3HW2B

Crystal structure of the sifa-skip(ph) complex
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
105
structure length
105
Chain Sequence
TITKEGMLHYKAGTSYLGKEHWKTCFVVLSNGILYQYPDRTDVIPLLSVNMGGEQCGGCRRANTTDRPHAFQVILSDRPCLELSAESEAEMAEWMQHLCQAVSKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Protein sifA
publication title Interaction between the SifA virulence factor and its host target skip is essential for salmonella pathogenesis
pubmed doi rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium
molecule tags Signaling protein
total genus 16
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2009-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3hw2B00
1DROA 3AU4A 3N7CA 1LB1A 1DYNA 2QKLA 4EJNA 4PNKA 3ULCA 2YT1A 2ZPYA 2MKRA 1DDMA 1MK9B 2EMSA 4IOYX 1SHCA 2YS3A 3DXCA 3FM8C 1LW3A 3CIKA 3PVUA 2UVMA 3F5RA 2D9ZA 3VOQA 2H7EA 3UZTA 4K81A 2KUPA 2LOZA 2D2QA 1U5FA 4TYZA 1WJMA 4NSWA 1K5DB 2CY5A 5D3YA 1UNQA 5D3WA 1BAKA 1TQZA 2PZ1A 1WGUA 3PG7A 2ROZB 3A8QA 5D27A 3AU5A 2CRFA 5DH9B 3SNHA 2KGXB 2FJLA 2L2IA 3ULBA 1MPHA 2J0JA 2GCLA 2RNRB 3VIAA 2MFQA 2LYDA 4GMXB 3X23A 1AWEA 4YL8A 1P6SA 3KRXA 1WVHA 2YVCA 2W2WA 4DX90 5LOPB 4XWXA 2N0YA 2RSGA 1P5TA 4F7UP 1IRSA 2DN6A 5JP4A 1WJ1A 4HAZB 3D8DA 3BJIA 4GPTB 1M7EA 1V5MA 2DKQA 2AEHA 1V5UA 1BWNA 5KQ1A 1GC6A 3SV1A 1U27A 2DYQA 3RCPA 2E2XA 1XODA 3HW2B 2G35A 1Y5OA 3QBVB 4Z2NA 4MK0A 2N23A 3FSSA 4IFSA 1U5EA 2GS0A 2MDXA 2LOXA 1FHXA 2Q13A 4F7HA 1AQCA 4KHAA 1NTYA 1E5WA 2EJ8A 2LG1A 2IYBA 1ISNA 2L1CA 3A98B 1I2HA 4NY0A 1DBHA 2R0DA 1X1GA 1FB8A 2DFKA 4D0NB 2UZRA 3SYXA 3ODWA 5EFXA 3MDBC 3KRWA 3PZDA 3KY9A 1TJ6A 3U8ZA 2K00A 2CAYA 1H10A 2COAA 2MWNB 4WVFB 2KCJA 2V76A 5C5BB 1P3RA 1RJ2A 1J19A 1XR0B 3DXEA 2COCA 1X05A 3ML4A 3SO6A 1J0WA 3SUZA 5L81A 2RGNB 5FI1A 4Y94A 3NSUA 3PP2A 2UZSA 2J0MA 2VKIA 2DKPA 4K2PA 1WI1A 1ZC3B 2D10A 1TXDA 1FOEA 2DTCA 4YONA 3WYFB 2D9XA 4HATB 3TCAA 1Y19B 4EKUA 2EMTA 1U29A 5D3XA 1PFJA 1V89A 2P8VA 4HB4B 3HQCA 2VRWB 3D8EA 2D9VA 2K2JA 2I1KA 2QKMA 3U7DA 2VSZA 1X86A 5D3VA 4ZRIA 1GG3A 1X1FA 3GYPA 1UNPA 5HE1A 2M38A 3MPXA 2YS1A 1H4RA 5DHFB 1NU2A 4C0AA 5HE2A 4BBKA 1UNRA 4WSFA 1UEFA 5FI0A 5HE3A 1WGQA 3T06A 4MT7A 4KHBB 4GXBA 1NI2A 3IVFA 4HB0B 4K17A 2P0FA 2YF0A 4Z2MB 2OQBA 3KZ1A 4CHMA 2I1JA 4HAWB 3WA0A 3PVLA 2HTHB 1BTKA 1M7RA 2ADZA 3DXDA 2D9YA 2DX1A 4HB2B 5J3TA 2ELAA 2Y8FA 3P7ZA 1W1DA 2GJYA 2HE7A 2ELBA 3ZVRA 1ZM0A 4DX8A 1UPQA 3ODOA 3G9WA 5LONB 4IAPA 2X18A 2Z0PA 2COFA 4DXAB 2H7DA 4A6HA 1OY2A 3A8PA 5DI9B 1MAIA 3QWMA 1QQGA 2ROVA 3PSCA 2R09A 4K2OA 1RRPB 1XX0A 4ZRKA 3FEHA 1N3HA 4ZRJA 5J3YA 4HHVA 5C6RA 3TVVA 1GC7A 3LJUX 1DDWA 2RVBB 4HAVB 2D4QA 2NMBA 1EAZA 5C5BA 2DX5A 2Z0QA 1OQNA 1ZVRA 3P6AA 4A6FB 5CLLB 1FGYA 1U2BA 1UPRA 4A6FA 2CODA 4A5KA 4EMOA 2YT0A 5JHGA 1U5GA 2EC1A 4GN1A 4GZUA 4F7GA 2DHJA 3O96A 1KZ7A 2LKOA 3M1IB 2K2UA 3AJ4A 2P0HA 1OMWA 2DA0A 2Z0OA 1W1HA 1FAOA 3BINA 4WJ7A 3TFMA 1KZGA 5DIFB 1MK7B 5C16A 2RUKB 3KSYA 4A6KA 2Y8GA 2JP2A 