3HW2B

Crystal structure of the sifa-skip(ph) complex
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
105
structure length
105
Chain Sequence
TITKEGMLHYKAGTSYLGKEHWKTCFVVLSNGILYQYPDRTDVIPLLSVNMGGEQCGGCRRANTTDRPHAFQVILSDRPCLELSAESEAEMAEWMQHLCQAVSKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Signaling protein
molecule keywords Protein sifA
publication title Interaction between the SifA virulence factor and its host target skip is essential for salmonella pathogenesis
pubmed doi rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium
total genus 16
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2009-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3hw2B00
4KVGB 5CLLB 2YS3A 1AQCA 2P0HA 3O96A 3ZVRA 3QIJA 4Z2NA 3PVLA 2XQNM 2K2UA 1MK7B 1XODA 2MWNB 3U8ZA 1MK9B 3KRXA 2Y8FA 2DHIA 1WJ1A 1ZVRA 1MKEA 2YSZA 1X11A 2DYNA 3OANA 5LONB 1UPRA 2K00A 3D8DA 4ZRIA 4GMVA 3BJIA 1NU2A 4GN1A 2OQBA 1PFJA 5D3VA 1Q67A 3TO1A 2DYQA 4KHBB 1ZC3B 3ML4A 1LW3A 3KRWA 2NZ8B 3KSYA 4P7IA 1DDMA 1ISNA 1U2BA 2FJLA 2DX5A 1NI2A 2YS1A 4H8SA 2ADZA 1X05A 4KHAA 4PQ0A 4IAPA 5DHFB 2D9YA 1PLSA 2X18A 3M1IB 2YT0A 1GC7A 2ELBA 1OY2A 1BTKA 1P6SA 1MPHA 2DHKA 4KHOA 4TKNA 1SGHA 1EVHA 2E2XA 3PEGA 3MDBC 1K5DB 4Z2MB 2D9ZA 5C5BA 4YL8A 1NTYA 2OTXA 2DKPA 3SYXA 4HB3B 1TJ6A 1DBHA 2D9WA 3SNHA 1U5GA 1OMWA 5JHGA 5C6RA 2LOZA 1FHXA 1QQGA 5HE2A 3BINA 2V76A 2R0DA 1W1GA 1Y19B 4ZRJA 2UZRA 4MY6A 1UNRA 2COCA 5J3TA 2HE7A 3IVFA 5D3XA 3NSUA 5J3YA 4A6FA 2J0KA 2BCJA 3U7DA 5KQ1A 1XR0B 2LG1A 2RLOA 4HATB 1EF1A 2MFQA 2GJYA 3D8EA 1H4RA 3UZTA 3G9WA 1BAKA 2JP2A 2CY5A 2YF0A 3ULBA 2D11A 5D27A 3GYPA 5LOPB 1SHCA 1V89A 3HQCA 2IFSA 3CXBB 1OQNA 4DX90 5J3QA 2Z0OA 4GMXB 1RJ2A 2DLWA 4ZRKA 4CHMA 3AJ4A 4HDQA 2J59M 1N3HA 3VOQA 2EC1A 2W2XC 4NSWA 3FM8C 1UEFA 2I5CA 2Z0QA 1TQZA 1MIZB 3P6AA 5JLJB 1V5UA 1TXDA 1ZC4B 2KUPA 3TCAA 3TW1A 4WSFA 1BWNA 3MPXA 5D3YA 3A8QA 2YVCA 1MAIA 4BBKA 3KZ1A 1ZM0A 2DHJA 3KY9A 1KZ7A 3PVWA 1I2HA 4HAVB 1FGYA 5D3WA 4HB0B 2D4QA 2DN6A 2M38A 2RSGA 1E5WA 1UPQA 3LJUX 1XKEA 1U5DA 1J19A 1XCGA 2AEHA 1WVHA 2VKIA 2GCLA 2Y7BA 4IFSA 4WJ7A 5GOWB 1MIXA 2DKQA 4B6HA 2LKOA 2CRFA 1U27A 1DDVA 4HDOA 4F7UP 2P0DA 2N23A 2J0MA 1XD4A 1Y5OA 4HAZB 1WI1A 3DXCA 1V5MA 4GXBA 2DA0A 2P8VA 1DDWA 3WYFB 4GPTB 3V5WA 1M7EA 2Q13A 1P5TA 2QKMA 1UNPA 1WG7A 3AU5A 4K81A 1ZSQA 1QC6A 4K2PA 2GCJA 2Y8GA 4L6EA 5DIFB 4YONA 4CHJA 2D2QA 1GG3A 1EGXA 3AU4A 3CIKA 3QWMA 1V61A 2NMBA 5DH9B 2EMSA 3F5RA 1J0WA 3QBVB 2D9XA 2ZPYA 2I1JA 2L1CA 1KZGA 4GZUA 2M14A 3VIAA 3X23A 2LULA 1FOEA 4PNKA 2W2WA 3ODWA 3N7CA 2GS0A 4HB2B 4DX8A 1WGUA 2D10A 1UNQA 1I7AA 2VRWB 3GYOA 1H10A 2I5FA 2YT1A 2DX1A 2H7DA 3T06A 3SO6A 3ZDTA 1DYNA 1GC6A 2Z0PA 3TFMA 4F7GA 2COFA 4A6KA 1KI1B 1XX0A 1AWEA 5JHHA 5KQ4A 4EJNA 2EJ8A 3HW2B 2DTCA 4MT7A 2K2JA 4K2OA 1X86A 1X1GA 1EAZA 2YS5A 4HAUB 5FI0A 2COAA 5FI1A 1FHOA 5C5BB 1DROA 3A98B 5DHAB 4A6HA 4TYZA 3FEHA 2LOXA 4WVFB 5DI9B 3F0WA 1LB1A 4EKUA 4HB4B 2KCJA 2UZSA 4CYEA 1PMSA 