3HW2B

Crystal structure of the sifa-skip(ph) complex
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
105
structure length
105
Chain Sequence
b'TITKEGMLHYKAGTSYLGKEHWKTCFVVLSNGILYQYPDRTDVIPLLSVNMGGEQCGGCRRANTTDRPHAFQVILSDRPCLELSAESEAEMAEWMQHLCQAVSKG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Protein sifA
publication title Interaction between the SifA virulence factor and its host target skip is essential for salmonella pathogenesis
pubmed doi rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium
molecule tags Signaling protein
total genus 16
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2009-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3hw2B00
1V5MA 2VSZA 2DKPA 3PG7A 4MK0A 5JHHA 1XX0A 2DX5A 3SUZA 1AQCA 3X23A 3M1IB 3BJIA 4C0AA 2H7DA 3SO6A 5D3YA 2DHIA 1QC6A 2Y8GA 4EJNA 1DDWA 2R09A 5DHAB 3VOQA 1XODA 1MIZB 2N0YA 3SYXA 2ELAA 2RVBB 1XKEA 5D27A 3PVUA 1UNPA 1PMSA 2KUPA 1ZM0A 4D0NB 4TKNA 1PLSA 1P3RA 2EJ8A 2LKOA 4H8SA 1X1GA 1RRPB 3A98B 3TVVA 2GS0A 2ADZA 5HE3A 2EC1A 2BCJA 5HE0A 2QKLA 2DA0A 5C16A 4KVGB 5FI1A 1J19A 3VIAA 4DX8A 5C6RA 4GMVA 4HB2B 3MPXA 1GC7A 1I2HA 4HDQA 1AWEA 4KHAA 4IOYX 1PFJA 2EMTA 3D8FA 1FAOA 4A6FB 5HE1A 4MT7A 1U2BA 2D11A 2W2XD 5CLLB 1IRSA 4KHBB 3SNHA 1U29A 2DYQA 2J59M 4XWXA 2P8VA 1OMWA 2CY5A 3U8ZA 2JP2A 2ROZB 3F0WA 3F5RA 1KZGA 2CY4A 2UVMA 1BTNA 1TJ6A 2G35A 3MDBC 2YVCA 1DYNA 4P7IA 2VKIA 4A6HA 2HE7A 3ZDTA 2MWNB 1H4RA 1WGQA 2J0MA 4K81A 2X18A 4HAUB 2DX1A 4Z2MB 1ZSQA 1H10A 3QBVB 2RNRB 1X11A 1Q67A 5D3WA 1W1DA 2RUKB 4PNKA 2VRWB 4Y94A 3PSCA 1K5GB 4EKUA 1DDMA 1X86A 1Y19B 5D3XA 5DIFB 2M38A 4KHOA 4ZRJA 2KGXB 2GCLA 2J0KA 4HDOA 4YONA 1UEFA 5KQ1A 2ROVA 1U27A 5C5BB 3QIJA 2LULA 2DHKA 3P6AA 1GC6A 2N23A 3FEHA 1TQZA 1P6SA 4HAVB 2UZSA 1TXDA 3ODOA 1WJ1A 1WGUA 1XR0B 3LJUX 