3HW2B

Crystal structure of the sifa-skip(ph) complex
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
105
structure length
105
Chain Sequence
TITKEGMLHYKAGTSYLGKEHWKTCFVVLSNGILYQYPDRTDVIPLLSVNMGGEQCGGCRRANTTDRPHAFQVILSDRPCLELSAESEAEMAEWMQHLCQAVSKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Interaction between the SifA virulence factor and its host target skip is essential for salmonella pathogenesis
pubmed doi rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium
molecule tags Signaling protein
molecule keywords Protein sifA
total genus 16
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2009-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3hw2B00
4PQ0A 4KAXB 4MY6A 2YF0A 2LYDA 1FGYA 3ULBA 1IRSA 2ELAA 1E5WA 1NTYA 1MPHA 3SUZA 2MKRA 1WG7A 1XCGA 4HAXB 4BBKA 1UNRA 2AEHA 1DBHA 2D9YA 3IVFA 2DHIA 2DHKA 1U5EA 4HAUB 4GMXB 2H7DA 4C0AA 1U27A 3ODXA 2ROZB 2RLOA 4GPTB 1NU2A 1TJ6A 3RCPA 1K5DB 2MWNB 3SYXA 4CYEA 5D3XA 1DYNA 3AU4A 5KQ4A 2RVBB 2ROVA 2L2IA 2RGNB 5FI0A 2GJYA 1MIZB 3N7CA 1ISNA 2OTXA 1PLSA 1QQGA 1U29A 1GC6A 4HAVB 1LW3A 4CHJA 5DIFB 2M38A 2H7EA 2COCA 2QKLA 1UNPA 4KVGB 3KSYA 2GCJA 3HQCA 4L6EA 3PEGA 1EGXA 2CODA 2DYNA 2DA0A 2ELBA 4TKNA 1J0WA 2DLWA 2DX1A 4HB3B 3BINA 3T06A 4ZRJA 1V5MA 3FEHA 4HDQA 3SO6A 5JHGA 5CLQB 3PVUA 3TFMA 3D8EA 3WA0A 3TCAA 2YT0A 2Z0QA 3FSSA 1MK9B 4GN1A 3A98B 1K5GB 1FHWA 1FHXA 1FOEA 1H10A 1OMWA 2MDXA 1W1HA 5HE2A 4HB4B 1N3HA 4GMVA 3PZDA 3QIJA 2R0DA 4K2PA 3P7ZA 2Z0PA 1P6SA 1WI1A 2NZ8B 1BWNA 4Z2NA 5C6RA 3U8ZA 2GS0A 2CAYA 2DFKA 4HAZB 5HE1A 2K2JA 5D3VA 2MFQA 2K00A 2M14A 5D27A 1DDWA 3X23A 5DHAB 3P6AA 1KI1B 1GC7A 2W2XD 3QWMA 1UNQA 2Y8GA 4HB0B 5HE3A 1P3RA 2LOZA 1OY2A 5L81A 1MK7B 1AWEA 1BTNA 4HDOA 4K17A 5JLJB 1LB1A 2LOXA 2P8VA 1Y19B 2KUPA 2KCJA 2Y8FA 2DN6A 1I2HA 4F7UP 3PG7A 1V61A 4D0NB 1DDVA 3M1IB 3F0WA 1QC6A 3TVVA 2OQBA 2DYQA 5C79A 2D9VA 2V76A 2RNRB 2QKMA 3AU5A 1U5DA 4WSFA 5FI1A 2W2WA 1FGZA 5EFXA 3TW1A 5D3WA 2UVMA 1SHCA 4B6HA 2AL6A 4F7GA 2DHJA 4IAPA 3G9WA 5J3YA 2LKOA 4A6FA 5GOWB 5KQ1A 1W1GA 3KRWA 1XODA 3NSUA 4KHAA 3A8QA 3HW2B 1I7AA 1XX0A 1V89A 5C5BB 2KGXB 1X11A 5J3QA 1MIXA 3PVLA 4NSWA 2D9ZA 2YS1A 3ML4A 1DDMA 4EKUA 1WGUA 1FAOA 3PVWA 3WYFB 4DX90 2CY4A 5KCVA 4HAWB 1ZC4B 2CY5A 2DKQA 1AQCA 4A6HA 3CXBB 1XR0B 1X1GA 2YVCA 4WVFB 3UZTA 4TYZA 1U2BA 1RJ2A 2I1KA 1M7RA 2BCJA 2RUKB 4MT7A 3KZ1A 3PSCA 2D10A 3O96A 1V5PA 3F5RA 1TXDA 3HK0A 5HE0A 2VKIA 2JP2A 2IYBA 4HAYB 4NY0A 4DXAB 2ZPYA 2D9WA 3OANA 1WJMA 3FM8C 2UZSA 5D3YA 1NI2A 1MKEA 1H4RA 1NTVA 2L1CA 2I5FA 1EAZA 3KRXA 4A5KA 1WJ1A 5J3TA 1KZGA 4DX8A 4P7IA 2D9XA 2N23A 4CHMA 2CRFA 1KZ7A 4PNKA 3AJ4A 3ULCA 4A6KA 1ZSQA 1UEFA 4Y94A 4K2OA 3D8DA 2E2XA 1EF1A 4EMOA 3V5WA 4YONA 2YRYA 1OQNA 3VOQA 2VRWB 1PMSA 3DXDA 4ZRKA 5DH9B 2D2QA 2YT1A 1V88A 4YL8A 1WGQA 1ZM0A 2HTHB 1M7EA 3KY9A 4KHOA 2NMBA 2J0MA 2PZ1A 2IFSA 1B55A 2LULA 2I5CA 3CIKA 3TO1A 3ZDTA 2DTCA 4GZUA 1J19A 4WJ7A 1FB8A 3ODOA 2D11A 4A6FB 2DKPA 4H8SA 2EMSA 