4EMOA 4KAXB 2RNRB 1RRPB 4HHVA 2W2XD 4NY0A 5KCVA 4MK0A 2LYDA 2J0JA 1Z87A 2CODA 2RGNB 2DFKA 1WGQA 3ODXA 1W1HA 1M7RA 2I1KA 1U5FA 3PZDA 4DBBA 3PP2A 3TVVA 5EFXA 2ELAA 3FSSA 3HK0A 1V88A 4DXAB 2IYBA 2VSZA 1K5GB 4A6FB 3RCPA 3ODOA 3D8FA 4XWXA 4C0AA 4F7HA 3DXDA 3DXEA 3PSCA 2CY4A 2UVMA 2MKRA 3SUZA 5HE3A 2R09A 2KGXB 1FB8A 1NTVA 3SV1A 3ULCA 5HE1A 1V5PA 1X1FA 2YRYA 3PG7A 4HAYB 2RUKB 2ROVA 2MDXA 1U5EA 1BTNA 2QKLA 3WA0A 1P3RA 2D9VA 5JP4A 5C16A 4K17A 2RVBB 4D0NB 2H7EA 1W1DA 4A5KA 5L81A 1FGZA 2N0YA 5HE0A 4Y94A 4HAWB 2P0FA 2HTHB 1WJMA 4IOYX 5CLQB 2ROZB 1FAOA 1IRSA 2EMTA 2G35A 3PVUA 1FHWA 2CAYA 3A8PA 4HAXB 2PZ1A 1B55A 1U29A 2L2IA 3P7ZA 2AL6A 5C79A
chains in the Genus database with same CATH superfamily
4KVGB 5CLLB 2KIEA 1AQCA 2YS3A 2P0HA 3O96A 3ZVRA 3QIJA 4Z2NA 3PVLA 2XQNM 2K2UA 1MK7B 1XODA 2MWNB 3U8ZA 1MK9B 3KRXA 3U12A 2Y8FA 2DHIA 1WJ1A 1ZVRA 4OT1A 1MKEA 2YSZA 1X11A 2DYNA 3OANA 5LONB 1UPRA 3NW8A 2K00A 3D8DA 4ZRIA 4GMVA 2Z4DA 3BJIA 1NU2A 4GN1A 5I2MA 2OQBA 1PFJA 5D3VA 1Q67A 3TO1A 2DYQA 4KHBB 1ZC3B 3ML4A 1LW3A 3KRWA 2NZ8B 3KSYA 4P7IA 1DDMA 1ISNA 1U2BA 2FJLA 2DX5A 1NI2A 2YS1A 4H8SA 2ADZA 1X05A 4KHAA 4PQ0A 4IAPA 5DHFB 2D9YA 1PLSA 2X18A 3M1IB 2YT0A 1GC7A 2ELBA 3NWAA 1OY2A 1BTKA 1P6SA 1MPHA 2DHKA 1T77A 4KHOA 4TKNA 2NBVA 1SGHA 1EVHA 2E2XA 3PEGA 3MDBC 1K5DB 4Z2MB 2D9ZA 5C5BA 4YL8A 1NTYA 2OTXA 2DKPA 3SYXA 4HB3B 1TJ6A 4QXAB 1DBHA 2D9WA 3SNHA 1U5GA 2KIGA 1OMWA 5JHGA 5C6RA 2LOZA 1FHXA 1QQGA 5HE2A 2GUMA 3BINA 3OHMB 2YT2A 2V76A 2R0DA 1W1GA 4CSQA 4HSIA 1Y19B 4ZRJA 2KUQA 2UZRA 2Z59A 4MY6A 1UNRA 2KR0A 2COCA 5J3TA 2HE7A 3IVFA 5D3XA 3NSUA 5J3YA 4A6FA 3NWDA 2J0KA 2BCJA 3U7DA 5KQ1A 1XR0B 2LG1A 2RLOA 4HATB 1EF1A 3DCXA 2MFQA 2GJYA 4GOUA 3D8EA 1H4RA 3UZTA 3G9WA 1BAKA 2JP2A 2CY5A 2YF0A 3ULBA 3A58A 2D11A 5D27A 3GYPA 5LOPB 5M4YB 1SHCA 1V89A 3CXBB 3HQCA 2IFSA 1OQNA 4DX90 5J3QA 2Z0OA 2K49A 4GMXB 1RJ2A 2DLWA 4ZRKA 4CHMA 3AJ4A 3FVCA 4HDQA 2J59M 1N3HA 3VOQA 2EC1A 2W2XC 4NSWA 3FM8C 1UEFA 2I5CA 2Z0QA 1TQZA 1MIZB 3P6AA 5JLJB 1V5UA 1TXDA 1ZC4B 2KUPA 5LG4B 3TCAA 3TW1A 4WSFA 1BWNA 3MPXA 5D3YA 3A8QA 2YVCA 1MAIA 3HIEA 3KZ1A 4BBKA 1ZM0A 2DHJA 1ZYIA 3KY9A 1KZ7A 3PVWA 1I2HA 4HAVB 5I2SA 1FGYA 5D3WA 4HB0B 2D4QA 2DN6A 2M38A 2RSGA 1E5WA 1UPQA 3LJUX 1XKEA 1J19A 1U5DA 3NWFA 4GNKB 1XCGA 2AEHA 2ZKMX 1WVHA 2VKIA 2GCLA 2Y7BA 4IFSA 4WJ7A 5GOWB 1MIXA 2DKQA 4B6HA 2LKOA 2CRFA 1U27A 1DDVA 4HDOA 4F7UP 4OSNA 2P0DA 2N23A 2J0MA 1XD4A 1Y5OA 4HAZB 1WI1A 3DXCA 1V5MA 4GXBA 2DA0A 2P8VA 4QJ3B 1DDWA 3WYFB 4GPTB 3V5WA 4D6WA 1M7EA 2Q13A 1P5TA 2QKMA 1UNPA 4KHBA 3B77A 1WG7A 3AU5A 4K81A 2K8EA 1ZSQA 1QC6A 4K2PA 2GCJA 2Y8GA 4L6EA 5DIFB 4YONA 4CHJA 2D2QA 1GG3A 1EGXA 2R2YA 5IRSA 1MI1A 3AU4A 3CIKA 3QWMA 1V61A 2NMBA 5DH9B 2EMSA 3F5RA 1J0WA 3QBVB 2D9XA 2ZPYA 2I1JA 2L1CA 1KZGA 4GZUA 2M14A 3VIAA 3X23A 2LULA 1FOEA 4PNKA 4QJ4B 2W2WA 3ODWA 3N7CA 2GS0A 4HB2B 4DX8A 1WGUA 2D10A 1UNQA 3HSAA 1I7AA 2VRWB 3GYOA 1H10A 2I5FA 2YT1A 2DX1A 2H7DA 3T06A 3SO6A 3ZDTA 1DYNA 