1WI1A

Solution structure of the ph domain of human calcium-dependent activator protein for secretion (caps)
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
126
structure length
126
Chain Sequence
GSSGSSGMKHSGYLWAIGKNVWKRWKKRFFVLVQVSQYTFAMCSYREKKAEPQELLQLDGYTVDYTDPQPGLEGGRAFFNAVKEGDTVIFASDDEQDRILWVQAMYRATGQSHKPVPPTQSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords calcium-dependent activator protein for secretion, CAPS
publication title Solution structure of the PH domain of human calcium-dependent activator protein for secretion (CAPS)
rcsb
source organism Homo sapiens
molecule tags Endocytosis/exocytosis
total genus 14
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2004-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1wi1A01
1MK7B 1IRSA 1DDVA 1W1DA 1Q67A 5D3VA 5HE1A 1PFJA 5KCVA 4NSWA 1ZC3B 3G9WA 4Y94A 2J0JA 5HE0A 1KZ7A 1X1FA 4GZUA 3DXDA 3A98B 1TXDA 5JHGA 1V5MA 1W1GA 4HB4B 2IYBA 3F5RA 2LYDA 2MKRA 2J59M 1DDMA 2Z0PA 3QIJA 3PP2A 1X05A 2K2JA 1RRPB 5C79A 4WJ7A 2DKQA 2G35A 2GCJA 3KSYA 4C0AA 1DYNA 3KY9A 1V5UA 4KAXB 1XR0B 2VRWB 2HE7A 4IOYX 1WGUA 2D9ZA 4GN1A 4EKUA 4GXBA 2CODA 1PMSA 2YSZA 2BCJA 2P8VA 3D8DA 2QKMA 1UPRA 1OY2A 2HTHB 2DX5A 3KRXA 4HAVB 1RJ2A 2H7EA 2YT0A 1U5DA 5D3XA 3GYPA 2P0FA 4EJNA 3SNHA 4K17A 2J0MA 1EVHA 2W2XC 1H10A 5L81A 2D10A 1TJ6A 1XCGA 3ODXA 4HHVA 3HQCA 3V5WA 2W2WA 5DH9B 2UZRA 5D27A 2JP2A 1U27A 4KHAA 5KQ1A 1EF1A 4KHOA 1LW3A 2X18A 1FHWA 2M14A 2N23A 1UNQA 2OTXA 1BTNA 1FOEA 3SV1A 2L2IA 3PG7A 2GCLA 5D3YA 3AJ4A 1K5DB 1DBHA 4ZRJA 1GC7A 2E2XA 3CIKA 1GG3A 2M38A 4IFSA 3TVVA 3ZVRA 5C6RA 5J3YA 4HAZB 1U5GA 3VOQA 4HDOA 4TKNA 4KHBB 4HAWB 1J19A 4A6FA 1XX0A 3FSSA 5JLJB 2CRFA 3SO6A 1MK9B 4XWXA 1U5EA 4NY0A 2ROZB 3P7ZA 4MT7A 2KGXB 1BAKA 2RVBB 2LG1A 2Z0OA 5EFXA 4PNKA 2ELAA 2EMTA 2Y8FA 1M7EA 1V89A 3U8ZA 2MWNB 1W1HA 1Z87A 4DXAB 2D9VA 1SHCA 1X86A 2GJYA 3MPXA 4F7UP 1WJMA 1V5PA 5DI9B 3A8QA 5D3WA 3BJIA 1H4RA 3PSCA 2DX1A 1U29A 1FB8A 2YS5A 3SYXA 1NTVA 4HAXB 3SUZA 4GPTB 3OANA 2I1KA 3D8FA 4GMXB 1X1GA 2DN6A 1UNPA 2DKPA 4WSFA 2D9WA 2DFKA 2DTCA 2NZ8B 2K2UA 2YF0A 4PQ0A 1WI1A 3N7CA 3DXEA 1FGYA 4P7IA 5CLQB 1WVHA 2R09A 3WYFB 2AL6A 5DHFB 2EJ8A 1KI1B 4Z2MB 2AEHA 5C5BB 3ULCA 2D4QA 2COAA 2MFQA 4IAPA 1U2BA 2DHJA 2RLOA 2Y7BA 3MDBC 3QWMA 2J0KA 2RSGA 4EMOA 1QC6A 2FJLA 4GMVA 3PEGA 2Y8GA 5CLLB 4HDQA 2LOXA 5JHHA 1M7RA 2OQBA 2L1CA 2QKLA 2D9YA 2D11A 2GS0A 2DHIA 2MDXA 4HB3B 2I1JA 1XODA 1WJ1A 3AU4A 2D9XA 4DX90 3GYOA 5KQ4A 4D0NB 1ISNA 3PZDA 1FHOA 3KRWA 2EC1A 1AWEA 2CY4A 1XD4A 4YONA 1MIZB 2COFA 3PVLA 3X23A 3NSUA 4B6HA 2DA0A 2LKOA 4HATB 3U7DA 1LB1A 5JP4A 3WA0A 3M1IB 2VSZA 3ZDTA 1NTYA 1GC6A 1BTKA 2EMSA 3P6AA 3TW1A 3ODOA 3FM8C 1V88A 3D8EA 5J3TA 1UPQA 4H8SA 2P0HA 1MKEA 4CHJA 2YT1A 2DYQA 3ODWA 4HB0B 2COCA 2PZ1A 2W2XD 2RUKB 1NU2A 3O96A 2IFSA 2D2QA 1MPHA 2YS3A 1MIXA 2ZPYA 2LOZA 1UEFA 1Y5OA 4BBKA 5FI1A 2NMBA 2YS1A 1WGQA 2K00A 3PVWA 1I7AA 1NI2A 3HK0A 3KZ1A 5DIFB 2DLWA 2ROVA 1OQNA 3PVUA 4HAYB 