2P0DA 3GYOA 2IFSA 2DHIA 4L6EA 4KHOA 2YSZA 1MIZB 1FHOA 2M14A 4TKNA 1FGZA 5C79A 1NTVA 2YRYA 1XCGA 4MY6A 1DDVA 1EVHA 1EGXA 2W2XD 4CYEA 1B55A 1U5DA 1W1GA 2OTXA 4KAXB 2AL6A 2D9WA 1XKEA 4B6HA 2XQNM 2RLOA 1FHWA 1V5PA 1WG7A 5KCVA 4HB3B 4DBBA 4HAXB 4CHJA 3V5WA 1K5GB 2W2XC 3TO1A 4KVGB 2YS5A 4HAUB 1MIXA 2I5CA 3F0WA 4PQ0A 3TW1A 1XD4A 5CLQB 1V88A 2DHKA 5GOWB 1EF1A 1Z87A 3CXBB 1Q67A 4HAYB 2BCJA 1PLSA 2J59M 3ZDTA 4HDOA 4GMVA 1MKEA 4HDQA 4H8SA 5JHHA 1X11A 5HE0A 2LULA 2I5FA 1QC6A 2DYNA 3HK0A 1KI1B 3OANA 5J3QA 2D11A 1I7AA 5JLJB 1PMSA 3QIJA 1BTNA 3ODXA 1V61A 5KQ4A 2CY4A 1ZSQA 5DHAB 2NZ8B 2J0KA 2GCJA 3D8FA 2DLWA 4P7IA 1ZC4B 3PVWA 2Y7BA 3PEGA 1SGHA
chains in the Genus database with same CATH superfamily
1DROA 3AU4A 3N7CA 1LB1A 1DYNA 2QKLA 4DIXA 4EJNA 4PNKA 3ULCA 2YT1A 2R2YA 2ZPYA 2MKRA 1DDMA 1MK9B 2EMSA 4IOYX 1SHCA 2YS3A 3DXCA 3FM8C 1LW3A 3CIKA 3PVUA 2UVMA 3F5RA 2D9ZA 5I2SA 3VOQA 2H7EA 3UZTA 4K81A 2KUPA 2LOZA 2D2QA 1U5FA 2KIGA 4TYZA 1WJMA 4NSWA 1K5DB 2CY5A 5D3YA 1UNQA 5D3WA 1BAKA 1TQZA 2PZ1A 1WGUA 3PG7A 2ROZB 3A8QA 5D27A 3AU5A 2CRFA 5DH9B 3SNHA 2KGXB 2FJLA 2L2IA 2Z4DA 3ULBA 1MPHA 2J0JA 2GCLA 2RNRB 3FVCA 3VIAA 2MFQA 2LYDA 4GMXB 3X23A 1AWEA 4YL8A 1P6SA 3KRXA 1WVHA 2YVCA 3NWFA 3U12A 2W2WA 3A58A 4DX90 5LOPB 4XWXA 5IRSA 2N0YA 2RSGA 1P5TA 4F7UP 1IRSA 2DN6A 5JP4A 1WJ1A 4HAZB 3D8DA 3BJIA 4GPTB 1M7EA 1V5MA 2DKQA 2AEHA 1V5UA 1BWNA 2YT2A 5KQ1A 1GC6A 3SV1A 1U27A 2DYQA 3RCPA 2E2XA 1XODA 2KUQA 3HW2B 2G35A 5I2MA 1Y5OA 3QBVB 4Z2NA 4MK0A 2N23A 3FSSA 4IFSA 4GNKB 1U5EA 2GS0A 2MDXA 2LOXA 1FHXA 2Q13A 4F7HA 1AQCA 4KHAA 1NTYA 1E5WA 2EJ8A 2LG1A 2IYBA 1ISNA 2L1CA 3A98B 1I2HA 3NWDA 4NY0A 4GOUA 1DBHA 2R0DA 1X1GA 1FB8A 2DFKA 4D0NB 2UZRA 3SYXA 4OT1A 3ODWA 5EFXA 3MDBC 3KRWA 4CSQA 3PZDA 3KY9A 1TJ6A 3U8ZA 2K00A 2CAYA 1H10A 2COAA 2MWNB 4WVFB 5LG4B 2KCJA 2V76A 5C5BB 1P3RA 1RJ2A 1J19A 1XR0B 3DXEA 2COCA 1X05A 3ML4A 3SO6A 1J0WA 3SUZA 5L81A 2RGNB 5FI1A 4Y94A 3NSUA 3PP2A 2UZSA 2J0MA 2VKIA 2DKPA 4K2PA 5M4YB 1WI1A 4D6WA 3B77A 1ZC3B 2D10A 1TXDA 1FOEA 2DTCA 3HIEA 4YONA 3NW8A 3WYFB 2D9XA 4HATB 3TCAA 1Y19B 4EKUA 2EMTA 1U29A 5D3XA 1PFJA 1V89A 2P8VA 4HB4B 3HQCA 2VRWB 3D8EA 2D9VA 2K2JA 2I1KA 2QKMA 3U7DA 2VSZA 1X86A 5D3VA 4ZRIA 1GG3A 1X1FA 3GYPA 1UNPA 5HE1A 2M38A 3MPXA 1ZYIA 2YS1A 1H4RA 5DHFB 1NU2A 4C0AA 5HE2A 4BBKA 1UNRA 4WSFA 3DCXA 1UEFA 5FI0A 5HE3A 1WGQA 1T77A 3T06A 4MT7A 4KHBB 4GXBA 1NI2A 3IVFA 2KIEA 4HB0B 4K17A 4QJ3B 2P0FA 2YF0A 4Z2MB 2OQBA 3KZ1A 4CHMA 2I1JA 4HAWB 3WA0A 3PVLA 2HTHB 1BTKA 4HSIA 1M7RA 2ADZA 3DXDA 2D9YA 2DX1A 4HB2B 5J3TA 2ELAA 2Y8FA 3P7ZA 1W1DA 2GJYA 2HE7A 2ELBA 3ZVRA 1ZM0A 4DX8A 1UPQA 3ODOA 3G9WA 4QJ4B 5LONB 4IAPA 2X18A 2Z0PA 2COFA 3HSAA 4DXAB 2H7DA 4A6HA 1OY2A 3A8PA 5DI9B 1MAIA 3QWMA 1QQGA 2ROVA 3PSCA 2R09A 4K2OA 1RRPB 3OHMB 1XX0A 4ZRKA 3FEHA 1MI1A 1N3HA 4ZRJA 5J3YA 4HHVA 5C6RA 3TVVA 1GC7A 3LJUX 1DDWA 2RVBB 4HAVB 2D4QA 2NMBA 1EAZA 5C5BA 2DX5A 2Z0QA 1OQNA 1ZVRA 3P6AA 4A6FB 5CLLB 1FGYA 1U2BA 1UPRA 2GUMA 