP2 A;  4ZRI A;  1U5E A;  2EJ8 A;  1J19 A;  2K2J A;  3M1I B;  1M7E A;  3KZ1 A;  2P8V A;  2IFS A;  4HB0 B;  3VIA A;  2HTH B;  2KUP A;  2MWN B;  2CRF A;  3TFM A;  2ADZ A;  3SUZ A;  1EVH A;  2DLW A;  4DX9 0;  1ZVR A;  4GMV A;  2DX1 A;  1X11 A;  4A6H A;  2VSZ A;  1K5G B;  1ZC4 B;  3TCA A;  2OTX A;  3FSS A;  4DX8 A;  3V5W A;  4KHA A;  2MKR A;  1FHX A;  4IOY X;  4K2P A;  3ZDT A;  4HAV B;  2DFK A;  2EMT A;  1PMS A;  1WGQ A;  5GOW B;  2I1K A;  2D9Z A;  2DHI A;  2P0F A;  4IAP A;  5CLQ B;  4H8S A;  1WJM A;  5C6R A;  4TYZ A;  3AU5 A;  3AU4 A;  1EAZ A;  2G35 A;  2D9W A;  5D27 A;  5C16 A;  1UNR A;  2RGN B;  2I5C A;  2V76 A;  2DA0 A;  1ZM0 A;  1PLS A;  3ULC A;  4WVF B;  1TXD A;  5KCV A;  3DXD A;  3AJ4 A;  4CHJ A;  1MK7 B;  2NMB A;  1X1G A;  2LYD A;  3PZD A;  3PVL A;  4PQ0 A;  1FB8 A;  1OMW A;  2R0D A;  2LKO A;  3KSY A;  2LOZ A;  3ODW A;  1FHO A;  1DDW A;  2COC A;  2D9X A;  2ROV A;  2COD A;  4ZRJ A;  4MK0 A;  1MIX A;  1FGY A;  3ZVR A;  1PFJ A;  3CIK A;  4XWX A;  1GC6 A;  4HAU B;  4EKU A;  4Z2N A;  1IRS A;  1NI2 A;  3O96 A;  2AEH A;  1DDM A;  1H10 A;  2DKQ A;  4A6F A;  1NTV A;  2H7D A;  2D9Y A;  4HB4 B;  5HE3 A;  1TJ6 A;  4D0N B;  2CY5 A;  1FHW A;  1WI1 A;  2EC1 A;  3G9W A;  2L2I A;  1V89 A;  1P3R A;  3HQC A;  1Y5O A;  1X86 A;  3TW1 A;  3PVU A;  1AQC A;  5DI9 B;  3ML4 A;  3NSU A;  2J0K A;  4HB3 B;  2Y7B A;  1EF1 A;  1KZ7 A;  1W1H A;  2N0Y A;  1QC6 A;  1AWE A;  4P7I A;  4GXB A;  2ELA A;  2W2X C;  1ZC3 B;  2QKM A;  2DTC A;  4YON A;  1MAI A;  5C5B A;  2AL6 A;  5HE2 A;  2RLO A;  2RSG A;  1Y19 B;  2YT0 A;  4CYE A;  4A6F B;  1WG7 A;  1X1F A;  2DN6 A;  4YL8 A;  3T06 A;  2COF A;  2H7E A;  3OAN A;  2P0D A;  2DYQ A;  2OQB A;  1W1D A;  4Y94 A;  3TO1 A;  2GS0 A;  1SGH A;  2EMS A;  4CHM A;  2VRW B;  1N3H A;  4NSW A;  3N7C A;  2D4Q A;  3FM8 C;  2KGX B;  3BIN A;  1XKE A;  2DYN A;  3DXE A;  2PZ1 A;  3HK0 A;  5D3X A;  4HHV A;  1TQZ A;  5JP4 A;  2YF0 A;  5J3T A;  3MDB C;  1K5D B;  1FGZ A;  1V61 A;  2D11 A;  2M38 A;  3QBV B;  2CAY A; 
#chains in the Genus database with same CATH topology