4F7HA 5HE2A 1P6SA 5J3QA 5HE3A 4WVFB 2CY5A 5FI0A 4CHMA 1FGZA 1XKEA 4KVGB 2R0DA 3RCPA 3F0WA 2VKIA 1ZVRA 1DROA 2LULA 1X11A 4HAUB 1EGXA 5LONB 1U5FA 4HB2B 2YVCA 2DYNA 2ELBA 4CYEA 4TYZA 2RGNB 2P0DA 2UVMA 2V76A 2XQNM 1QQGA 3IVFA 2Z0QA 3TFMA 3UZTA 1AQCA 4A6KA 1SGHA 3A8PA 3ULBA 1EAZA 3BINA 2ADZA 4MY6A 4A6FB 1I2HA 2Q13A 1FAOA 1UNRA 4DX8A 4A5KA 3QBVB 3FEHA 1OMWA 1ZSQA 4A6HA 1BWNA 3HW2B 1DDWA 1K5GB 3CXBB 2H7DA 2CAYA 3VIAA 3ML4A 1P5TA 5DHAB 4ZRKA 1ZM0A 3AU5A 3LJUX 4L6EA 4K2PA 1V61A 1P3RA 1PLSA 2N0YA 4Z2NA 4YL8A 2UZSA 2KUPA 4K81A 5C16A 1B55A 1N3HA 4DBBA 2I5CA 1ZC4B 2RNRB 1WG7A 1KZGA 5GOWB 1J0WA 3DXCA 2KCJA 2I5FA 1MAIA 2DHKA 5LOPB 5C5BA 1FHXA 4ZRIA 3T06A 4MK0A 1TQZA 4K2OA 4F7GA 2YRYA 3TCAA 3TO1A 1E5WA 1Y19B
chains in the Genus database with same CATH superfamily
2R2YA 1MK7B 1IRSA 1DDVA 1W1DA 1Q67A 5D3VA 5HE1A 3A58A 1PFJA 5KCVA 4NSWA 1ZC3B 3G9WA 4Y94A 2J0JA 5HE0A 2Z4DA 1KZ7A 1X1FA 4GZUA 3DXDA 3A98B 1TXDA 5JHGA 1V5MA 1W1GA 4GNKB 4QJ5B 4HB4B 2IYBA 3F5RA 2LYDA 3NWFA 2MKRA 2J59M 1DDMA 2Z0PA 3QIJA 2Z59A 3PP2A 4D6WA 1X05A 2K2JA 1RRPB 5C79A 3HSAA 4WJ7A 2DKQA 2G35A 2GCJA 3KSYA 4C0AA 1DYNA 3KY9A 1V5UA 4KAXB 1XR0B 2VRWB 2HE7A 4IOYX 1WGUA 2D9ZA 4GN1A 4DIXA 4EKUA 4GXBA 2CODA 1PMSA 2YSZA 2BCJA 2K8EA 2P8VA 3D8DA 2QKMA 2FJUB 1UPRA 1OY2A 2HTHB 2DX5A 3KRXA 4HAVB 2KUQA 1RJ2A 2H7EA 5I2MA 2YT0A 1U5DA 5D3XA 3GYPA 2P0FA 4EJNA 3SNHA 4K17A 2J0MA 1EVHA 2W2XC 1H10A 5L81A 2D10A 1TJ6A 1XCGA 3ODXA 4HHVA 3HQCA 3V5WA 2W2WA 5DH9B 2UZRA 3NWAA 5D27A 2JP2A 1U27A 4KHAA 2YT2A 5KQ1A 1EF1A 4KHOA 1LW3A 2X18A 1FHWA 4OT1A 2M14A 2N23A 1UNQA 2OTXA 1BTNA 1FOEA 3SV1A 2L2IA 3PG7A 2GCLA 5LG4B 5D3YA 3AJ4A 1K5DB 1DBHA 4ZRJA 1GC7A 2E2XA 3CIKA 1GG3A 2M38A 4IFSA 3TVVA 3ZVRA 5C6RA 5J3YA 4HAZB 1U5GA 3VOQA 4HDOA 4TKNA 2KR0A 2KIGA 4KHBB 4HAWB 1J19A 4A6FA 1XX0A 3FSSA 5JLJB 2CRFA 3SO6A 1MK9B 4XWXA 1U5EA 4NY0A 2ROZB 3P7ZA 4MT7A 2KGXB 1BAKA 2RVBB 2LG1A 2Z0OA 5EFXA 5IRSA 4PNKA 2ELAA 2EMTA 5I2SA 2Y8FA 1M7EA 1V89A 3U8ZA 2MWNB 1W1HA 1Z87A 4DXAB 2D9VA 1SHCA 1X86A 2K49A 2GJYA 3MPXA 4F7UP 1WJMA 1V5PA 5DI9B 3A8QA 5D3WA 3BJIA 1H4RA 3PSCA 2DX1A 1U29A 1FB8A 2YS5A 3SYXA 1NTVA 4HAXB 2ZKMX 3SUZA 3U12A 4GPTB 3OANA 2I1KA 3D8FA 4GMXB 1X1GA 2DN6A 1UNPA 4CSQA 2DKPA 4WSFA 2D9WA 2DFKA 2DTCA 2NZ8B 2K2UA 2YF0A 4PQ0A 1WI1A 3N7CA 3DXEA 1FGYA 2Z13A 4P7IA 5CLQB 1WVHA 2R09A 3WYFB 2GUMA 2AL6A 5DHFB 2EJ8A 1KI1B 4Z2MB 2AEHA 5C5BB 1T77A 3ULCA 2D4QA 2COAA 2MFQA 4IAPA 1U2BA 2DHJA 2RLOA 2Y7BA 3MDBC 3QWMA 2J0KA 2RSGA 4EMOA 1QC6A 2FJLA 4GMVA 3DCXA 3PEGA 2Y8GA 5CLLB 4HDQA 2LOXA 5JHHA 1M7RA 2OQBA 2L1CA 2QKLA 2D9YA 2D11A 2GS0A 2DHIA 2MDXA 4HB3B 2I1JA 1XODA 1WJ1A 3AU4A 2D9XA 4DX90 3GYOA 5KQ4A 4D0NB 1ISNA 3PZDA 1FHOA 3KRWA 2EC1A 1AWEA 2CY4A 1XD4A 4YONA 1MIZB 2COFA 3HIEA 3PVLA 3X23A 3NSUA 4B6HA 2DA0A 2LKOA 4HATB 3U7DA 1LB1A 5JP4A 3WA0A 3M1IB 4OSNA 1MI1A 2VSZA 3ZDTA 1NTYA 1GC6A 1BTKA 2EMSA 3P6AA 3TW1A 4HSIA 3ODOA 3FM8C 1V88A 3D8EA 5J3TA 1UPQA 4H8SA 2P0HA 1MKEA 4CHJA 2YT1A 2DYQA 