4A6FA 2CODA 4A5KA 4EMOA 2YT0A 5JHGA 1U5GA 2EC1A 4GN1A 4GZUA 4F7GA 2DHJA 3O96A 1KZ7A 2NBVA 2LKOA 3M1IB 2K2UA 3AJ4A 2P0HA 2Z14A 2K8EA 1OMWA 2FJUB 2DA0A 2Z0OA 1W1HA 4L1RA 1FAOA 3BINA 4WJ7A 3TFMA 1KZGA 5DIFB 1MK7B 5C16A 2RUKB 3KSYA 4A6KA 2Y8GA 2JP2A 2P0DA 3GYOA 2IFSA 2DHIA 4L6EA 4KHOA 2YSZA 1MIZB 1FHOA 2M14A 4TKNA 1FGZA 5C79A 1NTVA 2YRYA 1XCGA 4MY6A 1DDVA 1EVHA 1EGXA 2RRFA 2W2XD 2KR0A 4CYEA 1B55A 1U5DA 1W1GA 2OTXA 4KAXB 2AL6A 2D9WA 1XKEA 4B6HA 2XQNM 2RLOA 4KHBA 1FHWA 1V5PA 1WG7A 5KCVA 4HB3B 4DBBA 4HAXB 4CHJA 3V5WA 4QJ5B 1K5GB 2W2XC 3TO1A 2ZKMX 4KVGB 2YS5A 4HAUB 1MIXA 2I5CA 3F0WA 4PQ0A 3TW1A 1XD4A 5CLQB 1V88A 2DHKA 5GOWB 1EF1A 1Z87A 3CXBB 1Q67A 4HAYB 2BCJA 1PLSA 2J59M 3ZDTA 4HDOA 4GMVA 1MKEA 4HDQA 4H8SA 5JHHA 1X11A 5HE0A 2LULA 2Z13A 2I5FA 1QC6A 2DYNA 3HK0A 1KI1B 3OANA 5J3QA 2D11A 1I7AA 5JLJB 1PMSA 3QIJA 1BTNA 3ODXA 1V61A 5KQ4A 4QXAB 2Z59A 2K49A 2CY4A 1ZSQA 5DHAB 2NZ8B 2J0KA 2GCJA 4OSNA 3D8FA 2DLWA 4P7IA 1ZC4B 3PVWA 2Y7BA 3PEGA 3NWAA 1SGHA
chains in the Genus database with same CATH topology
1DROA 3AU4A 3N7CA 1LB1A 1DYNA 2QKLA 4EJNA 4PNKA 3ULCA 2YT1A 2ZPYA 2MKRA 1DDMA 1MK9B 2EMSA 4IOYX 1SHCA 2YS3A 3DXCA 3FM8C 1LW3A 3CIKA 3PVUA 2UVMA 3F5RA 2D9ZA 3VOQA 2H7EA 3UZTA 4K81A 2KUPA 2LOZA 2D2QA 1U5FA 4TYZA 1WJMA 4NSWA 1K5DB 2CY5A 5D3YA 1UNQA 5D3WA 1BAKA 1TQZA 2PZ1A 1WGUA 3PG7A 2ROZB 3A8QA 5D27A 3AU5A 2CRFA 5DH9B 3SNHA 2KGXB 2FJLA 2L2IA 3ULBA 1MPHA 2J0JA 2GCLA 2RNRB 3VIAA 2MFQA 2LYDA 4GMXB 3X23A 1AWEA 4YL8A 1P6SA 3KRXA 1WVHA 2YVCA 2W2WA 4DX90 5LOPB 4XWXA 2N0YA 2RSGA 1P5TA 4F7UP 1IRSA 2DN6A 5JP4A 1WJ1A 4HAZB 3D8DA 3BJIA 4GPTB 1M7EA 1V5MA 2DKQA 2AEHA 1V5UA 1BWNA 5KQ1A 1GC6A 3SV1A 1U27A 2DYQA 3RCPA 2E2XA 1XODA 3HW2B 2G35A 1Y5OA 3QBVB 4Z2NA 4MK0A 2N23A 3FSSA 4IFSA 1U5EA 2GS0A 2MDXA 2LOXA 1FHXA 2Q13A 4F7HA 1AQCA 4KHAA 1NTYA 1E5WA 2EJ8A 2LG1A 2IYBA 1ISNA 2L1CA 3A98B 1I2HA 4NY0A 1DBHA 2R0DA 1X1GA 1FB8A 2DFKA 4D0NB 2UZRA 3SYXA 3ODWA 5EFXA 3MDBC 3KRWA 3PZDA 3KY9A 1TJ6A 3U8ZA 2K00A 2CAYA 1H10A 2COAA 2MWNB 4WVFB 2KCJA 2V76A 5C5BB 1P3RA 1RJ2A 1J19A 1XR0B 3DXEA 2COCA 1X05A 3ML4A 3SO6A 1J0WA 3SUZA 5L81A 2RGNB 5FI1A 4Y94A 3NSUA 3PP2A 2UZSA 2J0MA 2VKIA 2DKPA 4K2PA 1WI1A 1ZC3B 2D10A 1TXDA 1FOEA 2DTCA 4YONA 3WYFB 2D9XA 4HATB 3TCAA 1Y19B 4EKUA 2EMTA 1U29A 5D3XA 1PFJA 1V89A 2P8VA 4HB4B 3HQCA 2VRWB 3D8EA 2D9VA 2K2JA 2I1KA 2QKMA 3U7DA 2VSZA 1X86A 5D3VA 4ZRIA 1GG3A 1X1FA 3GYPA 1UNPA 5HE1A 2M38A 3MPXA 2YS1A 1H4RA 5DHFB 1NU2A 4C0AA 5HE2A 4BBKA 1UNRA 4WSFA 1UEFA 5FI0A 5HE3A 1WGQA 3T06A 4MT7A 4KHBB 4GXBA 1NI2A 3IVFA 4HB0B 4K17A 2P0FA 2YF0A 4Z2MB 2OQBA 3KZ1A 4CHMA 2I1JA 4HAWB 3WA0A 3PVLA 2HTHB 1BTKA 1M7RA 2ADZA 3DXDA 2D9YA 2DX1A 4HB2B 5J3TA 2ELAA 2Y8FA 3P7ZA 1W1DA 2GJYA 2HE7A 2ELBA 3ZVRA 1ZM0A 4DX8A 1UPQA 3ODOA 3G9WA 5LONB 4IAPA 2X18A 2Z0PA 2COFA 4DXAB 2H7DA 4A6HA 1OY2A 3A8PA 5DI9B 1MAIA 3QWMA 1QQGA 2ROVA 3PSCA 2R09A 4K2OA 1RRPB 1XX0A 4ZRKA 3FEHA 1N3HA 4ZRJA 5J3YA 4HHVA 5C6RA 3TVVA 1GC7A 3LJUX 