1SHCA 4B6HA 3OANA 4BBKA 4WVFB 1DDVA 3WYFB 2YRYA 2V76A 1MKEA 2RSGA 4IFSA 1KI1B 4MY6A 3ODXA 2DLWA 2RGNB 2DTCA 1XCGA 4ZRIA 4CHMA 1GG3A 5J3YA 4Z2NA 1FHOA 4EMOA 1EAZA 4HAXB 4HB0B 3CIKA 1FB8A 5DHFB 1NTYA 1MPHA 2Z0OA 2DN6A 1RJ2A 3U7DA 1MK9B 3A8PA 3ML4A 2CAYA 2P0FA 2LOXA 3TW1A 2Z0PA 2YSZA 5JP4A 2DYNA 4GPTB 1BAKA 1Y5OA 3DXCA 4HHVA 3AU5A 3UZTA 4DXAB 3HW2B 2ZPYA 4GMXB 3T06A 2PZ1A 3NSUA 4K2PA 2I5FA 2K00A 4KAXB 2ELBA 2MKRA 3FSSA 4TYZA 5FI0A 1WG7A 2YS5A 3KY9A 1V89A 2Y7BA 1V61A 2D9YA 4A6FA 1NI2A 1E5WA 1XD4A 1ZC4B 3ULBA 1V5PA 2MFQA 3TO1A 1UNRA 4F7UP 2EMSA 3PVLA 1MIXA 3V5WA 3TFMA 3D8EA 3PEGA 2KCJA 1B55A 4YL8A 3BINA 5JHGA 4HATB 2QKMA 3A8QA 2H7EA 2I5CA 1NU2A 5GOWB 1BWNA 3SV1A 2UZRA 2W2XC 3QWMA 2D2QA 3DXDA 4F7GA 2M14A 1DBHA 3AU4A 3GYOA 3KRXA 3CXBB 4GN1A 2CODA 3PVWA 3ULCA 2COCA 3D8DA 2K2UA 2YS3A 3O96A 5L81A 2FJLA 1OY2A 1OQNA 1SGHA 2LG1A 2P0HA 2Q13A 2L1CA 5JLJB 2K2JA 1ZVRA 3HK0A 5DH9B 2IFSA 1FHXA 1WVHA 1FOEA 4NSWA 1M7EA 4WSFA 1DROA 1WI1A 2HTHB 1EVHA 3AJ4A 1V5UA 4CYEA 3FM8C 2AL6A 4HAYB 5C5BA 2DHJA 1ZC3B 2P0DA 2D4QA 2Z0QA 5HE2A 3RCPA 5KCVA 5J3TA 2COAA 1W1HA 1UPRA 2NZ8B 4NY0A 4F7HA 1N3HA 2YT0A 1UNQA 2OQBA 1Z87A 5LOPB 1J0WA 3KZ1A 1X1FA 3HQCA 1P5TA 2OTXA 5LONB 2D9ZA 4IAPA 2W2WA 1LW3A 3GYPA 4HAWB 3N7CA 2RLOA 2YS1A 3TCAA 4A5KA 2D9WA 2MDXA 4GZUA 2E2XA 2YT1A 2Y8FA 2LOZA 3ZVRA 1MK7B 1NTVA 1U5FA 3IVFA 1I7AA 4CHJA 1FGYA 1W1GA 2D9VA 1U5EA 2IYBA 1LB1A 4PQ0A 3P7ZA 3KRWA 2GCJA 2D10A 1FGZA 1EF1A 2CRFA 4HAZB 3PP2A 4ZRKA 1K5DB 5CLQB 2L2IA 5C79A 4L6EA 1V88A 4K17A 5J3QA 3G9WA 2YF0A 5EFXA 1EGXA 1WJMA 2D9XA 2R0DA 3PZDA 2NMBA 2GJYA 3ODWA 3KSYA 4A6KA 1QQGA 1M7RA 3WA0A 5DI9B 1MAIA 4HB4B 3DXEA 2XQNM 4K2OA 1BTKA 2I1JA 1X05A 2LYDA 1U5GA 2I1KA 2DKQA 2DFKA 1FHWA 1KZ7A 1UPQA 5KQ4A 2AEHA 4WJ7A 4DX90 4DBBA 4HB3B 1U5DA 2COFA 1ISNA 5D3VA 4GXBA 2J0JA