3FVCA 2RRFA 3ODWA 4HB0B 2COCA 2PZ1A 2W2XD 2RUKB 3NWDA 1NU2A 3O96A 2IFSA 2D2QA 4L1RA 1MPHA 2KIEA 2YS3A 1MIXA 2ZPYA 2LOZA 1UEFA 1Y5OA 4BBKA 5FI1A 3NW8A 2NMBA 2YS1A 1WGQA 4QJ4B 3OHMB 2K00A 3PVWA 1I7AA 1NI2A 3HK0A 3KZ1A 5DIFB 4GOUA 2DLWA 2ROVA 1OQNA 3PVUA 4HAYB 4F7HA 5HE2A 1P6SA 5J3QA 5HE3A 4WVFB 2CY5A 5FI0A 4CHMA 1FGZA 1XKEA 4KVGB 2R0DA 3RCPA 3F0WA 2VKIA 1ZVRA 4KHBA 1DROA 2LULA 1X11A 4HAUB 1EGXA 5LONB 1U5FA 2NBVA 4HB2B 2YVCA 2DYNA 2ELBA 4CYEA 1ZYIA 4TYZA 2RGNB 2P0DA 2UVMA 2V76A 2XQNM 1QQGA 3IVFA 2Z0QA 3TFMA 3UZTA 1AQCA 4A6KA 1SGHA 3A8PA 3ULBA 3B77A 1EAZA 3BINA 2ADZA 4MY6A 4A6FB 1I2HA 2Q13A 1FAOA 1UNRA 4DX8A 4A5KA 3QBVB 3FEHA 1OMWA 1ZSQA 4A6HA 1BWNA 3HW2B 1DDWA 1K5GB 3CXBB 2H7DA 2CAYA 3VIAA 3ML4A 1P5TA 5DHAB 4ZRKA 1ZM0A 3AU5A 3LJUX 4L6EA 4K2PA 1V61A 1P3RA 1PLSA 2N0YA 4Z2NA 4YL8A 2UZSA 2KUPA 4K81A 4QXAB 5C16A 4QJ3B 1B55A 1N3HA 4DBBA 2I5CA 1ZC4B 2RNRB 1WG7A 1KZGA 5GOWB 1J0WA 3DXCA 2KCJA 2Z14A 2I5FA 1MAIA 2DHKA 5LOPB 5C5BA 1FHXA 4ZRIA 3T06A 4MK0A 1TQZA 4K2OA 4F7GA 2YRYA 3TCAA 3TO1A 1E5WA 1Y19B 5M4YB
chains in the Genus database with same CATH topology
1MK7B 1IRSA 1DDVA 1W1DA 1Q67A 5D3VA 5HE1A 1PFJA 5KCVA 4NSWA 1ZC3B 3G9WA 4Y94A 2J0JA 5HE0A 1KZ7A 1X1FA 4GZUA 3DXDA 3A98B 1TXDA 5JHGA 1V5MA 1W1GA 4HB4B 2IYBA 3F5RA 2LYDA 2MKRA 2J59M 1DDMA 2Z0PA 3QIJA 3PP2A 1X05A 2K2JA 1RRPB 5C79A 4WJ7A 2DKQA 2G35A 2GCJA 3KSYA 4C0AA 1DYNA 3KY9A 1V5UA 4KAXB 1XR0B 2VRWB 2HE7A 4IOYX 1WGUA 2D9ZA 4GN1A 4EKUA 4GXBA 2CODA 1PMSA 2YSZA 2BCJA 2P8VA 3D8DA 2QKMA 1UPRA 1OY2A 2HTHB 2DX5A 3KRXA 4HAVB 1RJ2A 2H7EA 2YT0A 1U5DA 5D3XA 3GYPA 2P0FA 4EJNA 3SNHA 4K17A 2J0MA 1EVHA 2W2XC 1H10A 5L81A 2D10A 1TJ6A 1XCGA 3ODXA 4HHVA 3HQCA 3V5WA 2W2WA 5DH9B 2UZRA 5D27A 2JP2A 1U27A 4KHAA 5KQ1A 1EF1A 4KHOA 1LW3A 2X18A 1FHWA 2M14A 2N23A 1UNQA 2OTXA 1BTNA 1FOEA 3SV1A 2L2IA 3PG7A 2GCLA 5D3YA 3AJ4A 1K5DB 1DBHA 4ZRJA 1GC7A 2E2XA 3CIKA 1GG3A 2M38A 4IFSA 3TVVA 3ZVRA 5C6RA 5J3YA 4HAZB 1U5GA 3VOQA 4HDOA 4TKNA 4KHBB 4HAWB 1J19A 4A6FA 1XX0A 3FSSA 5JLJB 2CRFA 3SO6A 1MK9B 4XWXA 1U5EA 4NY0A 2ROZB 3P7ZA 4MT7A 2KGXB 1BAKA 2RVBB 2LG1A 2Z0OA 5EFXA 4PNKA 2ELAA 2EMTA 2Y8FA 1M7EA 1V89A 3U8ZA 2MWNB 1W1HA 1Z87A 4DXAB 2D9VA 1SHCA 1X86A 2GJYA 3MPXA 4F7UP 1WJMA 1V5PA 5DI9B 3A8QA 5D3WA 3BJIA 1H4RA 3PSCA 2DX1A 1U29A 1FB8A 2YS5A 3SYXA 1NTVA 4HAXB 3SUZA 4GPTB 3OANA 2I1KA 3D8FA 4GMXB 1X1GA 2DN6A 1UNPA 2DKPA 4WSFA 2D9WA 2DFKA 2DTCA 2NZ8B 2K2UA 2YF0A 4PQ0A 1WI1A 3N7CA 3DXEA 1FGYA 4P7IA 5CLQB 1WVHA 2R09A 3WYFB 2AL6A 5DHFB 2EJ8A 1KI1B 4Z2MB 2AEHA 5C5BB 3ULCA 2D4QA 2COAA 2MFQA 4IAPA 1U2BA 2DHJA 2RLOA 2Y7BA 3MDBC 3QWMA 2J0KA 2RSGA 4EMOA 1QC6A 2FJLA 4GMVA 3PEGA 2Y8GA 5CLLB 4HDQA 2LOXA 5JHHA 1M7RA 2OQBA 2L1CA 2QKLA 2D9YA 2D11A 2GS0A 2DHIA 2MDXA 4HB3B 2I1JA 1XODA 1WJ1A 3AU4A 2D9XA 4DX90 3GYOA 5KQ4A 4D0NB 1ISNA 3PZDA 1FHOA 3KRWA 2EC1A 1AWEA 2CY4A 1XD4A 4YONA 1MIZB 2COFA 3PVLA 3X23A 3NSUA 4B6HA 2DA0A 2LKOA 4HATB 3U7DA 1LB1A 5JP4A 3WA0A 3M1IB 2VSZA 3ZDTA 1NTYA 1GC6A 