1GC6A 2Z0PA 3TFMA 4F7GA 2COFA 4A6KA 1KI1B 1XX0A 1AWEA 5JHHA 5KQ4A 4EJNA 2EJ8A 3HW2B 2DTCA 4MT7A 2K2JA 4K2OA 1X86A 1X1GA 1EAZA 2YS5A 4QJ5B 4HAUB 5FI0A 2COAA 5FI1A 1FHOA 5C5BB 1DROA 2Z13A 3A98B 5DHAB 4A6HA 4TYZA 3FEHA 2LOXA 4WVFB 5DI9B 3F0WA 1LB1A 4EKUA 4HB4B 2KCJA 2UZSA 4CYEA 1PMSA 4L1RA 4EMOA 4KAXB 2RNRB 1RRPB 4HHVA 2W2XD 4NY0A 5KCVA 4MK0A 2LYDA 2J0JA 1Z87A 2CODA 2RGNB 2DFKA 1WGQA 3ODXA 1W1HA 1M7RA 2I1KA 1U5FA 3PZDA 4DBBA 3PP2A 3TVVA 5EFXA 2ELAA 3FSSA 3HK0A 1V88A 4DXAB 2IYBA 2VSZA 1K5GB 4A6FB 3RCPA 3ODOA 3D8FA 4XWXA 4C0AA 4F7HA 3DXDA 3DXEA 3PSCA 2CY4A 2UVMA 2MKRA 3SUZA 2FJUB 5HE3A 2R09A 2KGXB 1FB8A 1NTVA 3SV1A 3ULCA 5HE1A 1V5PA 1X1FA 2YRYA 3PG7A 4HAYB 2Z14A 2RUKB 2ROVA 2MDXA 1U5EA 1BTNA 2QKLA 3WA0A 1P3RA 2D9VA 4DIXA 5JP4A 5C16A 4K17A 2RVBB 4D0NB 2H7EA 1W1DA 4A5KA 5L81A 1FGZA 2N0YA 5HE0A 4Y94A 4HAWB 2P0FA 2HTHB 1WJMA 4IOYX 5CLQB 2ROZB 2RRFA 1FAOA 1IRSA 2EMTA 2G35A 3PVUA 1FHWA 2CAYA 3A8PA 4HAXB 2PZ1A 1B55A 1U29A 2L2IA 3P7ZA 2AL6A 5C79A
chains in the Genus database with same CATH topology
4KVGB 5CLLB 2YS3A 1AQCA 2P0HA 3O96A 3ZVRA 3QIJA 4Z2NA 3PVLA 2XQNM 2K2UA 1MK7B 1XODA 2MWNB 3U8ZA 1MK9B 3KRXA 2Y8FA 2DHIA 1WJ1A 1ZVRA 1MKEA 2YSZA 1X11A 2DYNA 3OANA 5LONB 1UPRA 2K00A 3D8DA 4ZRIA 4GMVA 3BJIA 1NU2A 4GN1A 2OQBA 1PFJA 5D3VA 1Q67A 3TO1A 2DYQA 4KHBB 1ZC3B 3ML4A 1LW3A 3KRWA 2NZ8B 3KSYA 4P7IA 1DDMA 1ISNA 1U2BA 2FJLA 2DX5A 1NI2A 2YS1A 4H8SA 2ADZA 1X05A 4KHAA 4PQ0A 4IAPA 5DHFB 2D9YA 1PLSA 2X18A 3M1IB 2YT0A 1GC7A 2ELBA 1OY2A 1BTKA 1P6SA 1MPHA 2DHKA 4KHOA 4TKNA 1SGHA 1EVHA 2E2XA 3PEGA 3MDBC 1K5DB 4Z2MB 2D9ZA 5C5BA 4YL8A 1NTYA 2OTXA 2DKPA 3SYXA 4HB3B 1TJ6A 1DBHA 2D9WA 3SNHA 1U5GA 1OMWA 5JHGA 5C6RA 2LOZA 1FHXA 1QQGA 5HE2A 3BINA 2V76A 2R0DA 1W1GA 1Y19B 4ZRJA 2UZRA 4MY6A 1UNRA 2COCA 5J3TA 2HE7A 3IVFA 5D3XA 3NSUA 5J3YA 4A6FA 2J0KA 2BCJA 3U7DA 5KQ1A 1XR0B 2LG1A 2RLOA 4HATB 1EF1A 2MFQA 2GJYA 3D8EA 1H4RA 3UZTA 3G9WA 1BAKA 2JP2A 2CY5A 2YF0A 3ULBA 2D11A 5D27A 3GYPA 5LOPB 1SHCA 1V89A 3HQCA 2IFSA 3CXBB 1OQNA 4DX90 5J3QA 2Z0OA 4GMXB 1RJ2A 2DLWA 4ZRKA 4CHMA 3AJ4A 4HDQA 2J59M 1N3HA 3VOQA 2EC1A 2W2XC 4NSWA 3FM8C 1UEFA 2I5CA 2Z0QA 1TQZA 1MIZB 3P6AA 5JLJB 1V5UA 1TXDA 1ZC4B 2KUPA 3TCAA 3TW1A 4WSFA 1BWNA 3MPXA 5D3YA 3A8QA 2YVCA 1MAIA 4BBKA 3KZ1A 1ZM0A 2DHJA 3KY9A 1KZ7A 3PVWA 1I2HA 4HAVB 1FGYA 5D3WA 4HB0B 2D4QA 2DN6A 2M38A 2RSGA 1E5WA 1UPQA 3LJUX 1XKEA 1U5DA 1J19A 1XCGA 2AEHA 1WVHA 2VKIA 2GCLA 2Y7BA 4IFSA 4WJ7A 5GOWB 1MIXA 2DKQA 4B6HA 2LKOA 2CRFA 1U27A 1DDVA 4HDOA 4F7UP 2P0DA 2N23A 2J0MA 1XD4A 1Y5OA 4HAZB 1WI1A 3DXCA 1V5MA 4GXBA 2DA0A 2P8VA 1DDWA 3WYFB 4GPTB 3V5WA 1M7EA 2Q13A 1P5TA 2QKMA 1UNPA 1WG7A 3AU5A 4K81A 1ZSQA 1QC6A 4K2PA 2GCJA 2Y8GA 4L6EA 5DIFB 4YONA 4CHJA 2D2QA 1GG3A 1EGXA 3AU4A 3CIKA 3QWMA 1V61A 2NMBA 5DH9B 2EMSA 3F5RA 1J0WA 3QBVB 2D9XA 2ZPYA 2I1JA 2L1CA 1KZGA 4GZUA 2M14A 3VIAA 3X23A 2LULA 1FOEA 4PNKA 2W2WA 3ODWA 3N7CA 2GS0A 4HB2B 4DX8A 1WGUA 2D10A 1UNQA 1I7AA 2VRWB 3GYOA 1H10A 