chains in the Genus database with same CATH superfamily
1V5MA 2VSZA 2DKPA 3PG7A 3B77A 4MK0A 5JHHA 1XX0A 4DIXA 2DX5A 3SUZA 1AQCA 3X23A 3M1IB 3BJIA 4C0AA 2H7DA 4GNKB 5D3YA 3SO6A 2DHIA 1QC6A 2Y8GA 4EJNA 1DDWA 2R09A 5DHAB 3VOQA 1XODA 1MIZB 2N0YA 3SYXA 1T77A 2ELAA 2RVBB 1XKEA 5D27A 3PVUA 1UNPA 1PMSA 2KUPA 1ZM0A 3OHMB 4D0NB 4TKNA 1PLSA 1P3RA 2EJ8A 2LKOA 2Z4DA 4H8SA 1X1GA 1RRPB 3A98B 3TVVA 2GS0A 2ADZA 5HE3A 2EC1A 2BCJA 2YT2A 5HE0A 2QKLA 2DA0A 5C16A 4KVGB 5FI1A 1J19A 3VIAA 4DX8A 5C6RA 4GMVA 4HB2B 3MPXA 1GC7A 1I2HA 4HDQA 3NWFA 1AWEA 4KHAA 4IOYX 1PFJA 2EMTA 3D8FA 1FAOA 4A6FB 5HE1A 4MT7A 1U2BA 2D11A 2W2XD 5CLLB 1IRSA 4KHBB 3SNHA 1U29A 2DYQA 2J59M 4XWXA 2P8VA 2FJUB 1OMWA 2CY5A 3U8ZA 2JP2A 2ROZB 3F0WA 3F5RA 1KZGA 4D6WA 2CY4A 2UVMA 1BTNA 1TJ6A 2G35A 3MDBC 2YVCA 1DYNA 4P7IA 2VKIA 4A6HA 2HE7A 3ZDTA 2MWNB 1H4RA 1WGQA 2J0MA 4K81A 2X18A 3NWAA 4HAUB 2DX1A 4Z2MB 1ZSQA 1H10A 3QBVB 2RNRB 1X11A 1Q67A 5D3WA 1W1DA 2RUKB 4PNKA 2VRWB 4Y94A 3PSCA 1K5GB 4EKUA 1DDMA 1X86A 1Y19B 3FVCA 5D3XA 5DIFB 2M38A 4KHOA 4ZRJA 2KGXB 2GCLA 2J0KA 2Z59A 4HDOA 4YONA 5LG4B 1UEFA 5KQ1A 2ROVA 1U27A 5C5BB 3QIJA 2LULA 2DHKA 3P6AA 1GC6A 2N23A 3FEHA 1ZYIA 1TQZA 1P6SA 4HAVB 2UZSA 1TXDA 3ODOA 1WJ1A 1WGUA 1XR0B 3LJUX 1SHCA 4B6HA 3OANA 4BBKA 4WVFB 2GUMA 4OT1A 1DDVA 3WYFB 2YRYA 2V76A 1MKEA 2RSGA 4IFSA 1KI1B 4MY6A 3ODXA 2DLWA 2RGNB 2DTCA 1XCGA 2ZKMX 4ZRIA 4CHMA 1GG3A 5J3YA 4Z2NA 1FHOA 4EMOA 1EAZA 4HAXB 4HB0B 3CIKA 1FB8A 5DHFB 1NTYA 1MPHA 2Z0OA 2DN6A 1RJ2A 3U7DA 1MK9B 3A8PA 5IRSA 3ML4A 2CAYA 2P0FA 2LOXA 3TW1A 2Z0PA 2YSZA 5JP4A 2DYNA 4GPTB 1BAKA 1Y5OA 3DXCA 4HHVA 3AU5A 3UZTA 4DXAB 3HW2B 2ZPYA 4GMXB 4OSNA 3T06A 2PZ1A 3NSUA 4K2PA 2I5FA 2K00A 4KAXB 2ELBA 2MKRA 3FSSA 4TYZA 5FI0A 1WG7A 2YS5A 3KY9A 1V89A 2Y7BA 1V61A 2D9YA 4A6FA 1NI2A 1E5WA 4L1RA 