2FJLA 2J59M 3BJIA 3SV1A 1PFJA 5LOPB 3PP2A 1MAIA 4IFSA 1FHOA 3QBVB 2X18A 3SNHA 1U5FA 2G35A 2EC1A 2XQNM 3VIAA 2EMTA 5C5BA 3ZVRA 5DHFB 5JHHA 2P0HA 1XKEA 1W1DA 2N0YA 4EJNA 2YS3A 2LG1A 1WVHA 5LONB 2HE7A 4HATB 2YSZA 4Z2MB 3GYPA 1TQZA 3D8FA 2COFA 2ADZA 2D4QA 2RSGA 4HB2B 1ZC3B 1EVHA 5DI9B 2Q13A 3MDBC 1Q67A 3LJUX 3A8PA 1BTKA 2I1JA 4GXBA 4K81A 2DX5A 5JP4A 4KHBB 2COAA 1X05A 2K2UA 4ZRIA 4HHVA 1UPRA 4DBBA 3DXCA 1P5TA 1Y5OA 1BAKA 1Z87A 1RRPB 2J0KA 2R09A 2Z0OA 4IOYX 4XWXA 1SGHA 3U7DA 2Y7BA 5CLLB 1X86A 1UPQA 3DXEA 1DROA 1XD4A 3GYOA 2YS5A 2EJ8A 5C16A 3MPXA 1X1FA 2P0DA 4MK0A 1GG3A 1V5UA 2VSZA 2J0JA 2GCLA 2P0FA 1ZVRA 2W2XC 3ODWA 4F7HA 2UZRA 1U5GA
chains in the Genus database with same CATH superfamily
4PQ0A 4KAXB 4MY6A 2YF0A 2LYDA 1FGYA 3ULBA 1IRSA 2ELAA 1E5WA 1NTYA 1MPHA 3SUZA 2MKRA 4DIXA 1WG7A 1XCGA 4HAXB 4BBKA 1UNRA 2AEHA 1DBHA 2D9YA 2GUMA 3IVFA 2DHIA 2DHKA 2K8EA 1U5EA 4HAUB 4GMXB 2H7DA 4C0AA 1U27A 3ODXA 2ROZB 2RLOA 4GPTB 1NU2A 1TJ6A 3RCPA 1K5DB 2MWNB 3SYXA 4CYEA 5D3XA 1DYNA 3AU4A 5KQ4A 2RVBB 2ROVA 2L2IA 2RGNB 5FI0A 2GJYA 1MIZB 3N7CA 1ISNA 2OTXA 1PLSA 1QQGA 1U29A 1GC6A 4HAVB 1LW3A 4CHJA 5DIFB 2M38A 2H7EA 2COCA 2QKLA 1UNPA 4KVGB 3KSYA 2GCJA 3HQCA 4L6EA 3PEGA 1EGXA 2CODA 2DYNA 2DA0A 2ELBA 4TKNA 1J0WA 2DLWA 2DX1A 4HB3B 3BINA 3T06A 4ZRJA 1V5MA 3B77A 3FEHA 4HDQA 5I2MA 3SO6A 5JHGA 5CLQB 3PVUA 3TFMA 3D8EA 3WA0A 3TCAA 2YT0A 2Z0QA 3FSSA 1MK9B 4GN1A 3A98B 1K5GB 1FHWA 1FHXA 2KUQA 1FOEA 1H10A 1OMWA 2MDXA 1W1HA 5HE2A 2FJUB 1N3HA 4HB4B 4GMVA 3PZDA 3QIJA 4KHBA 2R0DA 4K2PA 3P7ZA 2Z0PA 1P6SA 1WI1A 2NZ8B 1BWNA 4Z2NA 5C6RA 3U8ZA 2GS0A 5LG4B 2CAYA 2DFKA 4HAZB 5HE1A 3NW8A 2K2JA 5D3VA 2MFQA 2K00A 2M14A 5D27A 1DDWA 3X23A 5DHAB 3P6AA 1KI1B 1GC7A 2W2XD 3QWMA 1UNQA 2Y8GA 4HB0B 5HE3A 1P3RA 2LOZA 1OY2A 5L81A 1MK7B 3NWAA 1AWEA 2KIGA 1BTNA 4HDOA 4K17A 5JLJB 1LB1A 2LOXA 2P8VA 1Y19B 2Z14A 3NWDA 2KUPA 2KCJA 2Y8FA 2KIEA 2DN6A 4QJ4B 1I2HA 2KR0A 4F7UP 3PG7A 1V61A 4D0NB 1DDVA 3M1IB 3F0WA 1QC6A 3TVVA 5IRSA 2OQBA 2DYQA 5C79A 2D9VA 2V76A 2RNRB 2QKMA 3AU5A 1U5DA 4WSFA 5FI1A 2W2WA 1FGZA 5EFXA 3TW1A 5D3WA 2UVMA 1SHCA 4B6HA 2AL6A 4F7GA 2DHJA 4IAPA 3G9WA 5J3YA 2LKOA 4A6FA 4GOUA 5GOWB 5KQ1A 1W1GA 3KRWA 1XODA 3NSUA 4KHAA 3A8QA 3HW2B 1I7AA 1XX0A 1MI1A 3HSAA 1V89A 5C5BB 2KGXB 1X11A 5J3QA 1MIXA 3PVLA 4NSWA 2D9ZA 2YS1A 3ML4A 1DDMA 4EKUA 4QJ3B 1WGUA 1FAOA 3PVWA 3WYFB 4DX90 2CY4A 5KCVA 4HAWB 1ZC4B 2CY5A 2DKQA 2Z13A 1AQCA 4A6HA 3CXBB 1XR0B 1X1GA 2YVCA 4WVFB 4QXAB 3UZTA 4TYZA 1U2BA 1RJ2A 2I1KA 1M7RA 2BCJA 2RUKB 4MT7A 3KZ1A 3PSCA 2D10A 3O96A 2RRFA 1V5PA 3F5RA 1TXDA 3HK0A 4OSNA 5HE0A 2VKIA 2JP2A 2IYBA 4HAYB 4NY0A 2Z4DA 4DXAB 2ZPYA 2D9WA 3OANA 1WJMA 3FM8C 2UZSA 5D3YA 1NI2A 1MKEA 1H4RA 1NTVA 2L1CA 2I5FA 1EAZA 3KRXA 4A5KA 1WJ1A 2YT2A 5J3TA 1KZGA 1ZYIA 4OT1A 4DX8A 4P7IA 2D9XA 2N23A 4CHMA 4D6WA 2NBVA 2CRFA 1KZ7A 4PNKA 3AJ4A 3ULCA 4A6KA 1ZSQA 1UEFA 4Y94A 4K2OA 3D8DA 2E2XA 1EF1A 4EMOA 3V5WA 4YONA 2YRYA 1OQNA 3VOQA 2VRWB 1PMSA 3DXDA 