2I5FA 2YT1A 2DX1A 2H7DA 3T06A 3SO6A 3ZDTA 1DYNA 1GC6A 2Z0PA 3TFMA 4F7GA 2COFA 4A6KA 1KI1B 1XX0A 1AWEA 5JHHA 5KQ4A 4EJNA 2EJ8A 3HW2B 2DTCA 4MT7A 2K2JA 4K2OA 1X86A 1X1GA 1EAZA 2YS5A 4HAUB 5FI0A 2COAA 5FI1A 1FHOA 5C5BB 1DROA 3A98B 5DHAB 4A6HA 4TYZA 3FEHA 2LOXA 4WVFB 5DI9B 3F0WA 1LB1A 4EKUA 4HB4B 2KCJA 2UZSA 4CYEA 1PMSA 4EMOA 4KAXB 2RNRB 1RRPB 4HHVA 2W2XD 4NY0A 5KCVA 4MK0A 2LYDA 2J0JA 1Z87A 2CODA 2RGNB 2DFKA 1WGQA 3ODXA 1W1HA 1M7RA 2I1KA 1U5FA 3PZDA 4DBBA 3PP2A 3TVVA 5EFXA 2ELAA 3FSSA 3HK0A 1V88A 4DXAB 2IYBA 2VSZA 1K5GB 4A6FB 3RCPA 3ODOA 3D8FA 4XWXA 4C0AA 4F7HA 3DXDA 3DXEA 3PSCA 2CY4A 2UVMA 2MKRA 3SUZA 5HE3A 2R09A 2KGXB 1FB8A 1NTVA 3SV1A 3ULCA 5HE1A 1V5PA 1X1FA 2YRYA 3PG7A 4HAYB 2RUKB 2ROVA 2MDXA 1U5EA 1BTNA 2QKLA 3WA0A 1P3RA 2D9VA 5JP4A 5C16A 4K17A 2RVBB 4D0NB 2H7EA 1W1DA 4A5KA 5L81A 1FGZA 2N0YA 5HE0A 4Y94A 4HAWB 2P0FA 2HTHB 1WJMA 4IOYX 5CLQB 2ROZB 1FAOA 1IRSA 2EMTA 2G35A 3PVUA 1FHWA 2CAYA 3A8PA 4HAXB 2PZ1A 1B55A 1U29A 2L2IA 3P7ZA 2AL6A 5C79A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KVG B;  5CLL B;  2YS3 A;  1AQC A;  2P0H A;  3O96 A;  3ZVR A;  3QIJ A;  4Z2N A;  3PVL A;  2XQN M;  2K2U A;  1MK7 B;  1XOD A;  2MWN B;  3U8Z A;  1MK9 B;  3KRX A;  2Y8F A;  2DHI A;  1WJ1 A;  1ZVR A;  1MKE A;  2YSZ A;  1X11 A;  2DYN A;  3OAN A;  5LON B;  1UPR A;  2K00 A;  3D8D A;  4ZRI A;  4GMV A;  3BJI A;  1NU2 A;  4GN1 A;  2OQB A;  1PFJ A;  5D3V A;  1Q67 A;  3TO1 A;  2DYQ A;  4KHB B;  1ZC3 B;  3ML4 A;  1LW3 A;  3KRW A;  2NZ8 B;  3KSY A;  4P7I A;  1DDM A;  1ISN A;  1U2B A;  2FJL A;  2DX5 A;  1NI2 A;  2YS1 A;  4H8S A;  2ADZ A;  1X05 A;  4KHA A;  4PQ0 A;  4IAP A;  5DHF B;  2D9Y A;  1PLS A;  2X18 A;  3M1I B;  2YT0 A;  1GC7 A;  2ELB A;  1OY2 A;  1BTK A;  1P6S A;  1MPH A;  2DHK A;  4KHO A;  4TKN A;  1SGH A;  1EVH A;  2E2X A;  3PEG A;  3MDB C;  1K5D B;  4Z2M B;  2D9Z A;  5C5B A;  4YL8 A;  1NTY A;  2OTX A;  2DKP A;  3SYX A;  4HB3 B;  1TJ6 A;  1DBH A;  2D9W A;  3SNH A;  1U5G A;  1OMW A;  5JHG A;  5C6R A;  2LOZ A;  1FHX A;  1QQG A;  5HE2 A;  3BIN A;  2V76 A;  2R0D A;  1W1G A;  1Y19 B;  4ZRJ A;  2UZR A;  4MY6 A;  1UNR A;  2COC A;  5J3T A;  2HE7 A;  3IVF A;  5D3X A;  3NSU A;  5J3Y A;  4A6F A;  2J0K A;  2BCJ A;  3U7D A;  5KQ1 A;  1XR0 B;  2LG1 A;  2RLO A;  4HAT B;  1EF1 A;  2MFQ A;  2GJY A;  3D8E A;  1H4R A;  3UZT A;  3G9W A;  1BAK A;  2JP2 A;  2CY5 A;  2YF0 A;  3ULB A;  2D11 A;  5D27 A;  3GYP A;  5LOP B;  1SHC A;  1V89 A;  3HQC A;  2IFS A;  3CXB B;  1OQN A;  4DX9 0;  5J3Q A;  2Z0O A;  4GMX B;  1RJ2 A;  2DLW A;  4ZRK A;  4CHM A;  3AJ4 A;  4HDQ A;  2J59 M;  1N3H A;  3VOQ A;  2EC1 A;  2W2X C;  4NSW A;  3FM8 C;  1UEF A;  2I5C A;  2Z0Q A;  1TQZ A;  1MIZ B;  3P6A A;  5JLJ B;  1V5U A;  1TXD A;  1ZC4 B;  2KUP A;  3TCA A;  3TW1 A;  4WSF A;  1BWN A;  3MPX A;  5D3Y A;  3A8Q A;  2YVC A;  1MAI A;  4BBK A;  3KZ1 A;  1ZM0 A;  2DHJ A;  3KY9 A;  1KZ7 A;  3PVW A;  1I2H A;  4HAV B;  1FGY A;  5D3W A;  