1XD4A 1ZC4B 3ULBA 1V5PA 2MFQA 3TO1A 1UNRA 4F7UP 2EMSA 3PVLA 1MIXA 3V5WA 3TFMA 3D8EA 3PEGA 2KCJA 1B55A 4YL8A 3BINA 5JHGA 4HATB 2QKMA 3A58A 3A8QA 2H7EA 2I5CA 1NU2A 3NW8A 5GOWB 1BWNA 3SV1A 2UZRA 3NWDA 2W2XC 3QWMA 2D2QA 3DXDA 4F7GA 2M14A 1DBHA 3AU4A 3GYOA 3KRXA 3CXBB 4GN1A 2CODA 2NBVA 3PVWA 3ULCA 2COCA 2Z14A 4QJ5B 3D8DA 2K2UA 2YS3A 1MI1A 3O96A 5L81A 2FJLA 1OY2A 1OQNA 1SGHA 2LG1A 2P0HA 4CSQA 2Q13A 2L1CA 5JLJB 2K2JA 1ZVRA 3HK0A 5DH9B 2IFSA 1FHXA 1WVHA 1FOEA 4NSWA 1M7EA 4WSFA 1DROA 1WI1A 5I2MA 2HTHB 1EVHA 3AJ4A 1V5UA 4CYEA 3FM8C 2AL6A 4HAYB 5C5BA 3U12A 2DHJA 2R2YA 1ZC3B 2P0DA 2D4QA 2K49A 2Z0QA 5HE2A 3RCPA 5KCVA 5J3TA 2K8EA 2COAA 1W1HA 1UPRA 2NZ8B 4NY0A 4F7HA 1N3HA 2YT0A 1UNQA 2OQBA 1Z87A 5LOPB 2KIGA 1J0WA 3HSAA 3KZ1A 1X1FA 3HQCA 1P5TA 2OTXA 5LONB 2D9ZA 4IAPA 2W2WA 1LW3A 3GYPA 4HSIA 4HAWB 3DCXA 3N7CA 2RLOA 2YS1A 3TCAA 4A5KA 2D9WA 2MDXA 2KIEA 4GZUA 2E2XA 2KUQA 2YT1A 2Y8FA 2LOZA 3ZVRA 1MK7B 1NTVA 1U5FA 2Z13A 2RRFA 3IVFA 1I7AA 4CHJA 1FGYA 4KHBA 1W1GA 2D9VA 1U5EA 2IYBA 1LB1A 3HIEA 4PQ0A 3P7ZA 3KRWA 2GCJA 2D10A 1FGZA 1EF1A 2CRFA 4HAZB 3PP2A 4ZRKA 1K5DB 5CLQB 2L2IA 5C79A 4L6EA 5I2SA 1V88A 4K17A 5J3QA 4QXAB 3G9WA 2YF0A 5EFXA 1EGXA 1WJMA 2D9XA 4QJ3B 2R0DA 3PZDA 2NMBA 2GJYA 3ODWA 3KSYA 4A6KA 1QQGA 1M7RA 3WA0A 4GOUA 5DI9B 5M4YB 4QJ4B 1MAIA 4HB4B 3DXEA 2XQNM 4K2OA 1BTKA 2I1JA 1X05A 2LYDA 1U5GA 2I1KA 2DKQA 2DFKA 1FHWA 1KZ7A 1UPQA 5KQ4A 2AEHA 2KR0A 4WJ7A 4DX90 4DBBA 4HB3B 1U5DA 2COFA 1ISNA 5D3VA 4GXBA 2J0JA
chains in the Genus database with same CATH topology