4ZRKA 5DH9B 2D2QA 2YT1A 1V88A 4YL8A 1WGQA 1ZM0A 2HTHB 2ZKMX 3KY9A 1M7EA 4HSIA 4KHOA 2NMBA 2J0MA 2PZ1A 2IFSA 3OHMB 1B55A 2LULA 2I5CA 3CIKA 3U12A 3TO1A 3ZDTA 2DTCA 4GZUA 1J19A 3A58A 4WJ7A 1FB8A 3DCXA 3ODOA 2D11A 4A6FB 2DKPA 4H8SA 2EMSA 2FJLA 2J59M 3BJIA 3SV1A 1PFJA 5LOPB 3PP2A 1MAIA 4IFSA 3NWFA 1FHOA 3QBVB 5I2SA 2X18A 3SNHA 1U5FA 2G35A 2EC1A 2XQNM 3VIAA 2EMTA 5C5BA 3ZVRA 5DHFB 5M4YB 5JHHA 2P0HA 1XKEA 1W1DA 2N0YA 4EJNA 2YS3A 2LG1A 1WVHA 5LONB 2HE7A 4HATB 2YSZA 4Z2MB 3GYPA 1TQZA 3D8FA 4GNKB 2COFA 2ADZA 2D4QA 2RSGA 4HB2B 1ZC3B 4L1RA 1EVHA 3FVCA 5DI9B 2Q13A 3MDBC 1Q67A 3LJUX 3A8PA 1BTKA 2I1JA 3HIEA 4GXBA 4K81A 2DX5A 5JP4A 4KHBB 2COAA 1X05A 1T77A 2K2UA 4ZRIA 4HHVA 1UPRA 4DBBA 3DXCA 1P5TA 1Y5OA 4QJ5B 1BAKA 1Z87A 1RRPB 2J0KA 2R09A 2Z0OA 4IOYX 4XWXA 1SGHA 3U7DA 2Y7BA 5CLLB 1X86A 1UPQA 3DXEA 1DROA 1XD4A 3GYOA 2YS5A 2EJ8A 4CSQA 5C16A 3MPXA 1X1FA 2P0DA 2Z59A 4MK0A 2K49A 1GG3A 1V5UA 2VSZA 2J0JA 2GCLA 2P0FA 1ZVRA 2R2YA 2W2XC 3ODWA 4F7HA 2UZRA 1U5GA
chains in the Genus database with same CATH topology
4PQ0A 4KAXB 4MY6A 2YF0A 2LYDA 1FGYA 3ULBA 1IRSA 2ELAA 1E5WA 1NTYA 1MPHA 3SUZA 2MKRA 1WG7A 1XCGA 4HAXB 4BBKA 1UNRA 2AEHA 1DBHA 2D9YA 3IVFA 2DHIA 2DHKA 1U5EA 4HAUB 4GMXB 2H7DA 4C0AA 1U27A 3ODXA 2ROZB 2RLOA 4GPTB 1NU2A 1TJ6A 3RCPA 1K5DB 2MWNB 3SYXA 4CYEA 5D3XA 1DYNA 3AU4A 5KQ4A 2RVBB 2ROVA 2L2IA 2RGNB 5FI0A 2GJYA 1MIZB 3N7CA 1ISNA 2OTXA 1PLSA 1QQGA 1U29A 1GC6A 4HAVB 1LW3A 4CHJA 5DIFB 2M38A 2H7EA 2COCA 2QKLA 1UNPA 4KVGB 3KSYA 2GCJA 3HQCA 4L6EA 3PEGA 1EGXA 2CODA 2DYNA 2DA0A 2ELBA 4TKNA 1J0WA 2DLWA 2DX1A 4HB3B 3BINA 3T06A 4ZRJA 1V5MA 3FEHA 4HDQA 3SO6A 5JHGA 5CLQB 3PVUA 3TFMA 3D8EA 3WA0A 3TCAA 2YT0A 2Z0QA 3FSSA 1MK9B 4GN1A 3A98B 1K5GB 1FHWA 1FHXA 1FOEA 1H10A 1OMWA 2MDXA 1W1HA 5HE2A 4HB4B 1N3HA 4GMVA 3PZDA 3QIJA 2R0DA 4K2PA 3P7ZA 2Z0PA 1P6SA 1WI1A 2NZ8B 1BWNA 4Z2NA 5C6RA 3U8ZA 2GS0A 2CAYA 2DFKA 4HAZB 5HE1A 2K2JA 5D3VA 2MFQA 2K00A 2M14A 5D27A 1DDWA 3X23A 5DHAB 3P6AA 1KI1B 1GC7A 2W2XD 3QWMA 1UNQA 2Y8GA 4HB0B 5HE3A 1P3RA 2LOZA 1OY2A 5L81A 1MK7B 1AWEA 1BTNA 4HDOA 4K17A 5JLJB 1LB1A 2LOXA 2P8VA 1Y19B 2KUPA 2KCJA 2Y8FA 2DN6A 1I2HA 4F7UP 3PG7A 1V61A 4D0NB 1DDVA 3M1IB 3F0WA 1QC6A 3TVVA 2OQBA 2DYQA 5C79A 2D9VA 2V76A 2RNRB 2QKMA 3AU5A 1U5DA 4WSFA 5FI1A 2W2WA 1FGZA 5EFXA 3TW1A 5D3WA 2UVMA 1SHCA 4B6HA 2AL6A 4F7GA 2DHJA 4IAPA 3G9WA 5J3YA 2LKOA 4A6FA 5GOWB 5KQ1A 1W1GA 3KRWA 1XODA 3NSUA 4KHAA 3A8QA 3HW2B 1I7AA 1XX0A 1V89A 5C5BB 2KGXB 1X11A 5J3QA 1MIXA 3PVLA 4NSWA 2D9ZA 2YS1A 3ML4A 1DDMA 4EKUA 1WGUA 1FAOA 3PVWA 3WYFB 4DX90 2CY4A 5KCVA 4HAWB 1ZC4B 2CY5A 2DKQA 1AQCA 4A6HA 3CXBB 1XR0B 1X1GA 2YVCA 4WVFB 3UZTA 4TYZA 1U2BA 1RJ2A 2I1KA 1M7RA 2BCJA 2RUKB 4MT7A 3KZ1A 3PSCA 2D10A 3O96A 1V5PA 3F5RA 1TXDA 3HK0A 5HE0A 2VKIA 2JP2A 2IYBA 4HAYB 4NY0A 4DXAB 2ZPYA 2D9WA 3OANA 1WJMA 3FM8C 2UZSA 5D3YA 1NI2A 1MKEA 1H4RA 1NTVA 2L1CA 2I5FA 1EAZA 3KRXA 4A5KA 1WJ1A 5J3TA 1KZGA 4DX8A 4P7IA 2D9XA 2N23A 4CHMA 2CRFA 1KZ7A 