4HB0 B;  2D4Q A;  2DN6 A;  2M38 A;  2RSG A;  1E5W A;  1UPQ A;  3LJU X;  1XKE A;  1U5D A;  1J19 A;  1XCG A;  2AEH A;  1WVH A;  2VKI A;  2GCL A;  2Y7B A;  4IFS A;  4WJ7 A;  5GOW B;  1MIX A;  2DKQ A;  4B6H A;  2LKO A;  2CRF A;  1U27 A;  1DDV A;  4HDO A;  4F7U P;  2P0D A;  2N23 A;  2J0M A;  1XD4 A;  1Y5O A;  4HAZ B;  1WI1 A;  3DXC A;  1V5M A;  4GXB A;  2DA0 A;  2P8V A;  1DDW A;  3WYF B;  4GPT B;  3V5W A;  1M7E A;  2Q13 A;  1P5T A;  2QKM A;  1UNP A;  1WG7 A;  3AU5 A;  4K81 A;  1ZSQ A;  1QC6 A;  4K2P A;  2GCJ A;  2Y8G A;  4L6E A;  5DIF B;  4YON A;  4CHJ A;  2D2Q A;  1GG3 A;  1EGX A;  3AU4 A;  3CIK A;  3QWM A;  1V61 A;  2NMB A;  5DH9 B;  2EMS A;  3F5R A;  1J0W A;  3QBV B;  2D9X A;  2ZPY A;  2I1J A;  2L1C A;  1KZG A;  4GZU A;  2M14 A;  3VIA A;  3X23 A;  2LUL A;  1FOE A;  4PNK A;  2W2W A;  3ODW A;  3N7C A;  2GS0 A;  4HB2 B;  4DX8 A;  1WGU A;  2D10 A;  1UNQ A;  1I7A A;  2VRW B;  3GYO A;  1H10 A;  2I5F A;  2YT1 A;  2DX1 A;  2H7D A;  3T06 A;  3SO6 A;  3ZDT A;  1DYN A;  1GC6 A;  2Z0P A;  3TFM A;  4F7G A;  2COF A;  4A6K A;  1KI1 B;  1XX0 A;  1AWE A;  5JHH A;  5KQ4 A;  4EJN A;  2EJ8 A;  3HW2 B;  2DTC A;  4MT7 A;  2K2J A;  4K2O A;  1X86 A;  1X1G A;  1EAZ A;  2YS5 A;  4HAU B;  5FI0 A;  2COA A;  5FI1 A;  1FHO A;  5C5B B;  1DRO A;  3A98 B;  5DHA B;  4A6H A;  4TYZ A;  3FEH A;  2LOX A;  4WVF B;  5DI9 B;  3F0W A;  1LB1 A;  4EKU A;  4HB4 B;  2KCJ A;  2UZS A;  4CYE A;  1PMS A;  4EMO A;  4KAX B;  2RNR B;  1RRP B;  4HHV A;  2W2X D;  4NY0 A;  5KCV A;  4MK0 A;  2LYD A;  2J0J A;  1Z87 A;  2COD A;  2RGN B;  2DFK A;  1WGQ A;  3ODX A;  1W1H A;  1M7R A;  2I1K A;  1U5F A;  3PZD A;  4DBB A;  3PP2 A;  3TVV A;  5EFX A;  2ELA A;  3FSS A;  3HK0 A;  1V88 A;  4DXA B;  2IYB A;  2VSZ A;  1K5G B;  4A6F B;  3RCP A;  3ODO A;  3D8F A;  4XWX A;  4C0A A;  4F7H A;  3DXD A;  3DXE A;  3PSC A;  2CY4 A;  2UVM A;  2MKR A;  3SUZ A;  5HE3 A;  2R09 A;  2KGX B;  1FB8 A;  1NTV A;  3SV1 A;  3ULC A;  5HE1 A;  1V5P A;  1X1F A;  2YRY A;  3PG7 A;  4HAY B;  2RUK B;  2ROV A;  2MDX A;  1U5E A;  1BTN A;  2QKL A;  3WA0 A;  1P3R A;  2D9V A;  5JP4 A;  5C16 A;  4K17 A;  2RVB B;  4D0N B;  2H7E A;  1W1D A;  4A5K A;  5L81 A;  1FGZ A;  2N0Y A;  5HE0 A;  4Y94 A;  4HAW B;  2P0F A;  2HTH B;  1WJM A;  4IOY X;  5CLQ B;  2ROZ B;  1FAO A;  1IRS A;  2EMT A;  2G35 A;  3PVU A;  1FHW A;  2CAY A;  3A8P A;  4HAX B;  2PZ1 A;  1B55 A;  1U29 A;  2L2I A;  3P7Z A;  2AL6 A;  5C79 A; 
#chains in the Genus database with same CATH topology