1V5MA 2VSZA 2DKPA 3PG7A 4MK0A 5JHHA 1XX0A 2DX5A 3SUZA 1AQCA 3X23A 3M1IB 3BJIA 4C0AA 2H7DA 3SO6A 5D3YA 2DHIA 1QC6A 2Y8GA 4EJNA 1DDWA 2R09A 5DHAB 3VOQA 1XODA 1MIZB 2N0YA 3SYXA 2ELAA 2RVBB 1XKEA 5D27A 3PVUA 1UNPA 1PMSA 2KUPA 1ZM0A 4D0NB 4TKNA 1PLSA 1P3RA 2EJ8A 2LKOA 4H8SA 1X1GA 1RRPB 3A98B 3TVVA 2GS0A 2ADZA 5HE3A 2EC1A 2BCJA 5HE0A 2QKLA 2DA0A 5C16A 4KVGB 5FI1A 1J19A 3VIAA 4DX8A 5C6RA 4GMVA 4HB2B 3MPXA 1GC7A 1I2HA 4HDQA 1AWEA 4KHAA 4IOYX 1PFJA 2EMTA 3D8FA 1FAOA 4A6FB 5HE1A 4MT7A 1U2BA 2D11A 2W2XD 5CLLB 1IRSA 4KHBB 3SNHA 1U29A 2DYQA 2J59M 4XWXA 2P8VA 1OMWA 2CY5A 3U8ZA 2JP2A 2ROZB 3F0WA 3F5RA 1KZGA 2CY4A 2UVMA 1BTNA 1TJ6A 2G35A 3MDBC 2YVCA 1DYNA 4P7IA 2VKIA 4A6HA 2HE7A 3ZDTA 2MWNB 1H4RA 1WGQA 2J0MA 4K81A 2X18A 4HAUB 2DX1A 4Z2MB 1ZSQA 1H10A 3QBVB 2RNRB 1X11A 1Q67A 5D3WA 1W1DA 2RUKB 4PNKA 2VRWB 4Y94A 3PSCA 1K5GB 4EKUA 1DDMA 1X86A 1Y19B 5D3XA 5DIFB 2M38A 4KHOA 4ZRJA 2KGXB 2GCLA 2J0KA 4HDOA 4YONA 1UEFA 5KQ1A 2ROVA 1U27A 5C5BB 3QIJA 2LULA 2DHKA 3P6AA 1GC6A 2N23A 3FEHA 1TQZA 1P6SA 4HAVB 2UZSA 1TXDA 3ODOA 1WJ1A 1WGUA 1XR0B 3LJUX 1SHCA 4B6HA 3OANA 4BBKA 4WVFB 1DDVA 3WYFB 2YRYA 2V76A 1MKEA 2RSGA 4IFSA 1KI1B 4MY6A 3ODXA 2DLWA 2RGNB 2DTCA 1XCGA 4ZRIA 4CHMA 1GG3A 5J3YA 4Z2NA 1FHOA 4EMOA 1EAZA 4HAXB 4HB0B 3CIKA 1FB8A 5DHFB 1NTYA 1MPHA 2Z0OA 2DN6A 1RJ2A 3U7DA 1MK9B 3A8PA 3ML4A 2CAYA 2P0FA 2LOXA 3TW1A 2Z0PA 2YSZA 5JP4A 2DYNA 4GPTB 1BAKA 1Y5OA 3DXCA 4HHVA 3AU5A 3UZTA 4DXAB 3HW2B 2ZPYA 4GMXB 3T06A 2PZ1A 3NSUA 4K2PA 2I5FA 2K00A 4KAXB 2ELBA 2MKRA 3FSSA 4TYZA 5FI0A 1WG7A 2YS5A 3KY9A 1V89A 2Y7BA 1V61A 2D9YA 4A6FA 1NI2A 1E5WA 1XD4A 1ZC4B 3ULBA 1V5PA 2MFQA 3TO1A 1UNRA 4F7UP 2EMSA 3PVLA 1MIXA 3V5WA 3TFMA 3D8EA 3PEGA 2KCJA 1B55A 4YL8A 3BINA 5JHGA 4HATB 2QKMA 3A8QA 2H7EA 2I5CA 1NU2A 5GOWB 1BWNA 3SV1A 2UZRA 2W2XC 3QWMA 2D2QA 3DXDA 4F7GA 2M14A 1DBHA 3AU4A 3GYOA 3KRXA 3CXBB 4GN1A 2CODA 3PVWA 3ULCA 2COCA 3D8DA 2K2UA 2YS3A 3O96A 5L81A 2FJLA 1OY2A 1OQNA 1SGHA 2LG1A 2P0HA 2Q13A 2L1CA 5JLJB 2K2JA 1ZVRA 3HK0A 5DH9B 2IFSA 1FHXA 1WVHA 1FOEA 4NSWA 1M7EA 4WSFA 1DROA 1WI1A 2HTHB 1EVHA 