1BTKA 2EMSA 3P6AA 3TW1A 3ODOA 3FM8C 1V88A 3D8EA 5J3TA 1UPQA 4H8SA 2P0HA 1MKEA 4CHJA 2YT1A 2DYQA 3ODWA 4HB0B 2COCA 2PZ1A 2W2XD 2RUKB 1NU2A 3O96A 2IFSA 2D2QA 1MPHA 2YS3A 1MIXA 2ZPYA 2LOZA 1UEFA 1Y5OA 4BBKA 5FI1A 2NMBA 2YS1A 1WGQA 2K00A 3PVWA 1I7AA 1NI2A 3HK0A 3KZ1A 5DIFB 2DLWA 2ROVA 1OQNA 3PVUA 4HAYB 4F7HA 5HE2A 1P6SA 5J3QA 5HE3A 4WVFB 2CY5A 5FI0A 4CHMA 1FGZA 1XKEA 4KVGB 2R0DA 3RCPA 3F0WA 2VKIA 1ZVRA 1DROA 2LULA 1X11A 4HAUB 1EGXA 5LONB 1U5FA 4HB2B 2YVCA 2DYNA 2ELBA 4CYEA 4TYZA 2RGNB 2P0DA 2UVMA 2V76A 2XQNM 1QQGA 3IVFA 2Z0QA 3TFMA 3UZTA 1AQCA 4A6KA 1SGHA 3A8PA 3ULBA 1EAZA 3BINA 2ADZA 4MY6A 4A6FB 1I2HA 2Q13A 1FAOA 1UNRA 4DX8A 4A5KA 3QBVB 3FEHA 1OMWA 1ZSQA 4A6HA 1BWNA 3HW2B 1DDWA 1K5GB 3CXBB 2H7DA 2CAYA 3VIAA 3ML4A 1P5TA 5DHAB 4ZRKA 1ZM0A 3AU5A 3LJUX 4L6EA 4K2PA 1V61A 1P3RA 1PLSA 2N0YA 4Z2NA 4YL8A 2UZSA 2KUPA 4K81A 5C16A 1B55A 1N3HA 4DBBA 2I5CA 1ZC4B 2RNRB 1WG7A 1KZGA 5GOWB 1J0WA 3DXCA 2KCJA 2I5FA 1MAIA 2DHKA 5LOPB 5C5BA 1FHXA 4ZRIA 3T06A 4MK0A 1TQZA 4K2OA 4F7GA 2YRYA 3TCAA 3TO1A 1E5WA 1Y19B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MK7 B;  1IRS A;  1DDV A;  1W1D A;  1Q67 A;  5D3V A;  5HE1 A;  1PFJ A;  5KCV A;  4NSW A;  1ZC3 B;  3G9W A;  4Y94 A;  2J0J A;  5HE0 A;  1KZ7 A;  1X1F A;  4GZU A;  3DXD A;  3A98 B;  1TXD A;  5JHG A;  1V5M A;  1W1G A;  4HB4 B;  2IYB A;  3F5R A;  2LYD A;  2MKR A;  2J59 M;  1DDM A;  2Z0P A;  3QIJ A;  3PP2 A;  1X05 A;  2K2J A;  1RRP B;  5C79 A;  4WJ7 A;  2DKQ A;  2G35 A;  2GCJ A;  3KSY A;  4C0A A;  1DYN A;  3KY9 A;  1V5U A;  4KAX B;  1XR0 B;  2VRW B;  2HE7 A;  4IOY X;  1WGU A;  2D9Z A;  4GN1 A;  4EKU A;  4GXB A;  2COD A;  1PMS A;  2YSZ A;  2BCJ A;  2P8V A;  3D8D A;  2QKM A;  1UPR A;  1OY2 A;  2HTH B;  2DX5 A;  3KRX A;  4HAV B;  1RJ2 A;  2H7E A;  2YT0 A;  1U5D A;  5D3X A;  3GYP A;  2P0F A;  4EJN A;  3SNH A;  4K17 A;  2J0M A;  1EVH A;  2W2X C;  1H10 A;  5L81 A;  2D10 A;  1TJ6 A;  1XCG A;  3ODX A;  4HHV A;  3HQC A;  3V5W A;  2W2W A;  5DH9 B;  2UZR A;  5D27 A;  2JP2 A;  1U27 A;  4KHA A;  5KQ1 A;  1EF1 A;  4KHO A;  1LW3 A;  2X18 A;  1FHW A;  2M14 A;  2N23 A;  1UNQ A;  2OTX A;  1BTN A;  1FOE A;  3SV1 A;  2L2I A;  3PG7 A;  2GCL A;  5D3Y A;  3AJ4 A;  1K5D B;  1DBH A;  4ZRJ A;  1GC7 A;  2E2X A;  3CIK A;  1GG3 A;  2M38 A;  4IFS A;  3TVV A;  3ZVR A;  5C6R A;  5J3Y A;  4HAZ B;  1U5G A;  3VOQ A;  4HDO A;  4TKN A;  4KHB B;  4HAW B;  1J19 A;  4A6F A;  1XX0 A;  3FSS A;  5JLJ B;  2CRF A;  3SO6 A;  1MK9 B;  4XWX A;  1U5E A;  4NY0 A;  2ROZ B;  3P7Z A;  4MT7 A;  2KGX B;  1BAK A;  2RVB B;  2LG1 A;  2Z0O A;  5EFX A;  4PNK A;  2ELA A;  2EMT A;  2Y8F A;  1M7E A;  1V89 A;  3U8Z A;  2MWN B;  1W1H A;  1Z87 A;  4DXA B;  2D9V A;  1SHC A;  1X86 A;  2GJY A;  3MPX A;  4F7U P;  1WJM A;  1V5P A;  5DI9 B;  3A8Q A;  5D3W A;  3BJI A;  1H4R A;  3PSC A;  2DX1 A;  1U29 A;  1FB8 A;  2YS5 A;  3SYX A;  1NTV A;  4HAX B;  3SUZ A;  4GPT B;  3OAN A;  2I1K A;  3D8F A;  4GMX B;  1X1G