 2KUQ A;  4TKN A;  5C5B B;  1KZG A;  1XX0 A;  3DXC A;  2HE7 A;  3PVW A;  4KAX B;  4HDQ A;  2L1C A;  5D3Y A;  4F7G A;  4KHB B;  3ULB A;  3LJU X;  2D2Q A;  2W2W A;  5HE0 A;  4HDO A;  2GCJ A;  1UEF A;  2COA A;  1LW3 A;  2YT1 A;  4WJ7 A;  3SNH A;  4K2O A;  1DRO A;  2UZR A;  3U12 A;  4Z2M B;  1Q67 A;  1U5D A;  2LOX A;  2ZPY A;  5DHA B;  3B77 A;  1V88 A;  2N23 A;  1ZYI A;  2UVM A;  2J59 M;  1B55 A;  3U8Z A;  4EMO A;  4HAX B;  4MT7 A;  1RRP B;  2NZ8 B;  1U27 A;  4WSF A;  1DBH A;  3D8D A;  4DBB A;  1ZSQ A;  3A8P A;  5DHF B;  3WYF B;  1XR0 B;  1X05 A;  5D3W A;  1MPH A;  1J0W A;  1NTY A;  2Z14 A;  2YS3 A;  3F5R A;  4L6E A;  1GG3 A;  3P6A A;  1DDV A;  1P6S A;  1MI1 A;  4PNK A;  3SO6 A;  1U5F A;  4EJN A;  1BTK A;  2Z0Q A;  4OSN A;  3GYO A;  3HW2 B;  5CLL B;  2Z13 A;  5KQ4 A;  4HAZ B;  5LON B;  5KQ1 A;  1W1G A;  3KRW A;  2RVB B;  5FI1 A;  2J0M A;  3P7Z A;  4GZU A;  5HE1 A;  1LB1 A;  3NWA A;  2X18 A;  5JHG A;  4HSI A;  3BJI A;  3NWF A;  1E5W A;  2Z0O A;  3OHM B;  2J0J A;  2VKI A;  1DYN A;  2Y8F A;  1I2H A;  3ODO A;  4IFS A;  1BTN A;  2K2U A;  2UZS A;  4BBK A;  1MKE A;  1OQN A;  1MK9 B;  1WVH A;  2ROZ B;  3D8E A;  2Z4D A;  1U29 A;  2E2X A;  1FOE A;  5J3Q A;  3QIJ A;  2FJL A;  3FEH A;  2ZKM X;  1BWN A;  3PSC A;  2Q13 A;  3WA0 A;  2FJU B;  2QKL A;  1XD4 A;  2R09 A;  1WGU A;  4F7H A;  1M7R A;  4C0A A;  2YSZ A;  2DHJ A;  1GC7 A;  3UZT A;  2MDX A;  2P0H A;  5DIF B;  1U5G A;  3KRX A;  1KI1 B;  4D6W A;  1RJ2 A;  5IRS A;  3A98 B;  1V5P A;  5JLJ B;  1V5U A;  2DX5 A;  4A5K A;  2M14 A;  1UNQ A;  1UNP A;  5FI0 A;  4F7U P;  4QXA B;  1U2B A;  3NWD A;  5C79 A;  4GNK B;  4A6K A;  2I1J A;  2CY4 A;  4ZRK A;  4KVG B;  1XOD A;  2YVC A;  2RNR B;  2DKP A;  2YS1 A;  4HB2 B;  4KHO A;  3D8F A;  4MY6 A;  2Z0P A;  3PG7 A;  5DH9 B;  1BAK A;  2YRY A;  1V5M A;  3VOQ A;  5JHH A;  3RCP A;  2GJY A;  1NU2 A;  1MIZ B;  5L81 A;  1ISN A;  3ODX A;  2KIE A;  2GCL A;  2LG1 A;  4GPT B;  3X23 A;  5LOP B;  1P5T A;  1UPQ A;  2DHK A;  2XQN M;  2YS5 A;  2K00 A;  4B6H A;  4CSQ A;  1EGX A;  4DIX A;  2W2X D;  3GYP A;  3PP2 A;  3SV1 A;  4HAW B;  3MPX A;  5J3Y A;  3CXB B;  4HAY B;  2ELB A;  2RUK B;  3TVV A;  1I7A A;  2D9V A;  1QQG A;  4NY0 A;  2K49 A;  2MFQ A;  2LUL A;  2I5F A;  3IVF A;  3U7D A;  1OY2 A;  3SYX A;  1WJ1 A;  2KCJ A;  4GMX B;  3PEG A;  2Y8G A;  2BCJ A;  4K17 A;  1Z87 A;  2D10 A;  5D3V A;  4DXA B;  4QJ5 B;  2IYB A;  3A8Q A;  4K81 A;  2RRF A;  3KY9 