3AJ4A 1V5UA 4CYEA 3FM8C 2AL6A 4HAYB 5C5BA 2DHJA 1ZC3B 2P0DA 2D4QA 2Z0QA 5HE2A 3RCPA 5KCVA 5J3TA 2COAA 1W1HA 1UPRA 2NZ8B 4NY0A 4F7HA 1N3HA 2YT0A 1UNQA 2OQBA 1Z87A 5LOPB 1J0WA 3KZ1A 1X1FA 3HQCA 1P5TA 2OTXA 5LONB 2D9ZA 4IAPA 2W2WA 1LW3A 3GYPA 4HAWB 3N7CA 2RLOA 2YS1A 3TCAA 4A5KA 2D9WA 2MDXA 4GZUA 2E2XA 2YT1A 2Y8FA 2LOZA 3ZVRA 1MK7B 1NTVA 1U5FA 3IVFA 1I7AA 4CHJA 1FGYA 1W1GA 2D9VA 1U5EA 2IYBA 1LB1A 4PQ0A 3P7ZA 3KRWA 2GCJA 2D10A 1FGZA 1EF1A 2CRFA 4HAZB 3PP2A 4ZRKA 1K5DB 5CLQB 2L2IA 5C79A 4L6EA 1V88A 4K17A 5J3QA 3G9WA 2YF0A 5EFXA 1EGXA 1WJMA 2D9XA 2R0DA 3PZDA 2NMBA 2GJYA 3ODWA 3KSYA 4A6KA 1QQGA 1M7RA 3WA0A 5DI9B 1MAIA 4HB4B 3DXEA 2XQNM 4K2OA 1BTKA 2I1JA 1X05A 2LYDA 1U5GA 2I1KA 2DKQA 2DFKA 1FHWA 1KZ7A 1UPQA 5KQ4A 2AEHA 4WJ7A 4DX90 4DBBA 4HB3B 1U5DA 2COFA 1ISNA 5D3VA 4GXBA 2J0JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1V5M A;  2VSZ A;  2DKP A;  3PG7 A;  4MK0 A;  5JHH A;  1XX0 A;  2DX5 A;  3SUZ A;  1AQC A;  3X23 A;  3M1I B;  3BJI A;  4C0A A;  2H7D A;  3SO6 A;  5D3Y A;  2DHI A;  1QC6 A;  2Y8G A;  4EJN A;  1DDW A;  2R09 A;  5DHA B;  3VOQ A;  1XOD A;  1MIZ B;  2N0Y A;  3SYX A;  2ELA A;  2RVB B;  1XKE A;  5D27 A;  3PVU A;  1UNP A;  1PMS A;  2KUP A;  1ZM0 A;  4D0N B;  4TKN A;  1PLS A;  1P3R A;  2EJ8 A;  2LKO A;  4H8S A;  1X1G A;  1RRP B;  3A98 B;  3TVV A;  2GS0 A;  2ADZ A;  5HE3 A;  2EC1 A;  2BCJ A;  5HE0 A;  2QKL A;  2DA0 A;  5C16 A;  4KVG B;  5FI1 A;  1J19 A;  3VIA A;  4DX8 A;  5C6R A;  4GMV A;  4HB2 B;  3MPX A;  1GC7 A;  1I2H A;  4HDQ A;  1AWE A;  4KHA A;  4IOY X;  1PFJ A;  2EMT A;  3D8F A;  1FAO A;  4A6F B;  5HE1 A;  4MT7 A;  1U2B A;  2D11 A;  2W2X D;  5CLL B;  1IRS A;  4KHB B;  3SNH A;  1U29 A;  2DYQ A;  2J59 M;  4XWX A;  2P8V A;  1OMW A;  2CY5 A;  3U8Z A;  2JP2 A;  2ROZ B;  3F0W A;  