A;  2DN6 A;  1UNP A;  2DKP A;  4WSF A;  2D9W A;  2DFK A;  2DTC A;  2NZ8 B;  2K2U A;  2YF0 A;  4PQ0 A;  1WI1 A;  3N7C A;  3DXE A;  1FGY A;  4P7I A;  5CLQ B;  1WVH A;  2R09 A;  3WYF B;  2AL6 A;  5DHF B;  2EJ8 A;  1KI1 B;  4Z2M B;  2AEH A;  5C5B B;  3ULC A;  2D4Q A;  2COA A;  2MFQ A;  4IAP A;  1U2B A;  2DHJ A;  2RLO A;  2Y7B A;  3MDB C;  3QWM A;  2J0K A;  2RSG A;  4EMO A;  1QC6 A;  2FJL A;  4GMV A;  3PEG A;  2Y8G A;  5CLL B;  4HDQ A;  2LOX A;  5JHH A;  1M7R A;  2OQB A;  2L1C A;  2QKL A;  2D9Y A;  2D11 A;  2GS0 A;  2DHI A;  2MDX A;  4HB3 B;  2I1J A;  1XOD A;  1WJ1 A;  3AU4 A;  2D9X A;  4DX9 0;  3GYO A;  5KQ4 A;  4D0N B;  1ISN A;  3PZD A;  1FHO A;  3KRW A;  2EC1 A;  1AWE A;  2CY4 A;  1XD4 A;  4YON A;  1MIZ B;  2COF A;  3PVL A;  3X23 A;  3NSU A;  4B6H A;  2DA0 A;  2LKO A;  4HAT B;  3U7D A;  1LB1 A;  5JP4 A;  3WA0 A;  3M1I B;  2VSZ A;  3ZDT A;  1NTY A;  1GC6 A;  1BTK A;  2EMS A;  3P6A A;  3TW1 A;  3ODO A;  3FM8 C;  1V88 A;  3D8E A;  5J3T A;  1UPQ A;  4H8S A;  2P0H A;  1MKE A;  4CHJ A;  2YT1 A;  2DYQ A;  3ODW A;  4HB0 B;  2COC A;  2PZ1 A;  2W2X D;  2RUK B;  1NU2 A;  3O96 A;  2IFS A;  2D2Q A;  1MPH A;  2YS3 A;  1MIX A;  2ZPY A;  2LOZ A;  1UEF A;  1Y5O A;  4BBK A;  5FI1 A;  2NMB A;  2YS1 A;  1WGQ A;  2K00 A;  3PVW A;  1I7A A;  1NI2 A;  3HK0 A;  3KZ1 A;  5DIF B;  2DLW A;  2ROV A;  1OQN A;  3PVU A;  4HAY B;  4F7H A;  5HE2 A;  1P6S A;  5J3Q A;  5HE3 A;  4WVF B;  2CY5 A;  5FI0 A;  4CHM A;  1FGZ A;  1XKE A;  4KVG B;  2R0D A;  3RCP A;  3F0W A;  2VKI A;  1ZVR A;  1DRO A;  2LUL A;  1X11 A;  4HAU B;  1EGX A;  5LON B;  1U5F A;  4HB2 B;  2YVC A;  2DYN A;  2ELB A;  4CYE A;  4TYZ A;  2RGN B;  2P0D A;  2UVM A;  2V76 A;  2XQN M;  1QQG A;  3IVF A;  2Z0Q A;  3TFM A;  3UZT A;  1AQC A;  4A6K A;  1SGH A;  3A8P A;  3ULB A;  1EAZ A;  3BIN A;  2ADZ A;  4MY6 A;  4A6F B;  1I2H A;  2Q13 A;  1FAO A;  1UNR A;  4DX8 A;  4A5K A;  3QBV B;  3FEH A;  1OMW A;  1ZSQ A;  4A6H A;  1BWN A;  3HW2 B;  1DDW A;  1K5G B;  3CXB B;  2H7D A;  2CAY A;  3VIA A;  3ML4 A;  1P5T A;  5DHA B;  4ZRK A;  1ZM0 A;  3AU5 A;  3LJU X;  4L6E A;  4K2P A;  1V61 A;  1P3R A;  1PLS A;  2N0Y A;  4Z2N A;  4YL8 A;  2UZS A;  2KUP A;  4K81 A;  5C16 A;  1B55 A;  1N3H A;  4DBB A;  2I5C A;  1ZC4 B;  2RNR B;  1WG7 A;  1KZG A;  5GOW B;  1J0W A;  3DXC A;  2KCJ A;  2I5F A;  1MAI A;  2DHK A;  5LOP B;  5C5B A;  1FHX A;  4ZRI A;  3T06 A;  4MK0 A;  1TQZ A;  4K2O A;  4F7G A;  2YRY A;  3TCA A;  3TO1 A;  1E5W A;  1Y19 B; 
#chains in the Genus database with same CATH topology