4PNKA 3AJ4A 3ULCA 4A6KA 1ZSQA 1UEFA 4Y94A 4K2OA 3D8DA 2E2XA 1EF1A 4EMOA 3V5WA 4YONA 2YRYA 1OQNA 3VOQA 2VRWB 1PMSA 3DXDA 4ZRKA 5DH9B 2D2QA 2YT1A 1V88A 4YL8A 1WGQA 1ZM0A 2HTHB 1M7EA 3KY9A 4KHOA 2NMBA 2J0MA 2PZ1A 2IFSA 1B55A 2LULA 2I5CA 3CIKA 3TO1A 3ZDTA 2DTCA 4GZUA 1J19A 4WJ7A 1FB8A 3ODOA 2D11A 4A6FB 2DKPA 4H8SA 2EMSA 2FJLA 2J59M 3BJIA 3SV1A 1PFJA 5LOPB 3PP2A 1MAIA 4IFSA 1FHOA 3QBVB 2X18A 3SNHA 1U5FA 2G35A 2EC1A 2XQNM 3VIAA 2EMTA 5C5BA 3ZVRA 5DHFB 5JHHA 2P0HA 1XKEA 1W1DA 2N0YA 4EJNA 2YS3A 2LG1A 1WVHA 5LONB 2HE7A 4HATB 2YSZA 4Z2MB 3GYPA 1TQZA 3D8FA 2COFA 2ADZA 2D4QA 2RSGA 4HB2B 1ZC3B 1EVHA 5DI9B 2Q13A 3MDBC 1Q67A 3LJUX 3A8PA 1BTKA 2I1JA 4GXBA 4K81A 2DX5A 5JP4A 4KHBB 2COAA 1X05A 2K2UA 4ZRIA 4HHVA 1UPRA 4DBBA 3DXCA 1P5TA 1Y5OA 1BAKA 1Z87A 1RRPB 2J0KA 2R09A 2Z0OA 4IOYX 4XWXA 1SGHA 3U7DA 2Y7BA 5CLLB 1X86A 1UPQA 3DXEA 1DROA 1XD4A 3GYOA 2YS5A 2EJ8A 5C16A 3MPXA 1X1FA 2P0DA 4MK0A 1GG3A 1V5UA 2VSZA 2J0JA 2GCLA 2P0FA 1ZVRA 2W2XC 3ODWA 4F7HA 2UZRA 1U5GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PQ0 A;  4KAX B;  4MY6 A;  2YF0 A;  2LYD A;  1FGY A;  3ULB A;  1IRS A;  2ELA A;  1E5W A;  1NTY A;  1MPH A;  3SUZ A;  2MKR A;  1WG7 A;  1XCG A;  4HAX B;  4BBK A;  1UNR A;  2AEH A;  1DBH A;  2D9Y A;  3IVF A;  2DHI A;  2DHK A;  1U5E A;  4HAU B;  4GMX B;  2H7D A;  4C0A A;  1U27 A;  3ODX A;  2ROZ B;  2RLO A;  4GPT B;  1NU2 A;  1TJ6 A;  3RCP A;  1K5D B;  2MWN B;  3SYX A;  4CYE A;  5D3X A;  1DYN A;  3AU4 A;  5KQ4 A;  2RVB B;  2ROV A;  2L2I A;  2RGN B;  5FI0 A;  2GJY A;  1MIZ B;  3N7C A;  1ISN A;  2OTX A;  1PLS A;  1QQG A;  1U29 A;  1GC6 A;  4HAV B;  1LW3 A;  4CHJ A;  5DIF B;  2M38 A;  2H7E A;  2COC A;  2QKL A;  1UNP A;  4KVG B;  3KSY A;  2GCJ A;  3HQC A;  4L6E A;  3PEG A;  1EGX A;  2COD A;  2DYN A;  2DA0 A;  2ELB A;  4TKN A;  1J0W A;  2DLW A;  2DX1 A;  4HB3 B;  3BIN A;  3T06 A;  4ZRJ A;  1V5M A;  3FEH A;  4HDQ A;  3SO6 A;  5JHG A;  5CLQ B;  3PVU A;  3TFM A;  3D8E A;  3WA0 A;  3TCA A;  2YT0 A;  2Z0Q A;  3FSS A;  1MK9 B;  4GN1 A;  3A98 B;  1K5G B;  1FHW A;  1FHX A;  1FOE A;  1H10 A;  1OMW A;  2MDX A;  1W1H A;  5HE2 A;  4HB4 B;  1N3H A;  4GMV A;  3PZD A;  3QIJ A;  2R0D A;  4K2P A;  3P7Z A;  2Z0P A;  1P6S A;  1WI1 A;  2NZ8 B;  1BWN A;  4Z2N A;  5C6R A;  3U8Z A;  2GS0 A;  2CAY A;  2DFK A;  4HAZ B;  5HE1 A;  2K2J A;  5D3V A;  2MFQ A;  2K00 A;  2M14 A;  5D27 A;  1DDW A;  3X23 A;  5DHA B;  3P6A A;  1KI1 B;  1GC7 A;  2W2X D;  3QWM A;  1UNQ A;  2Y8G A;  4HB0 B;  5HE3 A;  1P3R A;  2LOZ A;  1OY2 A;  5L81 A;  1MK7 B;  1AWE A;  1BTN A;  4HDO A;  4K17 A;  5JLJ B;  1LB1 A;  2LOX A;  2P8V A;  1Y19 B;  2KUP A;  2KCJ A;  2Y8F A;  2DN6 A;  1I2H A;  4F7U P;  3PG7 A;  1V61 A;  4D0N B;  1DDV A;  3M1I B;  3F0W A;  1QC6 A;  3TVV A;  2OQB A;  2DYQ A;  5C79 A;  2D9V A;  2V76 A;  2RNR B;  2QKM A;  3AU5 A;  1U5D A;  4WSF A;  5FI1 A;  2W2W A;  1FGZ A;  5EFX A;  3TW1 A;  5D3W A;  2UVM A;  1SHC A;  4B6H A;  