 4KVG B;  5CLL B;  2KIE A;  1AQC A;  2YS3 A;  2P0H A;  3O96 A;  3ZVR A;  3QIJ A;  4Z2N A;  3PVL A;  2XQN M;  2K2U A;  1MK7 B;  1XOD A;  2MWN B;  3U8Z A;  1MK9 B;  3KRX A;  3U12 A;  2Y8F A;  2DHI A;  1WJ1 A;  1ZVR A;  4OT1 A;  1MKE A;  2YSZ A;  1X11 A;  2DYN A;  3OAN A;  5LON B;  1UPR A;  3NW8 A;  2K00 A;  3D8D A;  4ZRI A;  4GMV A;  2Z4D A;  3BJI A;  1NU2 A;  4GN1 A;  5I2M A;  2OQB A;  1PFJ A;  5D3V A;  1Q67 A;  3TO1 A;  2DYQ A;  4KHB B;  1ZC3 B;  3ML4 A;  1LW3 A;  3KRW A;  2NZ8 B;  3KSY A;  4P7I A;  1DDM A;  1ISN A;  1U2B A;  2FJL A;  2DX5 A;  1NI2 A;  2YS1 A;  4H8S A;  2ADZ A;  1X05 A;  4KHA A;  4PQ0 A;  4IAP A;  5DHF B;  2D9Y A;  1PLS A;  2X18 A;  3M1I B;  2YT0 A;  1GC7 A;  2ELB A;  3NWA A;  1OY2 A;  1BTK A;  1P6S A;  1MPH A;  2DHK A;  1T77 A;  4KHO A;  4TKN A;  2NBV A;  1SGH A;  1EVH A;  2E2X A;  3PEG A;  3MDB C;  1K5D B;  4Z2M B;  2D9Z A;  5C5B A;  4YL8 A;  1NTY A;  2OTX A;  2DKP A;  3SYX A;  4HB3 B;  1TJ6 A;  4QXA B;  1DBH A;  2D9W A;  3SNH A;  1U5G A;  2KIG A;  1OMW A;  5JHG A;  5C6R A;  2LOZ A;  1FHX A;  1QQG A;  5HE2 A;  2GUM A;  3BIN A;  3OHM B;  2YT2 A;  2V76 A;  2R0D A;  1W1G A;  4CSQ A;  4HSI A;  1Y19 B;  4ZRJ A;  2KUQ A;  2UZR A;  2Z59 A;  4MY6 A;  1UNR A;  2KR0 A;  2COC A;  5J3T A;  2HE7 A;  3IVF A;  5D3X A;  3NSU A;  5J3Y A;  4A6F A;  3NWD A;  2J0K A;  2BCJ A;  3U7D A;  5KQ1 A;  1XR0 B;  2LG1 A;  2RLO A;  4HAT B;  1EF1 A;  3DCX A;  2MFQ A;  2GJY A;  4GOU A;  3D8E A;  1H4R A;  3UZT A;  3G9W A;  1BAK A;  2JP2 A;  2CY5 A;  2YF0 A;  3ULB A;  3A58 A;  2D11 A;  5D27 A;  3GYP A;  5LOP B;  5M4Y B;  1SHC A;  1V89 A;  3CXB B;  3HQC A;  2IFS A;  1OQN A;  4DX9 0;  5J3Q A;  2Z0O A;  2K49 A;  4GMX B;  1RJ2 A;  2DLW A;  4ZRK A;  4CHM A;  3AJ4 A;  3FVC A;  4HDQ A;  2J59 M;  1N3H A;  3VOQ A;  2EC1 A;  2W2X C;  4NSW A;  3FM8 C;  1UEF A;  2I5C A;  2Z0Q A;  1TQZ A;  1MIZ B;  3P6A A;  5JLJ B;  1V5U A;  1TXD A;  1ZC4 B;  2KUP A;  5LG4 B;  3TCA A;  3TW1 A;  4WSF A;  1BWN A;  3MPX A;  5D3Y A;  3A8Q A;  2YVC A;  1MAI A;  3HIE A;  3KZ1 A;  4BBK A;  1ZM0 A;  2DHJ A;  1ZYI A;  3KY9 A;  1KZ7 A;  3PVW A;  1I2H A;  4HAV B;  5I2S A;  1FGY A;  5D3W A;  4HB0 B;  2D4Q A;  2DN6 A;  2M38 A;  2RSG A;  1E5W A;  1UPQ A;  3LJU X;  1XKE A;  1J19 A;  1U5D A;  3NWF A;  4GNK B;  1XCG A;  2AEH A;  2ZKM X;  1WVH A;  2VKI A;  2GCL A;  2Y7B A;  4IFS A;  4WJ7 A;  5GOW B;  1MIX A;  2DKQ A;  4B6H A;  2LKO A;  2CRF A;  1U27 A;  1DDV A;  4HDO A;  4F7U P;  4OSN A;  2P0D A;  2N23 A;  2J0M A;  1XD4 A;  1Y5O A;  4HAZ B;  1WI1 A;  3DXC A;  1V5M A;  4GXB A;  2DA0 A;  2P8V A;  4QJ3 B;  1DDW A;  3WYF B;  4GPT B;  3V5W A;  4D6W A;  1M7E A;  2Q13 A;  1P5T A;  2QKM A;  1UNP A;  4KHB A;  3B77 A;  1WG7 A;  3AU5 A;  4K81 A;  2K8E A;  1ZSQ A;  1QC6 A;  4K2P A;  2GCJ A;  2Y8G A;  4L6E A;  5DIF B;  4YON A;  4CHJ A;  2D2Q A;  1GG3 A;  1EGX A;  2R2Y A;  5IRS A;  1MI1 A;  3AU4 A;  3CIK A;  3QWM A;  1V61 A;  2NMB A;  5DH9 B;  2EMS A;  3F5R A;  1J0W A;  3QBV B;  2D9X A;  2ZPY A;  2I1J A;  2L1C A;  1KZG A;  4GZU A;  2M14 A;  3VIA A;  3X23 A;  2LUL A;  1FOE A;  4PNK A;  4QJ4 B;  2W2W A;  3ODW A;  3N7C A;  2GS0 A;  4HB2 B;  4DX8 A;  1WGU A;  2D10 A;  1UNQ A;  3HSA A;  1I7A A;  2VRW B;  3GYO A;  1H10 A;  2I5F A;  2YT1 A;  2DX1 A;  2H7D A;  3T06 A;  3SO6 A;  3ZDT A;  1DYN A;  1GC6 A;  2Z0P A;  3TFM A;  4F7G A;  2COF A;  4A6K A;  