1DDWA 2RVBB 4HAVB 2D4QA 2NMBA 1EAZA 5C5BA 2DX5A 2Z0QA 1OQNA 1ZVRA 3P6AA 4A6FB 5CLLB 1FGYA 1U2BA 1UPRA 4A6FA 2CODA 4A5KA 4EMOA 2YT0A 5JHGA 1U5GA 2EC1A 4GN1A 4GZUA 4F7GA 2DHJA 3O96A 1KZ7A 2LKOA 3M1IB 2K2UA 3AJ4A 2P0HA 1OMWA 2DA0A 2Z0OA 1W1HA 1FAOA 3BINA 4WJ7A 3TFMA 1KZGA 5DIFB 1MK7B 5C16A 2RUKB 3KSYA 4A6KA 2Y8GA 2JP2A 2P0DA 3GYOA 2IFSA 2DHIA 4L6EA 4KHOA 2YSZA 1MIZB 1FHOA 2M14A 4TKNA 1FGZA 5C79A 1NTVA 2YRYA 1XCGA 4MY6A 1DDVA 1EVHA 1EGXA 2W2XD 4CYEA 1B55A 1U5DA 1W1GA 2OTXA 4KAXB 2AL6A 2D9WA 1XKEA 4B6HA 2XQNM 2RLOA 1FHWA 1V5PA 1WG7A 5KCVA 4HB3B 4DBBA 4HAXB 4CHJA 3V5WA 1K5GB 2W2XC 3TO1A 4KVGB 2YS5A 4HAUB 1MIXA 2I5CA 3F0WA 4PQ0A 3TW1A 1XD4A 5CLQB 1V88A 2DHKA 5GOWB 1EF1A 1Z87A 3CXBB 1Q67A 4HAYB 2BCJA 1PLSA 2J59M 3ZDTA 4HDOA 4GMVA 1MKEA 4HDQA 4H8SA 5JHHA 1X11A 5HE0A 2LULA 2I5FA 1QC6A 2DYNA 3HK0A 1KI1B 3OANA 5J3QA 2D11A 1I7AA 5JLJB 1PMSA 3QIJA 1BTNA 3ODXA 1V61A 5KQ4A 2CY4A 1ZSQA 5DHAB 2NZ8B 2J0KA 2GCJA 3D8FA 2DLWA 4P7IA 1ZC4B 3PVWA 2Y7BA 3PEGA 1SGHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DRO A;  3AU4 A;  3N7C A;  1LB1 A;  1DYN A;  2QKL A;  4EJN A;  4PNK A;  3ULC A;  2YT1 A;  2ZPY A;  2MKR A;  1DDM A;  1MK9 B;  2EMS A;  4IOY X;  1SHC A;  2YS3 A;  3DXC A;  3FM8 C;  1LW3 A;  3CIK A;  3PVU A;  2UVM A;  3F5R A;  2D9Z A;  3VOQ A;  2H7E A;  3UZT A;  4K81 A;  2KUP A;  2LOZ A;  2D2Q A;  1U5F A;  4TYZ A;  1WJM A;  4NSW A;  1K5D B;  2CY5 A;  5D3Y A;  1UNQ A;  5D3W A;  1BAK A;  1TQZ A;  2PZ1 A;  1WGU A;  3PG7 A;  2ROZ B;  3A8Q A;  5D27 A;  3AU5 A;  2CRF A;  5DH9 B;  3SNH A;  2KGX B;  2FJL A;  2L2I A;  3ULB A;  1MPH A;  2J0J A;  2GCL A;  2RNR B;  3VIA A;  2MFQ A;  2LYD A;  4GMX B;  3X23 A;  1AWE A;  4YL8 A;  1P6S A;  3KRX A;  1WVH A;  2YVC A;  2W2W A;  4DX9 0;  5LOP B;  4XWX A;  2N0Y A;  2RSG A;  1P5T A;  4F7U P;  1IRS A;  2DN6 A;  5JP4 A;  1WJ1 A;  4HAZ B;  3D8D A;  3BJI A;  4GPT B;  1M7E A;  1V5M A;  2DKQ A;  2AEH A;  1V5U A;  1BWN A;  5KQ1 A;  1GC6 A;  3SV1 A;  1U27 A;  2DYQ A;  3RCP A;  2E2X A;  1XOD A;  3HW2 B;  2G35 A;  1Y5O A;  3QBV B;  4Z2N A;  4MK0 A;  2N23 A;  3FSS A;  4IFS A;  1U5E A;  2GS0 A;  2MDX A;  2LOX A;  1FHX A;  2Q13 A;  4F7H A;  1AQC A;  4KHA A;  1NTY A;  1E5W A;  2EJ8 A;  2LG1 A;  2IYB A;  1ISN A;  2L1C A;  3A98 B;  1I2H A;  4NY0 A;  1DBH A;  2R0D A;  1X1G A;  1FB8 A;  2DFK A;  4D0N B;  2UZR A;  3SYX A;  3ODW A;  5EFX A;  3MDB C;  3KRW A;  3PZD A;  3KY9 A;  1TJ6 A;  3U8Z A;  2K00 A;  2CAY A;  1H10 A;  2COA A;  2MWN B;  4WVF B;  2KCJ A;  2V76 A;  5C5B B;  1P3R A;  1RJ2 A;  1J19 A;  1XR0 B;  3DXE A;  2COC A;  1X05 A;  3ML4 A;  3SO6 A;  1J0W A;  3SUZ A;  5L81 A;  2RGN B;  5FI1 A;  4Y94 A;  3NSU A;  3PP2 A;  2UZS A;  2J0M A;  2VKI A;  2DKP A;  4K2P A;  1WI1 A;  1ZC3 B;  2D10 A;  1TXD A;  1FOE A;  2DTC A;  4YON A;  3WYF B;  2D9X A;  4HAT B;  3TCA A;  1Y19 B;  4EKU A;  2EMT A;  1U29 A;  5D3X A;  1PFJ A;  1V89 A;  2P8V A;  4HB4 B;  3HQC A;  2VRW B;  