2AL6 A;  4F7G A;  2DHJ A;  4IAP A;  3G9W A;  5J3Y A;  2LKO A;  4A6F A;  5GOW B;  5KQ1 A;  1W1G A;  3KRW A;  1XOD A;  3NSU A;  4KHA A;  3A8Q A;  3HW2 B;  1I7A A;  1XX0 A;  1V89 A;  5C5B B;  2KGX B;  1X11 A;  5J3Q A;  1MIX A;  3PVL A;  4NSW A;  2D9Z A;  2YS1 A;  3ML4 A;  1DDM A;  4EKU A;  1WGU A;  1FAO A;  3PVW A;  3WYF B;  4DX9 0;  2CY4 A;  5KCV A;  4HAW B;  1ZC4 B;  2CY5 A;  2DKQ A;  1AQC A;  4A6H A;  3CXB B;  1XR0 B;  1X1G A;  2YVC A;  4WVF B;  3UZT A;  4TYZ A;  1U2B A;  1RJ2 A;  2I1K A;  1M7R A;  2BCJ A;  2RUK B;  4MT7 A;  3KZ1 A;  3PSC A;  2D10 A;  3O96 A;  1V5P A;  3F5R A;  1TXD A;  3HK0 A;  5HE0 A;  2VKI A;  2JP2 A;  2IYB A;  4HAY B;  4NY0 A;  4DXA B;  2ZPY A;  2D9W A;  3OAN A;  1WJM A;  3FM8 C;  2UZS A;  5D3Y A;  1NI2 A;  1MKE A;  1H4R A;  1NTV A;  2L1C A;  2I5F A;  1EAZ A;  3KRX A;  4A5K A;  1WJ1 A;  5J3T A;  1KZG A;  4DX8 A;  4P7I A;  2D9X A;  2N23 A;  4CHM A;  2CRF A;  1KZ7 A;  4PNK A;  3AJ4 A;  3ULC A;  4A6K A;  1ZSQ A;  1UEF A;  4Y94 A;  4K2O A;  3D8D A;  2E2X A;  1EF1 A;  4EMO A;  3V5W A;  4YON A;  2YRY A;  1OQN A;  3VOQ A;  2VRW B;  1PMS A;  3DXD A;  4ZRK A;  5DH9 B;  2D2Q A;  2YT1 A;  1V88 A;  4YL8 A;  1WGQ A;  1ZM0 A;  2HTH B;  1M7E A;  3KY9 A;  4KHO A;  2NMB A;  2J0M A;  2PZ1 A;  2IFS A;  1B55 A;  2LUL A;  2I5C A;  3CIK A;  3TO1 A;  3ZDT A;  2DTC A;  4GZU A;  1J19 A;  4WJ7 A;  1FB8 A;  3ODO A;  2D11 A;  4A6F B;  2DKP A;  4H8S A;  2EMS A;  2FJL A;  2J59 M;  3BJI A;  3SV1 A;  1PFJ A;  5LOP B;  3PP2 A;  1MAI A;  4IFS A;  1FHO A;  3QBV B;  2X18 A;  3SNH A;  1U5F A;  2G35 A;  2EC1 A;  2XQN M;  3VIA A;  2EMT A;  5C5B A;  3ZVR A;  5DHF B;  5JHH A;  2P0H A;  1XKE A;  1W1D A;  2N0Y A;  4EJN A;  2YS3 A;  2LG1 A;  1WVH A;  5LON B;  2HE7 A;  4HAT B;  2YSZ A;  4Z2M B;  3GYP A;  1TQZ A;  3D8F A;  2COF A;  2ADZ A;  2D4Q A;  2RSG A;  4HB2 B;  1ZC3 B;  1EVH A;  5DI9 B;  2Q13 A;  3MDB C;  1Q67 A;  3LJU X;  3A8P A;  1BTK A;  2I1J A;  4GXB A;  4K81 A;  2DX5 A;  5JP4 A;  4KHB B;  2COA A;  1X05 A;  2K2U A;  4ZRI A;  4HHV A;  1UPR A;  4DBB A;  3DXC A;  1P5T A;  1Y5O A;  1BAK A;  1Z87 A;  1RRP B;  2J0K A;  2R09 A;  2Z0O A;  4IOY X;  4XWX A;  1SGH A;  3U7D A;  2Y7B A;  5CLL B;  1X86 A;  1UPQ A;  3DXE A;  1DRO A;  1XD4 A;  3GYO A;  2YS5 A;  2EJ8 A;  5C16 A;  3MPX A;  1X1F A;  2P0D A;  4MK0 A;  1GG3 A;  1V5U A;  2VSZ A;  2J0J A;  2GCL A;  2P0F A;  1ZVR A;  2W2X C;  3ODW A;  4F7H A;  2UZR A;  1U5G A; 
#chains in the Genus database with same CATH topology
 4PQ0 A;  4KAX B;  4MY6 A;  2YF0 A;  2LYD A;  1FGY A;  3ULB A;  1IRS A;  2ELA A;  1E5W A;  1NTY A;  1MPH A;  3SUZ A;  2MKR A;  4DIX A;  1WG7 A;  1XCG A;  4HAX B;  4BBK A;  1UNR A;  2AEH A;  1DBH A;  2D9Y A;  2GUM A;  3IVF A;  2DHI A;  2DHK A;  2K8E A;  1U5E A;  4HAU B;  4GMX B;  2H7D A;  4C0A A;  1U27 A;  3ODX A;  2ROZ B;  2RLO A;  4GPT B;  1NU2 A;  1TJ6 A;  3RCP A;  1K5D B;  2MWN B;  3SYX A;  4CYE A;  5D3X A;  1DYN A;  3AU4 A;  5KQ4 A;  2RVB B;  2ROV A;  2L2I A;  2RGN B;  5FI0 A;  2GJY A;  1MIZ B;  3N7C A;  1ISN A;  2OTX A;  1PLS A;  1QQG A;  1U29 A;  1GC6 A;  4HAV B;  1LW3 A;  4CHJ A;  5DIF B;  2M38 A;  2H7E A;  2COC A;  2QKL A;  1UNP A;  4KVG B;  3KSY A;  2GCJ A;  3HQC A;  4L6E A;  3PEG A;  1EGX A;  2COD A;  2DYN A;  2DA0 A;  2ELB A;  4TKN A;  1J0W A;  2DLW A;  2DX1 A;  4HB3 B;  3BIN A;  3T06 A;  4ZRJ A;  1V5M A;  3B77 A;  3FEH A;  4HDQ A;  5I2M A;  3SO6 A;  5JHG A;  5CLQ B;  3PVU A;  3TFM A;  3D8E A;  3WA0 A;  3TCA A;  2YT0 A;  2Z0Q A;  3FSS A;  1MK9 B;  4GN1 A;  3A98 B;  1K5G B;  1FHW A;  1FHX A;  2KUQ A;  1FOE A;  1H10 A;  1OMW A;  2MDX A;  1W1H A;  5HE2 A;  2FJU B;  1N3H A;  4HB4 B;  4GMV A;  3PZD A;  3QIJ A;  4KHB A;  2R0D A;  4K2P A;  3P7Z A;  2Z0P A;  1P6S A;  1WI1 A;  2NZ8 B;  1BWN A;  4Z2N A;  5C6R A;  3U8Z A;  2GS0 A;  5LG4 B;  2CAY A;  2DFK A;  4HAZ B;  5HE1 A;  3NW8 A;  2K2J A;  5D3V A;  2MFQ A;  2K00 A;  2M14 A;  5D27 A;  1DDW A;  3X23 A;  5DHA B;  3P6A A;  1KI1 B;  1GC7 A;  2W2X D;  3QWM A;  1UNQ A;  2Y8G A;  4HB0 B;  5HE3 A;  1P3R A;  2LOZ A;  1OY2 A;  5L81 A;  1MK7 B;  3NWA A;  1AWE A;  2KIG A;  1BTN A;  4HDO A;  4K17 A;  5JLJ B;  1LB1 A;  2LOX A;  2P8V A;  1Y19 B;  2Z14 A;  3NWD A;  2KUP A;  2KCJ A;  2Y8F A;  2KIE A;  2DN6 A;  4QJ4 B;  1I2H A;  2KR0 A;  4F7U P;  3PG7 A;  1V61 A;  4D0N B;  1DDV A;  3M1I B;  3F0W A;  1QC6 A;  3TVV A;  5IRS A;  2OQB A;  2DYQ A;  5C79 A;  2D9V A;  2V76 A;  2RNR B;  2QKM A;  3AU5 A;  1U5D A;  4WSF A;  5FI1 A;  2W2W A;  1FGZ A;  5EFX A;  3TW1 A;  5D3W A;  2UVM A;  1SHC A;  4B6H A;  2AL6 A;  4F7G A;  2DHJ A;  4IAP A;  3G9W A;  5J3Y A;  2LKO A;  4A6F A;  4GOU A;  5GOW B;  5KQ1 A;  1W1G A;  3KRW A;  1XOD A;  3NSU A;  4KHA A;  3A8Q A;  3HW2 B;  1I7A A;  1XX0 A;  1MI1 A;  3HSA A;  1V89 A;  5C5B B;  2KGX B;  1X11 A;  5J3Q A;  1MIX A;  3PVL A;  4NSW A;  2D9Z A;  2YS1 A;  3ML4 A;  1DDM A;  4EKU A;  4QJ3 B;  1WGU A;  1FAO A;  3PVW A;  3WYF B;  4DX9 0;  2CY4 A;  5KCV A;  4HAW B;  1ZC4 B;  2CY5 A;  2DKQ A;  2Z13 A;  1AQC A;  4A6H A;  3CXB B;  1XR0 B;  1X1G A;  2YVC A;  4WVF B;  4QXA B;  3UZT A;  4TYZ A;  1U2B A;  1RJ2 A;  2I1K A;  1M7R A;  2BCJ A;  2RUK B;  4MT7 A;  3KZ1 A;  3PSC A;  2D10 A;  3O96 A;  2RRF A;  1V5P A;  3F5R A;  1TXD A;  3HK0 A;  4OSN A;  5HE0 A;  2VKI A;  2JP2 A;  2IYB A;  4HAY B;  4NY0 A;  2Z4D A;  4DXA B;  2ZPY A;  2D9W A;  3OAN A;  1WJM A;  3FM8 C;  2UZS A;  5D3Y A;  1NI2 A;  1MKE A;  1H4R A;  1NTV A;  2L1C A;  2I5F A;  1EAZ A;  3KRX A;  4A5K A;  1WJ1 A;  2YT2 A;  5J3T A;  1KZG A;  1ZYI A;  4OT1 A;  4DX8 A;  4P7I A;  2D9X A;  2N23 A;  4CHM A;  4D6W A;  2NBV A;  2CRF A;  1KZ7 A;  4PNK A;  3AJ4 A;  3ULC A;  4A6K A;  1ZSQ A;  1UEF A;  4Y94 A;  4K2O A;  3D8D A;  2E2X A;  1EF1 A;  4EMO A;  3V5W A;  4YON A;  2YRY A;  1OQN A;  3VOQ A;  2VRW B;  1PMS A;  3DXD A;  4ZRK A;  5DH9 B;  2D2Q A;  2YT1 A;  1V88 A;  4YL8 A;  