1KI1 B;  1XX0 A;  1AWE A;  5JHH A;  5KQ4 A;  4EJN A;  2EJ8 A;  3HW2 B;  2DTC A;  4MT7 A;  2K2J A;  4K2O A;  1X86 A;  1X1G A;  1EAZ A;  2YS5 A;  4QJ5 B;  4HAU B;  5FI0 A;  2COA A;  5FI1 A;  1FHO A;  5C5B B;  1DRO A;  2Z13 A;  3A98 B;  5DHA B;  4A6H A;  4TYZ A;  3FEH A;  2LOX A;  4WVF B;  5DI9 B;  3F0W A;  1LB1 A;  4EKU A;  4HB4 B;  2KCJ A;  2UZS A;  4CYE A;  1PMS A;  4L1R A;  4EMO A;  4KAX B;  2RNR B;  1RRP B;  4HHV A;  2W2X D;  4NY0 A;  5KCV A;  4MK0 A;  2LYD A;  2J0J A;  1Z87 A;  2COD A;  2RGN B;  2DFK A;  1WGQ A;  3ODX A;  1W1H A;  1M7R A;  2I1K A;  1U5F A;  3PZD A;  4DBB A;  3PP2 A;  3TVV A;  5EFX A;  2ELA A;  3FSS A;  3HK0 A;  1V88 A;  4DXA B;  2IYB A;  2VSZ A;  1K5G B;  4A6F B;  3RCP A;  3ODO A;  3D8F A;  4XWX A;  4C0A A;  4F7H A;  3DXD A;  3DXE A;  3PSC A;  2CY4 A;  2UVM A;  2MKR A;  3SUZ A;  2FJU B;  5HE3 A;  2R09 A;  2KGX B;  1FB8 A;  1NTV A;  3SV1 A;  3ULC A;  5HE1 A;  1V5P A;  1X1F A;  2YRY A;  3PG7 A;  4HAY B;  2Z14 A;  2RUK B;  2ROV A;  2MDX A;  1U5E A;  1BTN A;  2QKL A;  3WA0 A;  1P3R A;  2D9V A;  4DIX A;  5JP4 A;  5C16 A;  4K17 A;  2RVB B;  4D0N B;  2H7E A;  1W1D A;  4A5K A;  5L81 A;  1FGZ A;  2N0Y A;  5HE0 A;  4Y94 A;  4HAW B;  2P0F A;  2HTH B;  1WJM A;  4IOY X;  5CLQ B;  2ROZ B;  2RRF A;  1FAO A;  1IRS A;  2EMT A;  2G35 A;  3PVU A;  1FHW A;  2CAY A;  3A8P A;  4HAX B;  2PZ1 A;  1B55 A;  1U29 A;  2L2I A;  3P7Z A;  2AL6 A;  5C79 A; 
#chains in the Genus database with same CATH homology
 4KVG B;  5CLL B;  2YS3 A;  1AQC A;  2P0H A;  3O96 A;  3ZVR A;  3QIJ A;  4Z2N A;  3PVL A;  2XQN M;  2K2U A;  1MK7 B;  1XOD A;  2MWN B;  3U8Z A;  1MK9 B;  3KRX A;  2Y8F A;  2DHI A;  1WJ1 A;  1ZVR A;  1MKE A;  2YSZ A;  1X11 A;  2DYN A;  3OAN A;  5LON B;  1UPR A;  2K00 A;  3D8D A;  4ZRI A;  4GMV A;  3BJI A;  1NU2 A;  4GN1 A;  2OQB A;  1PFJ A;  5D3V A;  1Q67 A;  3TO1 A;  2DYQ A;  4KHB B;  1ZC3 B;  3ML4 A;  1LW3 A;  3KRW A;  2NZ8 B;  3KSY A;  4P7I A;  1DDM A;  1ISN A;  1U2B A;  2FJL A;  2DX5 A;  1NI2 A;  2YS1 A;  4H8S A;  2ADZ A;  1X05 A;  4KHA A;  4PQ0 A;  4IAP A;  5DHF B;  2D9Y A;  1PLS A;  2X18 A;  3M1I B;  2YT0 A;  1GC7 A;  2ELB A;  1OY2 A;  1BTK A;  1P6S A;  1MPH A;  2DHK A;  4KHO A;  4TKN A;  1SGH A;  1EVH A;  2E2X A;  3PEG A;  3MDB C;  1K5D B;  4Z2M B;  2D9Z A;  5C5B A;  4YL8 A;  1NTY A;  2OTX A;  2DKP A;  3SYX A;  4HB3 B;  1TJ6 A;  1DBH A;  2D9W A;  3SNH A;  1U5G A;  1OMW A;  5JHG A;  5C6R A;  2LOZ A;  1FHX A;  1QQG A;  5HE2 A;  3BIN A;  2V76 A;  2R0D A;  1W1G A;  1Y19 B;  4ZRJ A;  2UZR A;  4MY6 A;  1UNR A;  2COC A;  5J3T A;  2HE7 A;  3IVF A;  5D3X A;  3NSU A;  5J3Y A;  4A6F A;  2J0K A;  2BCJ A;  3U7D A;  5KQ1 A;  1XR0 B;  2LG1 A;  2RLO A;  4HAT B;  1EF1 A;  2MFQ A;  2GJY A;  3D8E A;  1H4R A;  3UZT A;  3G9W A;  1BAK A;  2JP2 A;  2CY5 A;  2YF0 A;  3ULB A;  2D11 A;  5D27 A;  3GYP A;  5LOP B;  1SHC A;  1V89 A;  3HQC A;  2IFS A;  3CXB B;  1OQN A;  4DX9 0;  