3D8E A;  2D9V A;  2K2J A;  2I1K A;  2QKM A;  3U7D A;  2VSZ A;  1X86 A;  5D3V A;  4ZRI A;  1GG3 A;  1X1F A;  3GYP A;  1UNP A;  5HE1 A;  2M38 A;  3MPX A;  2YS1 A;  1H4R A;  5DHF B;  1NU2 A;  4C0A A;  5HE2 A;  4BBK A;  1UNR A;  4WSF A;  1UEF A;  5FI0 A;  5HE3 A;  1WGQ A;  3T06 A;  4MT7 A;  4KHB B;  4GXB A;  1NI2 A;  3IVF A;  4HB0 B;  4K17 A;  2P0F A;  2YF0 A;  4Z2M B;  2OQB A;  3KZ1 A;  4CHM A;  2I1J A;  4HAW B;  3WA0 A;  3PVL A;  2HTH B;  1BTK A;  1M7R A;  2ADZ A;  3DXD A;  2D9Y A;  2DX1 A;  4HB2 B;  5J3T A;  2ELA A;  2Y8F A;  3P7Z A;  1W1D A;  2GJY A;  2HE7 A;  2ELB A;  3ZVR A;  1ZM0 A;  4DX8 A;  1UPQ A;  3ODO A;  3G9W A;  5LON B;  4IAP A;  2X18 A;  2Z0P A;  2COF A;  4DXA B;  2H7D A;  4A6H A;  1OY2 A;  3A8P A;  5DI9 B;  1MAI A;  3QWM A;  1QQG A;  2ROV A;  3PSC A;  2R09 A;  4K2O A;  1RRP B;  1XX0 A;  4ZRK A;  3FEH A;  1N3H A;  4ZRJ A;  5J3Y A;  4HHV A;  5C6R A;  3TVV A;  1GC7 A;  3LJU X;  1DDW A;  2RVB B;  4HAV B;  2D4Q A;  2NMB A;  1EAZ A;  5C5B A;  2DX5 A;  2Z0Q A;  1OQN A;  1ZVR A;  3P6A A;  4A6F B;  5CLL B;  1FGY A;  1U2B A;  1UPR A;  4A6F A;  2COD A;  4A5K A;  4EMO A;  2YT0 A;  5JHG A;  1U5G A;  2EC1 A;  4GN1 A;  4GZU A;  4F7G A;  2DHJ A;  3O96 A;  1KZ7 A;  2LKO A;  3M1I B;  2K2U A;  3AJ4 A;  2P0H A;  1OMW A;  2DA0 A;  2Z0O A;  1W1H A;  1FAO A;  3BIN A;  4WJ7 A;  3TFM A;  1KZG A;  5DIF B;  1MK7 B;  5C16 A;  2RUK B;  3KSY A;  4A6K A;  2Y8G A;  2JP2 A;  2P0D A;  3GYO A;  2IFS A;  2DHI A;  4L6E A;  4KHO A;  2YSZ A;  1MIZ B;  1FHO A;  2M14 A;  4TKN A;  1FGZ A;  5C79 A;  1NTV A;  2YRY A;  1XCG A;  4MY6 A;  1DDV A;  1EVH A;  1EGX A;  2W2X D;  4CYE A;  1B55 A;  1U5D A;  1W1G A;  2OTX A;  4KAX B;  2AL6 A;  2D9W A;  1XKE A;  4B6H A;  2XQN M;  2RLO A;  1FHW A;  1V5P A;  1WG7 A;  5KCV A;  4HB3 B;  4DBB A;  4HAX B;  4CHJ A;  3V5W A;  1K5G B;  2W2X C;  3TO1 A;  4KVG B;  2YS5 A;  4HAU B;  1MIX A;  2I5C A;  3F0W A;  4PQ0 A;  3TW1 A;  1XD4 A;  5CLQ B;  1V88 A;  2DHK A;  5GOW B;  1EF1 A;  1Z87 A;  3CXB B;  1Q67 A;  4HAY B;  2BCJ A;  1PLS A;  2J59 M;  3ZDT A;  4HDO A;  4GMV A;  1MKE A;  4HDQ A;  4H8S A;  5JHH A;  1X11 A;  5HE0 A;  2LUL A;  2I5F A;  1QC6 A;  2DYN A;  3HK0 A;  1KI1 B;  3OAN A;  5J3Q A;  2D11 A;  1I7A A;  5JLJ B;  1PMS A;  3QIJ A;  1BTN A;  3ODX A;  1V61 A;  5KQ4 A;  2CY4 A;  1ZSQ A;  5DHA B;  2NZ8 B;  2J0K A;  2GCJ A;  3D8F A;  2DLW A;  4P7I A;  1ZC4 B;  3PVW A;  2Y7B A;  3PEG A;  1SGH A; 
#chains in the Genus database with same CATH topology