3F5R A;  1KZG A;  2CY4 A;  2UVM A;  1BTN A;  1TJ6 A;  2G35 A;  3MDB C;  2YVC A;  1DYN A;  4P7I A;  2VKI A;  4A6H A;  2HE7 A;  3ZDT A;  2MWN B;  1H4R A;  1WGQ A;  2J0M A;  4K81 A;  2X18 A;  4HAU B;  2DX1 A;  4Z2M B;  1ZSQ A;  1H10 A;  3QBV B;  2RNR B;  1X11 A;  1Q67 A;  5D3W A;  1W1D A;  2RUK B;  4PNK A;  2VRW B;  4Y94 A;  3PSC A;  1K5G B;  4EKU A;  1DDM A;  1X86 A;  1Y19 B;  5D3X A;  5DIF B;  2M38 A;  4KHO A;  4ZRJ A;  2KGX B;  2GCL A;  2J0K A;  4HDO A;  4YON A;  1UEF A;  5KQ1 A;  2ROV A;  1U27 A;  5C5B B;  3QIJ A;  2LUL A;  2DHK A;  3P6A A;  1GC6 A;  2N23 A;  3FEH A;  1TQZ A;  1P6S A;  4HAV B;  2UZS A;  1TXD A;  3ODO A;  1WJ1 A;  1WGU A;  1XR0 B;  3LJU X;  1SHC A;  4B6H A;  3OAN A;  4BBK A;  4WVF B;  1DDV A;  3WYF B;  2YRY A;  2V76 A;  1MKE A;  2RSG A;  4IFS A;  1KI1 B;  4MY6 A;  3ODX A;  2DLW A;  2RGN B;  2DTC A;  1XCG A;  4ZRI A;  4CHM A;  1GG3 A;  5J3Y A;  4Z2N A;  1FHO A;  4EMO A;  1EAZ A;  4HAX B;  4HB0 B;  3CIK A;  1FB8 A;  5DHF B;  1NTY A;  1MPH A;  2Z0O A;  2DN6 A;  1RJ2 A;  3U7D A;  1MK9 B;  3A8P A;  3ML4 A;  2CAY A;  2P0F A;  2LOX A;  3TW1 A;  2Z0P A;  2YSZ A;  5JP4 A;  2DYN A;  4GPT B;  1BAK A;  1Y5O A;  3DXC A;  4HHV A;  3AU5 A;  3UZT A;  4DXA B;  3HW2 B;  2ZPY A;  4GMX B;  3T06 A;  2PZ1 A;  3NSU A;  4K2P A;  2I5F A;  2K00 A;  4KAX B;  2ELB A;  2MKR A;  3FSS A;  4TYZ A;  5FI0 A;  1WG7 A;  2YS5 A;  3KY9 A;  1V89 A;  2Y7B A;  1V61 A;  2D9Y A;  4A6F A;  1NI2 A;  1E5W A;  1XD4 A;  1ZC4 B;  3ULB A;  1V5P A;  2MFQ A;  3TO1 A;  1UNR A;  4F7U P;  2EMS A;  3PVL A;  1MIX A;  3V5W A;  3TFM A;  3D8E A;  3PEG A;  2KCJ A;  1B55 A;  4YL8 A;  3BIN A;  5JHG A;  4HAT B;  2QKM A;  3A8Q A;  2H7E A;  2I5C A;  1NU2 A;  5GOW B;  1BWN A;  3SV1 A;  2UZR A;  2W2X C;  3QWM A;  2D2Q A;  3DXD A;  4F7G A;  