5J3Q A;  2Z0O A;  4GMX B;  1RJ2 A;  2DLW A;  4ZRK A;  4CHM A;  3AJ4 A;  4HDQ A;  2J59 M;  1N3H A;  3VOQ A;  2EC1 A;  2W2X C;  4NSW A;  3FM8 C;  1UEF A;  2I5C A;  2Z0Q A;  1TQZ A;  1MIZ B;  3P6A A;  5JLJ B;  1V5U A;  1TXD A;  1ZC4 B;  2KUP A;  3TCA A;  3TW1 A;  4WSF A;  1BWN A;  3MPX A;  5D3Y A;  3A8Q A;  2YVC A;  1MAI A;  4BBK A;  3KZ1 A;  1ZM0 A;  2DHJ A;  3KY9 A;  1KZ7 A;  3PVW A;  1I2H A;  4HAV B;  1FGY A;  5D3W A;  4HB0 B;  2D4Q A;  2DN6 A;  2M38 A;  2RSG A;  1E5W A;  1UPQ A;  3LJU X;  1XKE A;  1U5D A;  1J19 A;  1XCG A;  2AEH A;  1WVH A;  2VKI A;  2GCL A;  2Y7B A;  4IFS A;  4WJ7 A;  5GOW B;  1MIX A;  2DKQ A;  4B6H A;  2LKO A;  2CRF A;  1U27 A;  1DDV A;  4HDO A;  4F7U P;  2P0D A;  2N23 A;  2J0M A;  1XD4 A;  1Y5O A;  4HAZ B;  1WI1 A;  3DXC A;  1V5M A;  4GXB A;  2DA0 A;  2P8V A;  1DDW A;  3WYF B;  4GPT B;  3V5W A;  1M7E A;  2Q13 A;  1P5T A;  2QKM A;  1UNP A;  1WG7 A;  3AU5 A;  4K81 A;  1ZSQ A;  1QC6 A;  4K2P A;  2GCJ A;  2Y8G A;  4L6E A;  5DIF B;  4YON A;  4CHJ A;  2D2Q A;  1GG3 A;  1EGX A;  3AU4 A;  3CIK A;  3QWM A;  1V61 A;  2NMB A;  5DH9 B;  2EMS A;  3F5R A;  1J0W A;  3QBV B;  2D9X A;  2ZPY A;  2I1J A;  2L1C A;  1KZG A;  4GZU A;  2M14 A;  3VIA A;  3X23 A;  2LUL A;  1FOE A;  4PNK A;  2W2W A;  3ODW A;  3N7C A;  2GS0 A;  4HB2 B;  4DX8 A;  1WGU A;  2D10 A;  1UNQ A;  1I7A A;  2VRW B;  3GYO A;  1H10 A;  2I5F A;  2YT1 A;  2DX1 A;  2H7D A;  3T06 A;  3SO6 A;  3ZDT A;  1DYN A;  1GC6 A;  2Z0P A;  3TFM A;  4F7G A;  2COF A;  4A6K A;  1KI1 B;  1XX0 A;  1AWE A;  5JHH A;  5KQ4 A;  4EJN A;  2EJ8 A;  3HW2 B;  2DTC A;  4MT7 A;  2K2J A;  4K2O A;  1X86 A;  1X1G A;  1EAZ A;  2YS5 A;  4HAU B;  5FI0 A;  2COA A;  5FI1 A;  1FHO A;  5C5B B;  1DRO A;  3A98 B;  5DHA B;  4A6H A;  4TYZ A;  3FEH A;  2LOX A;  4WVF B;  5DI9 B;  3F0W A;  1LB1 A;  4EKU A;  4HB4 B;  2KCJ A;  2UZS A;  4CYE A;  1PMS A;  4EMO A;  4KAX B;  2RNR B;  1RRP B;  4HHV A;  2W2X D;  4NY0 A;  5KCV A;  4MK0 A;  2LYD A;  2J0J A;  1Z87 A;  2COD A;  2RGN B;  2DFK A;  1WGQ A;  3ODX A;  1W1H A;  1M7R A;  2I1K A;  1U5F A;  3PZD A;  4DBB A;  3PP2 A;  3TVV A;  5EFX A;  2ELA A;  3FSS A;  3HK0 A;  1V88 A;  4DXA B;  2IYB A;  2VSZ A;  1K5G B;  4A6F B;  3RCP A;  3ODO A;  3D8F A;  4XWX A;  4C0A A;  4F7H A;  3DXD A;  3DXE A;  3PSC A;  2CY4 A;  2UVM A;  2MKR A;  3SUZ A;  5HE3 A;  2R09 A;  2KGX B;  1FB8 A;  1NTV A;  3SV1 A;  3ULC A;  5HE1 A;  1V5P A;  1X1F A;  2YRY A;  3PG7 A;  4HAY B;  2RUK B;  2ROV A;  2MDX A;  1U5E A;  1BTN A;  2QKL A;  3WA0 A;  1P3R A;  2D9V A;  5JP4 A;  5C16 A;  4K17 A;  2RVB B;  4D0N B;  2H7E A;  1W1D A;  4A5K A;  5L81 A;  1FGZ A;  2N0Y A;  5HE0 A;  4Y94 A;  4HAW B;  2P0F A;  2HTH B;  1WJM A;  4IOY X;  5CLQ B;  2ROZ B;  1FAO A;  1IRS A;  2EMT A;  2G35 A;  3PVU A;  1FHW A;  2CAY A;  3A8P A;  4HAX B;  2PZ1 A;  1B55 A;  1U29 A;  2L2I A;  3P7Z A;  2AL6 A;  5C79 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...