 2R2Y A;  1MK7 B;  1IRS A;  1DDV A;  1W1D A;  1Q67 A;  5D3V A;  5HE1 A;  3A58 A;  1PFJ A;  5KCV A;  4NSW A;  1ZC3 B;  3G9W A;  4Y94 A;  2J0J A;  5HE0 A;  2Z4D A;  1KZ7 A;  1X1F A;  4GZU A;  3DXD A;  3A98 B;  1TXD A;  5JHG A;  1V5M A;  1W1G A;  4GNK B;  4QJ5 B;  4HB4 B;  2IYB A;  3F5R A;  2LYD A;  3NWF A;  2MKR A;  2J59 M;  1DDM A;  2Z0P A;  3QIJ A;  2Z59 A;  3PP2 A;  4D6W A;  1X05 A;  2K2J A;  1RRP B;  5C79 A;  3HSA A;  4WJ7 A;  2DKQ A;  2G35 A;  2GCJ A;  3KSY A;  4C0A A;  1DYN A;  3KY9 A;  1V5U A;  4KAX B;  1XR0 B;  2VRW B;  2HE7 A;  4IOY X;  1WGU A;  2D9Z A;  4GN1 A;  4DIX A;  4EKU A;  4GXB A;  2COD A;  1PMS A;  2YSZ A;  2BCJ A;  2K8E A;  2P8V A;  3D8D A;  2QKM A;  2FJU B;  1UPR A;  1OY2 A;  2HTH B;  2DX5 A;  3KRX A;  4HAV B;  2KUQ A;  1RJ2 A;  2H7E A;  5I2M A;  2YT0 A;  1U5D A;  5D3X A;  3GYP A;  2P0F A;  4EJN A;  3SNH A;  4K17 A;  2J0M A;  1EVH A;  2W2X C;  1H10 A;  5L81 A;  2D10 A;  1TJ6 A;  1XCG A;  3ODX A;  4HHV A;  3HQC A;  3V5W A;  2W2W A;  5DH9 B;  2UZR A;  3NWA A;  5D27 A;  2JP2 A;  1U27 A;  4KHA A;  2YT2 A;  5KQ1 A;  1EF1 A;  4KHO A;  1LW3 A;  2X18 A;  1FHW A;  4OT1 A;  2M14 A;  2N23 A;  1UNQ A;  2OTX A;  1BTN A;  1FOE A;  3SV1 A;  2L2I A;  3PG7 A;  2GCL A;  5LG4 B;  5D3Y A;  3AJ4 A;  1K5D B;  1DBH A;  4ZRJ A;  1GC7 A;  2E2X A;  3CIK A;  1GG3 A;  2M38 A;  4IFS A;  3TVV A;  3ZVR A;  5C6R A;  5J3Y A;  4HAZ B;  1U5G A;  3VOQ A;  4HDO A;  4TKN A;  2KR0 A;  2KIG A;  4KHB B;  4HAW B;  1J19 A;  4A6F A;  1XX0 A;  3FSS A;  5JLJ B;  2CRF A;  3SO6 A;  1MK9 B;  4XWX A;  1U5E A;  4NY0 A;  2ROZ B;  3P7Z A;  4MT7 A;  2KGX B;  1BAK A;  2RVB B;  2LG1 A;  2Z0O A;  5EFX A;  5IRS A;  4PNK A;  2ELA A;  2EMT A;  5I2S A;  2Y8F A;  1M7E A;  1V89 A;  3U8Z A;  2MWN B;  1W1H A;  1Z87 A;  4DXA B;  2D9V A;  1SHC A;  1X86 A;  2K49 A;  2GJY A;  3MPX A;  4F7U P;  1WJM A;  1V5P A;  5DI9 B;  3A8Q A;  5D3W A;  3BJI A;  1H4R A;  3PSC A;  2DX1 A;  1U29 A;  1FB8 A;  2YS5 A;  3SYX A;  1NTV A;  4HAX B;  2ZKM X;  3SUZ A;  3U12 A;  4GPT B;  3OAN A;  2I1K A;  3D8F A;  4GMX B;  1X1G A;  2DN6 A;  1UNP A;  4CSQ A;  2DKP A;  4WSF A;  2D9W A;  2DFK A;  2DTC A;  2NZ8 B;  2K2U A;  2YF0 A;  4PQ0 A;  1WI1 A;  3N7C A;  3DXE A;  1FGY A;  2Z13 A;  4P7I A;  5CLQ B;  1WVH A;  2R09 A;  3WYF B;  2GUM A;  2AL6 A;  5DHF B;  2EJ8 A;  1KI1 B;  4Z2M B;  2AEH A;  5C5B B;  1T77 A;  3ULC A;  2D4Q A;  2COA A;  2MFQ A;  4IAP A;  1U2B A;  2DHJ A;  2RLO A;  2Y7B A;  3MDB C;  3QWM A;  2J0K A;  2RSG A;  4EMO A;  1QC6 A;  2FJL A;  4GMV A;  3DCX A;  3PEG A;  2Y8G A;  5CLL B;  4HDQ A;  2LOX A;  5JHH A;  1M7R A;  2OQB A;  2L1C A;  2QKL A;  2D9Y A;  2D11 A;  2GS0 A;  2DHI A;  2MDX A;  4HB3 B;  2I1J A;  1XOD A;  1WJ1 A;  3AU4 A;  2D9X A;  4DX9 0;  3GYO A;  5KQ4 A;  4D0N B;  1ISN A;  3PZD A;  1FHO A;  3KRW A;  2EC1 A;  1AWE A;  2CY4 A;  1XD4 A;  4YON A;  1MIZ B;  2COF A;  3HIE A;  3PVL A;  3X23 A;  3NSU A;  4B6H A;  2DA0 A;  2LKO A;  4HAT B;  3U7D A;  1LB1 A;  5JP4 A;  3WA0 A;  3M1I B;  4OSN A;  1MI1 A;  2VSZ A;  3ZDT A;  1NTY A;  1GC6 A;  1BTK A;  2EMS A;  3P6A A;  3TW1 A;  4HSI A;  3ODO A;  3FM8 C;  1V88 A;  3D8E A;  5J3T A;  1UPQ A;  4H8S A;  2P0H A;  1MKE A;  4CHJ A;  2YT1 A;  2DYQ A;  3FVC A;  2RRF A;  3ODW A;  4HB0 B;  2COC A;  2PZ1 A;  2W2X D;  2RUK B;  3NWD A;  1NU2 A;  3O96 A;  2IFS A;  2D2Q A;  4L1R