 1DRO A;  3AU4 A;  3N7C A;  1LB1 A;  1DYN A;  2QKL A;  4DIX A;  4EJN A;  4PNK A;  3ULC A;  2YT1 A;  2R2Y A;  2ZPY A;  2MKR A;  1DDM A;  1MK9 B;  2EMS A;  4IOY X;  1SHC A;  2YS3 A;  3DXC A;  3FM8 C;  1LW3 A;  3CIK A;  3PVU A;  2UVM A;  3F5R A;  2D9Z A;  5I2S A;  3VOQ A;  2H7E A;  3UZT A;  4K81 A;  2KUP A;  2LOZ A;  2D2Q A;  1U5F A;  2KIG A;  4TYZ A;  1WJM A;  4NSW A;  1K5D B;  2CY5 A;  5D3Y A;  1UNQ A;  5D3W A;  1BAK A;  1TQZ A;  2PZ1 A;  1WGU A;  3PG7 A;  2ROZ B;  3A8Q A;  5D27 A;  3AU5 A;  2CRF A;  5DH9 B;  3SNH A;  2KGX B;  2FJL A;  2L2I A;  2Z4D A;  3ULB A;  1MPH A;  2J0J A;  2GCL A;  2RNR B;  3FVC A;  3VIA A;  2MFQ A;  2LYD A;  4GMX B;  3X23 A;  1AWE A;  4YL8 A;  1P6S A;  3KRX A;  1WVH A;  2YVC A;  3NWF A;  3U12 A;  2W2W A;  3A58 A;  4DX9 0;  5LOP B;  4XWX A;  5IRS A;  2N0Y A;  2RSG A;  1P5T A;  4F7U P;  1IRS A;  2DN6 A;  5JP4 A;  1WJ1 A;  4HAZ B;  3D8D A;  3BJI A;  4GPT B;  1M7E A;  1V5M A;  2DKQ A;  2AEH A;  1V5U A;  1BWN A;  2YT2 A;  5KQ1 A;  1GC6 A;  3SV1 A;  1U27 A;  2DYQ A;  3RCP A;  2E2X A;  1XOD A;  2KUQ A;  3HW2 B;  2G35 A;  5I2M A;  1Y5O A;  3QBV B;  4Z2N A;  4MK0 A;  2N23 A;  3FSS A;  4IFS A;  4GNK B;  1U5E A;  2GS0 A;  2MDX A;  2LOX A;  1FHX A;  2Q13 A;  4F7H A;  1AQC A;  4KHA A;  1NTY A;  1E5W A;  2EJ8 A;  2LG1 A;  2IYB A;  1ISN A;  2L1C A;  3A98 B;  1I2H A;  3NWD A;  4NY0 A;  4GOU A;  1DBH A;  2R0D A;  1X1G A;  1FB8 A;  2DFK A;  4D0N B;  2UZR A;  3SYX A;  4OT1 A;  3ODW A;  5EFX A;  3MDB C;  3KRW A;  4CSQ A;  3PZD A;  3KY9 A;  1TJ6 A;  3U8Z A;  2K00 A;  2CAY A;  1H10 A;  2COA A;  2MWN B;  4WVF B;  5LG4 B;  2KCJ A;  2V76 A;  5C5B B;  1P3R A;  1RJ2 A;  1J19 A;  1XR0 B;  3DXE A;  2COC A;  1X05 A;  3ML4 A;  3SO6 A;  1J0W A;  3SUZ A;  5L81 A;  2RGN B;  5FI1 A;  4Y94 A;  3NSU A;  3PP2 A;  2UZS A;  2J0M A;  2VKI A;  2DKP A;  4K2P A;  5M4Y B;  1WI1 A;  4D6W A;  3B77 A;  1ZC3 B;  2D10 A;  1TXD A;  1FOE A;  2DTC A;  3HIE A;  4YON A;  3NW8 A;  3WYF B;  2D9X A;  4HAT B;  3TCA A;  1Y19 B;  4EKU A;  2EMT A;  1U29 A;  5D3X A;  1PFJ A;  1V89 A;  2P8V A;  4HB4 B;  3HQC A;  2VRW B;  3D8E A;  2D9V A;  2K2J A;  2I1K A;  2QKM A;  3U7D A;  2VSZ A;  1X86 A;  5D3V A;  4ZRI A;  1GG3 A;  1X1F A;  3GYP A;  1UNP A;  5HE1 A;  2M38 A;  3MPX A;  1ZYI A;  2YS1 A;  1H4R A;  5DHF B;  1NU2 A;  4C0A A;  5HE2 A;  4BBK A;  1UNR A;  4WSF A;  3DCX A;  1UEF A;  5FI0 A;  5HE3 A;  1WGQ A;  1T77 A;  3T06 A;  4MT7 A;  4KHB B;  4GXB A;  1NI2 A;  3IVF A;  2KIE A;  4HB0 B;  4K17 A;  4QJ3 B;  2P0F A;  2YF0 A;  4Z2M B;  2OQB A;  3KZ1 A;  4CHM A;  2I1J A;  4HAW B;  3WA0 A;  3PVL A;  2HTH B;  1BTK A;  4HSI A;  1M7R A;  2ADZ A;  3DXD A;  2D9Y A;  2DX1 A;  4HB2 B;  5J3T A;  2ELA A;  2Y8F A;  3P7Z A;  1W1D A;  2GJY A;  2HE7 A;  2ELB A;  3ZVR A;  1ZM0 A;  4DX8 A;  1UPQ A;  3ODO A;  3G9W A;  4QJ4 B;  5LON B;  4IAP A;  2X18 A;  2Z0P A;  2COF A;  3HSA A;  4DXA B;  2H7D A;  4A6H A;  1OY2 A;  3A8P A;  5DI9 B;  1MAI A;  3QWM A;  1QQG A;  2ROV A;  3PSC A;  2R09 A;  4K2O A;  1RRP B;  3OHM B;  1XX0 A;  4ZRK A;  3FEH A;  1MI1 A;  1N3H A;  4ZRJ A;  5J3Y A;  4HHV A;  5C6R A;  3TVV A;  1GC7 A;  3LJU X;  1DDW A;  2RVB B;  4HAV B;  2D4Q A;  2NMB A;  1EAZ A;  5C5B A;  2DX5 A;  2Z0Q A;  1OQN A;  1ZVR A;  3P6A A;  4A6F B;  5CLL B;  1FGY A;  1U2B A;  1UPR A;  2GUM A;  4A6F A;  2COD A;  4A5K A;  4EMO A;  2YT0 A;  5JHG A;  