A;  1SHC A;  1H4R A;  1FAO A;  3QWM A;  4HAT B;  1XCG A;  3DCX A;  3F0W A;  2K8E A;  5M4Y B;  1UPR A;  5EFX A;  4GN1 A;  5LG4 B;  2JP2 A;  4ZRI A;  1U5E A;  2EJ8 A;  1J19 A;  2K2J A;  3M1I B;  1M7E A;  3KZ1 A;  2P8V A;  2IFS A;  4HB0 B;  3VIA A;  2HTH B;  2KUP A;  2MWN B;  2CRF A;  3TFM A;  2ADZ A;  3SUZ A;  1EVH A;  2GUM A;  2DLW A;  4DX9 0;  1ZVR A;  4GMV A;  2DX1 A;  3FVC A;  1X11 A;  4A6H A;  2VSZ A;  1K5G B;  1ZC4 B;  3NW8 A;  3TCA A;  2OTX A;  3FSS A;  4DX8 A;  3V5W A;  4KHA A;  2MKR A;  1FHX A;  4IOY X;  4K2P A;  3ZDT A;  4HAV B;  5I2S A;  2DFK A;  2EMT A;  1PMS A;  1WGQ A;  5GOW B;  2I1K A;  2D9Z A;  2DHI A;  2P0F A;  4IAP A;  5CLQ B;  4H8S A;  1WJM A;  5C6R A;  4TYZ A;  1T77 A;  3AU5 A;  3AU4 A;  1EAZ A;  2G35 A;  2D9W A;  5D27 A;  5C16 A;  3A58 A;  1UNR A;  2RGN B;  2I5C A;  2V76 A;  2DA0 A;  1ZM0 A;  1PLS A;  3ULC A;  4WVF B;  1TXD A;  5KCV A;  3DXD A;  3AJ4 A;  4CHJ A;  1MK7 B;  2NMB A;  1X1G A;  2LYD A;  3PZD A;  3PVL A;  5I2M A;  4PQ0 A;  1FB8 A;  1OMW A;  2R0D A;  2LKO A;  3KSY A;  2LOZ A;  3ODW A;  1FHO A;  1DDW A;  2COC A;  2D9X A;  2ROV A;  2COD A;  4ZRJ A;  4MK0 A;  1MIX A;  1FGY A;  3ZVR A;  1PFJ A;  3CIK A;  4XWX A;  1GC6 A;  4HAU B;  4EKU A;  4Z2N A;  1IRS A;  1NI2 A;  3O96 A;  2Z59 A;  2KIG A;  2AEH A;  1DDM A;  1H10 A;  2DKQ A;  4A6F A;  1NTV A;  2H7D A;  2D9Y A;  4HB4 B;  5HE3 A;  2KR0 A;  1TJ6 A;  3HSA A;  4D0N B;  2CY5 A;  1FHW A;  1WI1 A;  2YT2 A;  4QJ3 B;  2EC1 A;  4QJ4 B;  3G9W A;  2L2I A;  1V89 A;  1P3R A;  3HQC A;  2NBV A;  1Y5O A;  1X86 A;  3TW1 A;  3PVU A;  1AQC A;  5DI9 B;  3ML4 A;  3NSU A;  2R2Y A;  2J0K A;  4HB3 B;  2Y7B A;  1EF1 A;  1KZ7 A;  1W1H A;  2N0Y A;  1QC6 A;  1AWE A;  4P7I A;  4GXB A;  2ELA A;  2W2X C;  1ZC3 B;  4OT1 A;  2QKM A;  2DTC A;  4YON A;  1MAI A;  5C5B A;  2AL6 A;  5HE2 A;  2RLO A;  2RSG A;  1Y19 B;  2YT0 A;  4GOU A;  4CYE A;  4KHB A;  4A6F B;  1WG7 A;  1X1F A;  2DN6 A;  4YL8 A;  3T06 A;  2COF A;  2H7E A;  2P0D A;  3OAN A;  2DYQ A;  2OQB A;  3HIE A;  1W1D A;  4Y94 A;  4L1R A;  3TO1 A;  2GS0 A;  1SGH A;  2EMS A;  4CHM A;  2VRW B;  1N3H A;  4NSW A;  3N7C A;  2D4Q A;  3FM8 C;  2KGX B;  3BIN A;  1XKE A;  2DYN A;  3DXE A;  2PZ1 A;  3HK0 A;  5D3X A;  4HHV A;  1TQZ A;  5JP4 A;  2YF0 A;  5J3T A;  3MDB C;  1K5D B;  1FGZ A;  1V61 A;  2D11 A;  2M38 A;  3QBV B;  2CAY A; 