1WGQ A;  1ZM0 A;  2HTH B;  2ZKM X;  3KY9 A;  1M7E A;  4HSI A;  4KHO A;  2NMB A;  2J0M A;  2PZ1 A;  2IFS A;  3OHM B;  1B55 A;  2LUL A;  2I5C A;  3CIK A;  3U12 A;  3TO1 A;  3ZDT A;  2DTC A;  4GZU A;  1J19 A;  3A58 A;  4WJ7 A;  1FB8 A;  3DCX A;  3ODO A;  2D11 A;  4A6F B;  2DKP A;  4H8S A;  2EMS A;  2FJL A;  2J59 M;  3BJI A;  3SV1 A;  1PFJ A;  5LOP B;  3PP2 A;  1MAI A;  4IFS A;  3NWF A;  1FHO A;  3QBV B;  5I2S A;  2X18 A;  3SNH A;  1U5F A;  2G35 A;  2EC1 A;  2XQN M;  3VIA A;  2EMT A;  5C5B A;  3ZVR A;  5DHF B;  5M4Y B;  5JHH A;  2P0H A;  1XKE A;  1W1D A;  2N0Y A;  4EJN A;  2YS3 A;  2LG1 A;  1WVH A;  5LON B;  2HE7 A;  4HAT B;  2YSZ A;  4Z2M B;  3GYP A;  1TQZ A;  3D8F A;  4GNK B;  2COF A;  2ADZ A;  2D4Q A;  2RSG A;  4HB2 B;  1ZC3 B;  4L1R A;  1EVH A;  3FVC A;  5DI9 B;  2Q13 A;  3MDB C;  1Q67 A;  3LJU X;  3A8P A;  1BTK A;  2I1J A;  3HIE A;  4GXB A;  4K81 A;  2DX5 A;  5JP4 A;  4KHB B;  2COA A;  1X05 A;  1T77 A;  2K2U A;  4ZRI A;  4HHV A;  1UPR A;  4DBB A;  3DXC A;  1P5T A;  1Y5O A;  4QJ5 B;  1BAK A;  1Z87 A;  1RRP B;  2J0K A;  2R09 A;  2Z0O A;  4IOY X;  4XWX A;  1SGH A;  3U7D A;  2Y7B A;  5CLL B;  1X86 A;  1UPQ A;  3DXE A;  1DRO A;  1XD4 A;  3GYO A;  2YS5 A;  2EJ8 A;  4CSQ A;  5C16 A;  3MPX A;  1X1F A;  2P0D A;  2Z59 A;  4MK0 A;  2K49 A;  1GG3 A;  1V5U A;  2VSZ A;  2J0J A;  2GCL A;  2P0F A;  1ZVR A;  2R2Y A;  2W2X C;  3ODW A;  4F7H A;  2UZR A;  1U5G A; 
#chains in the Genus database with same CATH homology
 4PQ0 A;  4KAX B;  4MY6 A;  2YF0 A;  2LYD A;  1FGY A;  3ULB A;  1IRS A;  2ELA A;  1E5W A;  1NTY A;  1MPH A;  3SUZ A;  2MKR A;  1WG7 A;  1XCG A;  4HAX B;  4BBK A;  1UNR A;  2AEH A;  1DBH A;  2D9Y A;  3IVF A;  2DHI A;  2DHK A;  1U5E A;  4HAU B;  4GMX B;  2H7D A;  4C0A A;  1U27 A;  3ODX A;  2ROZ B;  2RLO A;  4GPT B;  1NU2 A;  1TJ6 A;  3RCP A;  1K5D B;  2MWN B;  3SYX A;  4CYE A;  5D3X A;  1DYN A;  3AU4 A;  5KQ4 A;  2RVB B;  2ROV A;  2L2I A;  2RGN B;  5FI0 A;  2GJY A;  1MIZ B;  3N7C A;  1ISN A;  2OTX A;  1PLS A;  1QQG A;  1U29 A;  1GC6 A;  4HAV B;  1LW3 A;  4CHJ A;  5DIF B;  2M38 A;  2H7E A;  2COC A;  2QKL A;  1UNP A;  4KVG B;  3KSY A;  2GCJ A;  3HQC A;  4L6E A;  3PEG A;  1EGX A;  2COD A;  2DYN A;  2DA0 A;  2ELB A;  4TKN A;  1J0W A;  2DLW A;  2DX1 A;  4HB3 B;  3BIN A;  3T06 A;  4ZRJ A;  1V5M A;  3FEH A;  4HDQ A;  3SO6 A;  5JHG A;  5CLQ B;  3PVU A;  3TFM A;  3D8E A;  3WA0 A;  3TCA A;  2YT0 A;  2Z0Q A;  3FSS A;  1MK9 B;  4GN1 A;  3A98 B;  1K5G B;  1FHW A;  1FHX A;  1FOE A;  1H10 A;  1OMW A;  2MDX A;  1W1H A;  5HE2 A;  4HB4 B;  1N3H A;  4GMV A;  3PZD A;  3QIJ A;  2R0D A;  4K2P A;  3P7Z A;  2Z0P A;  1P6S A;  1WI1 A;  2NZ8 B;  1BWN A;  4Z2N A;  5C6R A;  3U8Z A;  2GS0 A;  2CAY A;  2DFK A;  4HAZ B;  5HE1 A;  2K2J A;  5D3V A;  2MFQ A;  2K00 A;  2M14 A;  5D27 A;  1DDW A;  3X23 A;  5DHA B;  3P6A A;  1KI1 B;  1GC7 A;  2W2X D;  3QWM A;  1UNQ A;  2Y8G A;  4HB0 B;  5HE3 A;  