1U5G A;  2EC1 A;  4GN1 A;  4GZU A;  4F7G A;  2DHJ A;  3O96 A;  1KZ7 A;  2NBV A;  2LKO A;  3M1I B;  2K2U A;  3AJ4 A;  2P0H A;  2Z14 A;  2K8E A;  1OMW A;  2FJU B;  2DA0 A;  2Z0O A;  1W1H A;  4L1R A;  1FAO A;  3BIN A;  4WJ7 A;  3TFM A;  1KZG A;  5DIF B;  1MK7 B;  5C16 A;  2RUK B;  3KSY A;  4A6K A;  2Y8G A;  2JP2 A;  2P0D A;  3GYO A;  2IFS A;  2DHI A;  4L6E A;  4KHO A;  2YSZ A;  1MIZ B;  1FHO A;  2M14 A;  4TKN A;  1FGZ A;  5C79 A;  1NTV A;  2YRY A;  1XCG A;  4MY6 A;  1DDV A;  1EVH A;  1EGX A;  2RRF A;  2W2X D;  2KR0 A;  4CYE A;  1B55 A;  1U5D A;  1W1G A;  2OTX A;  4KAX B;  2AL6 A;  2D9W A;  1XKE A;  4B6H A;  2XQN M;  2RLO A;  4KHB A;  1FHW A;  1V5P A;  1WG7 A;  5KCV A;  4HB3 B;  4DBB A;  4HAX B;  4CHJ A;  3V5W A;  4QJ5 B;  1K5G B;  2W2X C;  3TO1 A;  2ZKM X;  4KVG B;  2YS5 A;  4HAU B;  1MIX A;  2I5C A;  3F0W A;  4PQ0 A;  3TW1 A;  1XD4 A;  5CLQ B;  1V88 A;  2DHK A;  5GOW B;  1EF1 A;  1Z87 A;  3CXB B;  1Q67 A;  4HAY B;  2BCJ A;  1PLS A;  2J59 M;  3ZDT A;  4HDO A;  4GMV A;  1MKE A;  4HDQ A;  4H8S A;  5JHH A;  1X11 A;  5HE0 A;  2LUL A;  2Z13 A;  2I5F A;  1QC6 A;  2DYN A;  3HK0 A;  1KI1 B;  3OAN A;  5J3Q A;  2D11 A;  1I7A A;  5JLJ B;  1PMS A;  3QIJ A;  1BTN A;  3ODX A;  1V61 A;  5KQ4 A;  4QXA B;  2Z59 A;  2K49 A;  2CY4 A;  1ZSQ A;  5DHA B;  2NZ8 B;  2J0K A;  2GCJ A;  4OSN A;  3D8F A;  2DLW A;  4P7I A;  1ZC4 B;  3PVW A;  2Y7B A;  3PEG A;  3NWA A;  1SGH A; 
#chains in the Genus database with same CATH homology
 1DRO A;  3AU4 A;  3N7C A;  1LB1 A;  1DYN A;  2QKL A;  4EJN A;  4PNK A;  3ULC A;  2YT1 A;  2ZPY A;  2MKR A;  1DDM A;  1MK9 B;  2EMS A;  4IOY X;  1SHC A;  2YS3 A;  3DXC A;  3FM8 C;  1LW3 A;  3CIK A;  3PVU A;  2UVM A;  3F5R A;  2D9Z A;  3VOQ A;  2H7E A;  3UZT A;  4K81 A;  2KUP A;  2LOZ A;  2D2Q A;  1U5F A;  4TYZ A;  1WJM A;  4NSW A;  1K5D B;  2CY5 A;  5D3Y A;  1UNQ A;  5D3W A;  1BAK A;  1TQZ A;  2PZ1 A;  1WGU A;  3PG7 A;  2ROZ B;  3A8Q A;  5D27 A;  3AU5 A;  2CRF A;  5DH9 B;  3SNH A;  2KGX B;  2FJL A;  2L2I A;  3ULB A;  1MPH A;  2J0J A;  2GCL A;  2RNR B;  3VIA A;  2MFQ A;  2LYD A;  4GMX B;  3X23 A;  1AWE A;  4YL8 A;  1P6S A;  3KRX A;  1WVH A;  2YVC A;  2W2W A;  4DX9 0;  5LOP B;  4XWX A;  2N0Y A;  2RSG A;  1P5T A;  4F7U P;  1IRS A;  2DN6 A;  5JP4 A;  1WJ1 A;  4HAZ B;  3D8D A;  3BJI A;  4GPT B;  1M7E A;  1V5M A;  2DKQ A;  2AEH A;  1V5U A;  1BWN A;  5KQ1 A;  1GC6 A;  3SV1 A;  1U27 A;  2DYQ A;  3RCP A;  2E2X A;  1XOD A;  3HW2 B;  2G35 A;  1Y5O A;  3QBV B;  4Z2N A;  4MK0 A;  2N23 A;  3FSS A;  4IFS A;  1U5E A;  2GS0 A;  2MDX A;  2LOX A;  1FHX A;  2Q13 A;  4F7H A;  1AQC A;  4KHA A;  1NTY A;  1E5W A;  2EJ8 A;  2LG1 A;  2IYB A;  1ISN A;  2L1C A;  3A98 B;  1I2H A;  4NY0 A;  1DBH A;  2R0D A;  1X1G A;  1FB8 A;  2DFK A;  4D0N B;  2UZR A;  3SYX A;  3ODW A;  5EFX A;  3MDB C;  3KRW A;  3PZD A;  3KY9 A;  1TJ6 A;  3U8Z A;  2K00 A;  2CAY A;  1H10 A;  2COA A;  2MWN B;  4WVF B;  