#chains in the Genus database with same CATH homology
 4TKN A;  5C5B B;  1KZG A;  1XX0 A;  3DXC A;  2HE7 A;  3PVW A;  4KAX B;  4HDQ A;  2L1C A;  5D3Y A;  4F7G A;  4KHB B;  3ULB A;  3LJU X;  2D2Q A;  2W2W A;  5HE0 A;  4HDO A;  2GCJ A;  1UEF A;  2COA A;  1LW3 A;  2YT1 A;  4WJ7 A;  3SNH A;  4K2O A;  1DRO A;  2UZR A;  4Z2M B;  1Q67 A;  1U5D A;  2LOX A;  2ZPY A;  5DHA B;  1V88 A;  2N23 A;  2UVM A;  2J59 M;  1B55 A;  3U8Z A;  4EMO A;  4HAX B;  4MT7 A;  1RRP B;  2NZ8 B;  1U27 A;  4WSF A;  1DBH A;  3D8D A;  4DBB A;  1ZSQ A;  3A8P A;  5DHF B;  3WYF B;  1XR0 B;  1X05 A;  5D3W A;  1MPH A;  1J0W A;  1NTY A;  2YS3 A;  3F5R A;  4L6E A;  1GG3 A;  3P6A A;  1DDV A;  1P6S A;  4PNK A;  3SO6 A;  1U5F A;  4EJN A;  1BTK A;  2Z0Q A;  3GYO A;  3HW2 B;  5CLL B;  5KQ4 A;  4HAZ B;  5LON B;  5KQ1 A;  1W1G A;  3KRW A;  2RVB B;  5FI1 A;  2J0M A;  3P7Z A;  4GZU A;  5HE1 A;  1LB1 A;  2X18 A;  5JHG A;  3BJI A;  1E5W A;  2Z0O A;  2J0J A;  2VKI A;  1DYN A;  2Y8F A;  1I2H A;  3ODO A;  4IFS A;  1BTN A;  2K2U A;  2UZS A;  4BBK A;  1MKE A;  1OQN A;  1MK9 B;  1WVH A;  2ROZ B;  3D8E A;  1U29 A;  2E2X A;  1FOE A;  5J3Q A;  3QIJ A;  2FJL A;  3FEH A;  1BWN A;  3PSC A;  2Q13 A;  3WA0 A;  2QKL A;  1XD4 A;  2R09 A;  1WGU A;  4F7H A;  1M7R A;  4C0A A;  2YSZ A;  2DHJ A;  1GC7 A;  3UZT A;  2MDX A;  2P0H A;  5DIF B;  1U5G A;  3KRX A;  1KI1 B;  1RJ2 A;  3A98 B;  1V5P A;  5JLJ B;  1V5U A;  2DX5 A;  4A5K A;  2M14 A;  1UNQ A;  1UNP A;  5FI0 A;  4F7U P;  1U2B A;  5C79 A;  4A6K A;  2I1J A;  2CY4 A;  4ZRK A;  4KVG B;  1XOD A;  2YVC A;  2RNR B;  2DKP A;  2YS1 A;  4HB2 B;  4KHO A;  3D8F A;  4MY6 A;  2Z0P A;  3PG7 A;  5DH9 B;  1BAK A;  2YRY A;  1V5M A;  3VOQ A;  5JHH A;  3RCP A;  2GJY A;  1NU2 A;  1MIZ B;  5L81 A;  1ISN A;  3ODX A;  2GCL A;  2LG1 A;  4GPT B;  3X23 A;  5LOP B;  1P5T A;  1UPQ A;  2DHK A;  2XQN M;  2YS5 A;  2K00 A;  4B6H A;  1EGX A;  2W2X D;  3GYP A;  3PP2 A;  3SV1 A;  4HAW B;  3MPX A;  5J3Y A;  3CXB B;  4HAY B;  2ELB A;  2RUK B;  3TVV A;  1I7A A;  2D9V A;  1QQG A;  4NY0 A;  2MFQ A;  2LUL A;  2I5F A;  3IVF A;  3U7D A;  1OY2 A;  3SYX A;  1WJ1 A;  2KCJ A;  4GMX B;  3PEG A;  2Y8G A;  2BCJ A;  4K17 A;  1Z87 A;  2D10 A;  5D3V A;  4DXA B;  2IYB A;  3A8Q A;  4K81 A;  3KY9 A;  1SHC A;  1H4R A;  1FAO A;  3QWM A;  4HAT B;  1XCG A;  3F0W A;  1UPR A;  5EFX A;  4GN1 A;  2JP2 A;  4ZRI A;  1U5E A;  2EJ8 A;  1J19 A;  2K2J A;  3M1I B;  1M7E A;  3KZ1 A;  2P8V A;  2IFS A;  4HB0 B;  3VIA A;  2HTH B;  2KUP A;  2MWN B;  2CRF A;  3TFM A;  2ADZ A;  3SUZ A;  1EVH A;  2DLW A;  4DX9 0;  1ZVR A;  4GMV A;  2DX1 A;  1X11 A;  4A6H A;  2VSZ A;  1K5G B;  1ZC4 B;  3TCA A;  2OTX A;  3FSS A;  4DX8 A;  3V5W A;  4KHA A;  2MKR A;  1FHX A;  4IOY X;  4K2P A;  3ZDT A;  4HAV B;  2DFK A;  2EMT A;  1PMS A;  1WGQ A;  5GOW B;  2I1K A;  2D9Z A;  2DHI A;  2P0F A;  4IAP A;  5CLQ B;  4H8S A;  1WJM A;  5C6R A;  4TYZ A;  3AU5 A;  3AU4 A;  1EAZ A;  2G35 A;  2D9W A;  5D27 A;  5C16 A;  1UNR A;  2RGN B;  2I5C A;  2V76 A;  2DA0 A;  1ZM0 A;  1PLS A;  3ULC A;  4WVF B;  1TXD A;  5KCV A;  3DXD A;  3AJ4 A;  4CHJ A;  1MK7 B;  2NMB A;  1X1G A;  2LYD A;  3PZD A;  3PVL A;  4PQ0 A;  1FB8 A;  1OMW A;  2R0D A;  2LKO A;  3KSY A;  2LOZ A;  3ODW A;  1FHO A;  1DDW A;  2COC A;  2D9X A;  2ROV A;  2COD A;  4ZRJ A;  4MK0 A;  1MIX A;  1FGY A;  3ZVR A;  1PFJ A;  3CIK A;  4XWX A;  1GC6 A;  4HAU B;  4EKU A;  4Z2N A;  1IRS A;  1NI2 A;  3O96 A;  2AEH A;  1DDM A;  1H10 A;  2DKQ A;  4A6F A;  1NTV A;  2H7D A;  2D9Y A;  4HB4 B;  5HE3 A;  1TJ6 A;  4D0N B;  2CY5 A;  1FHW A;  1WI1 A;  2EC1 A;  3G9W A;  2L2I A;  1V89 A;  1P3R A;  3HQC A;  1Y5O A;  1X86 A;  3TW1 A;  3PVU A;  1AQC A;  5DI9 B;  3ML4 A;  3NSU A;  2J0K A;  4HB3 B;  2Y7B A;  1EF1 A;  1KZ7 A;  1W1H A;  2N0Y A;  1QC6 A;  1AWE A;  4P7I A;  4GXB A;  2ELA A;  2W2X C;  1ZC3 B;  2QKM A;  2DTC A;  4YON A;  1MAI A;  5C5B A;  2AL6 A;  5HE2 A;  2RLO A;  2RSG A;  1Y19 B;  2YT0 A;  4CYE A;  4A6F B;  1WG7 A;  1X1F A;  2DN6 A;  4YL8 A;  3T06 A;  2COF A;  2H7E A;  3OAN A;  2P0D A;  2DYQ A;  2OQB A;  1W1D A;  4Y94 A;  3TO1 A;  2GS0 A;  1SGH A;  2EMS A;  4CHM A;  2VRW B;  1N3H A;  4NSW A;  3N7C A;  2D4Q A;  3FM8 C;  2KGX B;  3BIN A;  1XKE A;  2DYN A;  3DXE A;  2PZ1 A;  3HK0 A;  5D3X A;  4HHV A;  1TQZ A;  5JP4 A;  2YF0 A;  5J3T A;  3MDB C;  1K5D B;  1FGZ A;  1V61 A;  2D11 A;  2M38 A;  3QBV B;  2CAY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...