A;  1MPH A;  2KIE A;  2YS3 A;  1MIX A;  2ZPY A;  2LOZ A;  1UEF A;  1Y5O A;  4BBK A;  5FI1 A;  3NW8 A;  2NMB A;  2YS1 A;  1WGQ A;  4QJ4 B;  3OHM B;  2K00 A;  3PVW A;  1I7A A;  1NI2 A;  3HK0 A;  3KZ1 A;  5DIF B;  4GOU A;  2DLW A;  2ROV A;  1OQN A;  3PVU A;  4HAY B;  4F7H A;  5HE2 A;  1P6S A;  5J3Q A;  5HE3 A;  4WVF B;  2CY5 A;  5FI0 A;  4CHM A;  1FGZ A;  1XKE A;  4KVG B;  2R0D A;  3RCP A;  3F0W A;  2VKI A;  1ZVR A;  4KHB A;  1DRO A;  2LUL A;  1X11 A;  4HAU B;  1EGX A;  5LON B;  1U5F A;  2NBV A;  4HB2 B;  2YVC A;  2DYN A;  2ELB A;  4CYE A;  1ZYI A;  4TYZ A;  2RGN B;  2P0D A;  2UVM A;  2V76 A;  2XQN M;  1QQG A;  3IVF A;  2Z0Q A;  3TFM A;  3UZT A;  1AQC A;  4A6K A;  1SGH A;  3A8P A;  3ULB A;  3B77 A;  1EAZ A;  3BIN A;  2ADZ A;  4MY6 A;  4A6F B;  1I2H A;  2Q13 A;  1FAO A;  1UNR A;  4DX8 A;  4A5K A;  3QBV B;  3FEH A;  1OMW A;  1ZSQ A;  4A6H A;  1BWN A;  3HW2 B;  1DDW A;  1K5G B;  3CXB B;  2H7D A;  2CAY A;  3VIA A;  3ML4 A;  1P5T A;  5DHA B;  4ZRK A;  1ZM0 A;  3AU5 A;  3LJU X;  4L6E A;  4K2P A;  1V61 A;  1P3R A;  1PLS A;  2N0Y A;  4Z2N A;  4YL8 A;  2UZS A;  2KUP A;  4K81 A;  4QXA B;  5C16 A;  4QJ3 B;  1B55 A;  1N3H A;  4DBB A;  2I5C A;  1ZC4 B;  2RNR B;  1WG7 A;  1KZG A;  5GOW B;  1J0W A;  3DXC A;  2KCJ A;  2Z14 A;  2I5F A;  1MAI A;  2DHK A;  5LOP B;  5C5B A;  1FHX A;  4ZRI A;  3T06 A;  4MK0 A;  1TQZ A;  4K2O A;  4F7G A;  2YRY A;  3TCA A;  3TO1 A;  1E5W A;  1Y19 B;  5M4Y B; 
#chains in the Genus database with same CATH homology
 1MK7 B;  1IRS A;  1DDV A;  1W1D A;  1Q67 A;  5D3V A;  5HE1 A;  1PFJ A;  5KCV A;  4NSW A;  1ZC3 B;  3G9W A;  4Y94 A;  2J0J A;  5HE0 A;  1KZ7 A;  1X1F A;  4GZU A;  3DXD A;  3A98 B;  1TXD A;  5JHG A;  1V5M A;  1W1G A;  4HB4 B;  2IYB A;  3F5R A;  2LYD A;  2MKR A;  2J59 M;  1DDM A;  2Z0P A;  3QIJ A;  3PP2 A;  1X05 A;  2K2J A;  1RRP B;  5C79 A;  4WJ7 A;  2DKQ A;  2G35 A;  2GCJ A;  3KSY A;  4C0A A;  1DYN A;  3KY9 A;  1V5U A;  4KAX B;  1XR0 B;  2VRW B;  2HE7 A;  4IOY X;  1WGU A;  2D9Z A;  4GN1 A;  4EKU A;  4GXB A;  2COD A;  1PMS A;  2YSZ A;  2BCJ A;  2P8V A;  3D8D A;  2QKM A;  1UPR A;  1OY2 A;  2HTH B;  2DX5 A;  3KRX A;  4HAV B;  1RJ2 A;  2H7E A;  2YT0 A;  1U5D A;  5D3X A;  3GYP A;  2P0F A;  4EJN A;  3SNH A;  4K17 A;  2J0M A;  1EVH A;  2W2X C;  1H10 A;  5L81 A;  2D10 A;  1TJ6 A;  1XCG A;  3ODX A;  4HHV A;  3HQC A;  3V5W A;  2W2W A;  5DH9 B;  2UZR A;  5D27 A;  2JP2 A;  1U27 A;  4KHA A;  5KQ1 A;  1EF1 A;  4KHO A;  1LW3 A;  2X18 A;  1FHW A;  2M14 A;  2N23 A;  1UNQ A;  2OTX A;  1BTN A;  1FOE A;  3SV1 A;  2L2I A;  3PG7 A;  2GCL A;  5D3Y A;  3AJ4 A;  1K5D B;  1DBH A;  4ZRJ A;  1GC7 A;  2E2X A;  3CIK A;  1GG3 A;  2M38 A;  4IFS A;  3TVV A;  3ZVR A;  5C6R A;  5J3Y A;  4HAZ B;  1U5G A;  3VOQ A;  4HDO A;  4TKN A;  4KHB B;  4HAW B;  1J19 A;  4A6F A;  1XX0 A;  3FSS A;  5JLJ B;  2CRF A;  3SO6 A;  1MK9 B;  4XWX A;  1U5E A;  4NY0 A;  2ROZ B;  3P7Z A;  4MT7 A;  2KGX B;  