2KCJ A;  2V76 A;  5C5B B;  1P3R A;  1RJ2 A;  1J19 A;  1XR0 B;  3DXE A;  2COC A;  1X05 A;  3ML4 A;  3SO6 A;  1J0W A;  3SUZ A;  5L81 A;  2RGN B;  5FI1 A;  4Y94 A;  3NSU A;  3PP2 A;  2UZS A;  2J0M A;  2VKI A;  2DKP A;  4K2P A;  1WI1 A;  1ZC3 B;  2D10 A;  1TXD A;  1FOE A;  2DTC A;  4YON A;  3WYF B;  2D9X A;  4HAT B;  3TCA A;  1Y19 B;  4EKU A;  2EMT A;  1U29 A;  5D3X A;  1PFJ A;  1V89 A;  2P8V A;  4HB4 B;  3HQC A;  2VRW B;  3D8E A;  2D9V A;  2K2J A;  2I1K A;  2QKM A;  3U7D A;  2VSZ A;  1X86 A;  5D3V A;  4ZRI A;  1GG3 A;  1X1F A;  3GYP A;  1UNP A;  5HE1 A;  2M38 A;  3MPX A;  2YS1 A;  1H4R A;  5DHF B;  1NU2 A;  4C0A A;  5HE2 A;  4BBK A;  1UNR A;  4WSF A;  1UEF A;  5FI0 A;  5HE3 A;  1WGQ A;  3T06 A;  4MT7 A;  4KHB B;  4GXB A;  1NI2 A;  3IVF A;  4HB0 B;  4K17 A;  2P0F A;  2YF0 A;  4Z2M B;  2OQB A;  3KZ1 A;  4CHM A;  2I1J A;  4HAW B;  3WA0 A;  3PVL A;  2HTH B;  1BTK A;  1M7R A;  2ADZ A;  3DXD A;  2D9Y A;  2DX1 A;  4HB2 B;  5J3T A;  2ELA A;  2Y8F A;  3P7Z A;  1W1D A;  2GJY A;  2HE7 A;  2ELB A;  3ZVR A;  1ZM0 A;  4DX8 A;  1UPQ A;  3ODO A;  3G9W A;  5LON B;  4IAP A;  2X18 A;  2Z0P A;  2COF A;  4DXA B;  2H7D A;  4A6H A;  1OY2 A;  3A8P A;  5DI9 B;  1MAI A;  3QWM A;  1QQG A;  2ROV A;  3PSC A;  2R09 A;  4K2O A;  1RRP B;  1XX0 A;  4ZRK A;  3FEH A;  1N3H A;  4ZRJ A;  5J3Y A;  4HHV A;  5C6R A;  3TVV A;  1GC7 A;  3LJU X;  1DDW A;  2RVB B;  4HAV B;  2D4Q A;  2NMB A;  1EAZ A;  5C5B A;  2DX5 A;  2Z0Q A;  1OQN A;  1ZVR A;  3P6A A;  4A6F B;  5CLL B;  1FGY A;  1U2B A;  1UPR A;  4A6F A;  2COD A;  4A5K A;  4EMO A;  2YT0 A;  5JHG A;  1U5G A;  2EC1 A;  4GN1 A;  4GZU A;  4F7G A;  2DHJ A;  3O96 A;  1KZ7 A;  2LKO A;  3M1I B;  2K2U A;  3AJ4 A;  2P0H A;  1OMW A;  2DA0 A;  2Z0O A;  1W1H A;  1FAO A;  3BIN A;  4WJ7 A;  3TFM A;  1KZG A;  5DIF B;  1MK7 B;  5C16 A;  2RUK B;  3KSY A;  4A6K A;  2Y8G A;  2JP2 A;  2P0D A;  3GYO A;  2IFS A;  2DHI A;  4L6E A;  4KHO A;  2YSZ A;  1MIZ B;  1FHO A;  2M14 A;  4TKN A;  1FGZ A;  5C79 A;  1NTV A;  2YRY A;  1XCG A;  4MY6 A;  1DDV A;  1EVH A;  1EGX A;  2W2X D;  4CYE A;  1B55 A;  1U5D A;  1W1G A;  2OTX A;  4KAX B;  2AL6 A;  2D9W A;  1XKE A;  4B6H A;  2XQN M;  2RLO A;  1FHW A;  1V5P A;  1WG7 A;  5KCV A;  4HB3 B;  4DBB A;  4HAX B;  4CHJ A;  3V5W A;  1K5G B;  2W2X C;  3TO1 A;  4KVG B;  2YS5 A;  4HAU B;  1MIX A;  2I5C A;  3F0W A;  4PQ0 A;  3TW1 A;  1XD4 A;  5CLQ B;  1V88 A;  2DHK A;  5GOW B;  1EF1 A;  1Z87 A;  3CXB B;  1Q67 A;  4HAY B;  2BCJ A;  1PLS A;  2J59 M;  3ZDT A;  4HDO A;  4GMV A;  1MKE A;  4HDQ A;  4H8S A;  5JHH A;  1X11 A;  5HE0 A;  2LUL A;  2I5F A;  1QC6 A;  2DYN A;  3HK0 A;  1KI1 B;  3OAN A;  5J3Q A;  2D11 A;  1I7A A;  5JLJ B;  1PMS A;  3QIJ A;  1BTN A;  3ODX A;  1V61 A;  5KQ4 A;  2CY4 A;  1ZSQ A;  5DHA B;  2NZ8 B;  2J0K A;  2GCJ A;  3D8F A;  2DLW A;  4P7I A;  1ZC4 B;  3PVW A;  2Y7B A;  3PEG A;  1SGH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...