1P3R A;  2LOZ A;  1OY2 A;  5L81 A;  1MK7 B;  1AWE A;  1BTN A;  4HDO A;  4K17 A;  5JLJ B;  1LB1 A;  2LOX A;  2P8V A;  1Y19 B;  2KUP A;  2KCJ A;  2Y8F A;  2DN6 A;  1I2H A;  4F7U P;  3PG7 A;  1V61 A;  4D0N B;  1DDV A;  3M1I B;  3F0W A;  1QC6 A;  3TVV A;  2OQB A;  2DYQ A;  5C79 A;  2D9V A;  2V76 A;  2RNR B;  2QKM A;  3AU5 A;  1U5D A;  4WSF A;  5FI1 A;  2W2W A;  1FGZ A;  5EFX A;  3TW1 A;  5D3W A;  2UVM A;  1SHC A;  4B6H A;  2AL6 A;  4F7G A;  2DHJ A;  4IAP A;  3G9W A;  5J3Y A;  2LKO A;  4A6F A;  5GOW B;  5KQ1 A;  1W1G A;  3KRW A;  1XOD A;  3NSU A;  4KHA A;  3A8Q A;  3HW2 B;  1I7A A;  1XX0 A;  1V89 A;  5C5B B;  2KGX B;  1X11 A;  5J3Q A;  1MIX A;  3PVL A;  4NSW A;  2D9Z A;  2YS1 A;  3ML4 A;  1DDM A;  4EKU A;  1WGU A;  1FAO A;  3PVW A;  3WYF B;  4DX9 0;  2CY4 A;  5KCV A;  4HAW B;  1ZC4 B;  2CY5 A;  2DKQ A;  1AQC A;  4A6H A;  3CXB B;  1XR0 B;  1X1G A;  2YVC A;  4WVF B;  3UZT A;  4TYZ A;  1U2B A;  1RJ2 A;  2I1K A;  1M7R A;  2BCJ A;  2RUK B;  4MT7 A;  3KZ1 A;  3PSC A;  2D10 A;  3O96 A;  1V5P A;  3F5R A;  1TXD A;  3HK0 A;  5HE0 A;  2VKI A;  2JP2 A;  2IYB A;  4HAY B;  4NY0 A;  4DXA B;  2ZPY A;  2D9W A;  3OAN A;  1WJM A;  3FM8 C;  2UZS A;  5D3Y A;  1NI2 A;  1MKE A;  1H4R A;  1NTV A;  2L1C A;  2I5F A;  1EAZ A;  3KRX A;  4A5K A;  1WJ1 A;  5J3T A;  1KZG A;  4DX8 A;  4P7I A;  2D9X A;  2N23 A;  4CHM A;  2CRF A;  1KZ7 A;  4PNK A;  3AJ4 A;  3ULC A;  4A6K A;  1ZSQ A;  1UEF A;  4Y94 A;  4K2O A;  3D8D A;  2E2X A;  1EF1 A;  4EMO A;  3V5W A;  4YON A;  2YRY A;  1OQN A;  3VOQ A;  2VRW B;  1PMS A;  3DXD A;  4ZRK A;  5DH9 B;  2D2Q A;  2YT1 A;  1V88 A;  4YL8 A;  1WGQ A;  1ZM0 A;  2HTH B;  1M7E A;  3KY9 A;  4KHO A;  2NMB A;  2J0M A;  2PZ1 A;  2IFS A;  1B55 A;  2LUL A;  2I5C A;  3CIK A;  3TO1 A;  3ZDT A;  2DTC A;  4GZU A;  1J19 A;  4WJ7 A;  1FB8 A;  3ODO A;  2D11 A;  4A6F B;  2DKP A;  4H8S A;  2EMS A;  2FJL A;  2J59 M;  3BJI A;  3SV1 A;  1PFJ A;  5LOP B;  3PP2 A;  1MAI A;  4IFS A;  1FHO A;  3QBV B;  2X18 A;  3SNH A;  1U5F A;  2G35 A;  2EC1 A;  2XQN M;  3VIA A;  2EMT A;  5C5B A;  3ZVR A;  5DHF B;  5JHH A;  2P0H A;  1XKE A;  1W1D A;  2N0Y A;  4EJN A;  2YS3 A;  2LG1 A;  1WVH A;  5LON B;  2HE7 A;  4HAT B;  2YSZ A;  4Z2M B;  3GYP A;  1TQZ A;  3D8F A;  2COF A;  2ADZ A;  2D4Q A;  2RSG A;  4HB2 B;  1ZC3 B;  1EVH A;  5DI9 B;  2Q13 A;  3MDB C;  1Q67 A;  3LJU X;  3A8P A;  1BTK A;  2I1J A;  4GXB A;  4K81 A;  2DX5 A;  5JP4 A;  4KHB B;  2COA A;  1X05 A;  2K2U A;  4ZRI A;  4HHV A;  1UPR A;  4DBB A;  3DXC A;  1P5T A;  1Y5O A;  1BAK A;  1Z87 A;  1RRP B;  2J0K A;  2R09 A;  2Z0O A;  4IOY X;  4XWX A;  1SGH A;  3U7D A;  2Y7B A;  5CLL B;  1X86 A;  1UPQ A;  3DXE A;  1DRO A;  1XD4 A;  3GYO A;  2YS5 A;  2EJ8 A;  5C16 A;  3MPX A;  1X1F A;  2P0D A;  4MK0 A;  1GG3 A;  1V5U A;  2VSZ A;  2J0J A;  2GCL A;  2P0F A;  1ZVR A;  2W2X C;  3ODW A;  4F7H A;  2UZR A;  1U5G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...