1BAK A;  2RVB B;  2LG1 A;  2Z0O A;  5EFX A;  4PNK A;  2ELA A;  2EMT A;  2Y8F A;  1M7E A;  1V89 A;  3U8Z A;  2MWN B;  1W1H A;  1Z87 A;  4DXA B;  2D9V A;  1SHC A;  1X86 A;  2GJY A;  3MPX A;  4F7U P;  1WJM A;  1V5P A;  5DI9 B;  3A8Q A;  5D3W A;  3BJI A;  1H4R A;  3PSC A;  2DX1 A;  1U29 A;  1FB8 A;  2YS5 A;  3SYX A;  1NTV A;  4HAX B;  3SUZ A;  4GPT B;  3OAN A;  2I1K A;  3D8F A;  4GMX B;  1X1G A;  2DN6 A;  1UNP A;  2DKP A;  4WSF A;  2D9W A;  2DFK A;  2DTC A;  2NZ8 B;  2K2U A;  2YF0 A;  4PQ0 A;  1WI1 A;  3N7C A;  3DXE A;  1FGY A;  4P7I A;  5CLQ B;  1WVH A;  2R09 A;  3WYF B;  2AL6 A;  5DHF B;  2EJ8 A;  1KI1 B;  4Z2M B;  2AEH A;  5C5B B;  3ULC A;  2D4Q A;  2COA A;  2MFQ A;  4IAP A;  1U2B A;  2DHJ A;  2RLO A;  2Y7B A;  3MDB C;  3QWM A;  2J0K A;  2RSG A;  4EMO A;  1QC6 A;  2FJL A;  4GMV A;  3PEG A;  2Y8G A;  5CLL B;  4HDQ A;  2LOX A;  5JHH A;  1M7R A;  2OQB A;  2L1C A;  2QKL A;  2D9Y A;  2D11 A;  2GS0 A;  2DHI A;  2MDX A;  4HB3 B;  2I1J A;  1XOD A;  1WJ1 A;  3AU4 A;  2D9X A;  4DX9 0;  3GYO A;  5KQ4 A;  4D0N B;  1ISN A;  3PZD A;  1FHO A;  3KRW A;  2EC1 A;  1AWE A;  2CY4 A;  1XD4 A;  4YON A;  1MIZ B;  2COF A;  3PVL A;  3X23 A;  3NSU A;  4B6H A;  2DA0 A;  2LKO A;  4HAT B;  3U7D A;  1LB1 A;  5JP4 A;  3WA0 A;  3M1I B;  2VSZ A;  3ZDT A;  1NTY A;  1GC6 A;  1BTK A;  2EMS A;  3P6A A;  3TW1 A;  3ODO A;  3FM8 C;  1V88 A;  3D8E A;  5J3T A;  1UPQ A;  4H8S A;  2P0H A;  1MKE A;  4CHJ A;  2YT1 A;  2DYQ A;  3ODW A;  4HB0 B;  2COC A;  2PZ1 A;  2W2X D;  2RUK B;  1NU2 A;  3O96 A;  2IFS A;  2D2Q A;  1MPH A;  2YS3 A;  1MIX A;  2ZPY A;  2LOZ A;  1UEF A;  1Y5O A;  4BBK A;  5FI1 A;  2NMB A;  2YS1 A;  1WGQ A;  2K00 A;  3PVW A;  1I7A A;  1NI2 A;  3HK0 A;  3KZ1 A;  5DIF B;  2DLW A;  2ROV A;  1OQN A;  3PVU A;  4HAY B;  4F7H A;  5HE2 A;  1P6S A;  5J3Q A;  5HE3 A;  4WVF B;  2CY5 A;  5FI0 A;  4CHM A;  1FGZ A;  1XKE A;  4KVG B;  2R0D A;  3RCP A;  3F0W A;  2VKI A;  1ZVR A;  1DRO A;  2LUL A;  1X11 A;  4HAU B;  1EGX A;  5LON B;  1U5F A;  4HB2 B;  2YVC A;  2DYN A;  2ELB A;  4CYE A;  4TYZ A;  2RGN B;  2P0D A;  2UVM A;  2V76 A;  2XQN M;  1QQG A;  3IVF A;  2Z0Q A;  3TFM A;  3UZT A;  1AQC A;  4A6K A;  1SGH A;  3A8P A;  3ULB A;  1EAZ A;  3BIN A;  2ADZ A;  4MY6 A;  4A6F B;  1I2H A;  2Q13 A;  1FAO A;  1UNR A;  4DX8 A;  4A5K A;  3QBV B;  3FEH A;  1OMW A;  1ZSQ A;  4A6H A;  1BWN A;  3HW2 B;  1DDW A;  1K5G B;  3CXB B;  2H7D A;  2CAY A;  3VIA A;  3ML4 A;  1P5T A;  5DHA B;  4ZRK A;  1ZM0 A;  3AU5 A;  3LJU X;  4L6E A;  4K2P A;  1V61 A;  1P3R A;  1PLS A;  2N0Y A;  4Z2N A;  4YL8 A;  2UZS A;  2KUP A;  4K81 A;  5C16 A;  1B55 A;  1N3H A;  4DBB A;  2I5C A;  1ZC4 B;  2RNR B;  1WG7 A;  1KZG A;  5GOW B;  1J0W A;  3DXC A;  2KCJ A;  2I5F A;  1MAI A;  2DHK A;  5LOP B;  5C5B A;  1FHX A;  4ZRI A;  3T06 A;  4MK0 A;  1TQZ A;  4K2O A;  4F7G A;  2YRY A;  3TCA A;  3TO1 A;  1E5W A;  1Y19 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...