2M14 A;  1DBH A;  3AU4 A;  3GYO A;  3KRX A;  3CXB B;  4GN1 A;  2COD A;  3PVW A;  3ULC A;  2COC A;  3D8D A;  2K2U A;  2YS3 A;  3O96 A;  5L81 A;  2FJL A;  1OY2 A;  1OQN A;  1SGH A;  2LG1 A;  2P0H A;  2Q13 A;  2L1C A;  5JLJ B;  2K2J A;  1ZVR A;  3HK0 A;  5DH9 B;  2IFS A;  1FHX A;  1WVH A;  1FOE A;  4NSW A;  1M7E A;  4WSF A;  1DRO A;  1WI1 A;  2HTH B;  1EVH A;  3AJ4 A;  1V5U A;  4CYE A;  3FM8 C;  2AL6 A;  4HAY B;  5C5B A;  2DHJ A;  1ZC3 B;  2P0D A;  2D4Q A;  2Z0Q A;  5HE2 A;  3RCP A;  5KCV A;  5J3T A;  2COA A;  1W1H A;  1UPR A;  2NZ8 B;  4NY0 A;  4F7H A;  1N3H A;  2YT0 A;  1UNQ A;  2OQB A;  1Z87 A;  5LOP B;  1J0W A;  3KZ1 A;  1X1F A;  3HQC A;  1P5T A;  2OTX A;  5LON B;  2D9Z A;  4IAP A;  2W2W A;  1LW3 A;  3GYP A;  4HAW B;  3N7C A;  2RLO A;  2YS1 A;  3TCA A;  4A5K A;  2D9W A;  2MDX A;  4GZU A;  2E2X A;  2YT1 A;  2Y8F A;  2LOZ A;  3ZVR A;  1MK7 B;  1NTV A;  1U5F A;  3IVF A;  1I7A A;  4CHJ A;  1FGY A;  1W1G A;  2D9V A;  1U5E A;  2IYB A;  1LB1 A;  4PQ0 A;  3P7Z A;  3KRW A;  2GCJ A;  2D10 A;  1FGZ A;  1EF1 A;  2CRF A;  4HAZ B;  3PP2 A;  4ZRK A;  1K5D B;  5CLQ B;  2L2I A;  5C79 A;  4L6E A;  1V88 A;  4K17 A;  5J3Q A;  3G9W A;  2YF0 A;  5EFX A;  1EGX A;  1WJM A;  2D9X A;  2R0D A;  3PZD A;  2NMB A;  2GJY A;  3ODW A;  3KSY A;  4A6K A;  1QQG A;  1M7R A;  3WA0 A;  5DI9 B;  1MAI A;  4HB4 B;  3DXE A;  2XQN M;  4K2O A;  1BTK A;  2I1J A;  1X05 A;  2LYD A;  1U5G A;  2I1K A;  2DKQ A;  2DFK A;  1FHW A;  1KZ7 A;  1UPQ A;  5KQ4 A;  2AEH A;  4WJ7 A;  4DX9 0;  4DBB A;  4HB3 B;  1U5D A;  2COF A;  1ISN A;  5D3V A;  4GXB A;  2J0J A; 
#chains in the Genus database with same CATH topology
 1V5M A;  2VSZ A;  2DKP A;  3PG7 A;  3B77 A;  4MK0 A;  5JHH A;  1XX0 A;  4DIX A;  2DX5 A;  3SUZ A;  1AQC A;  3X23 A;  3M1I B;  3BJI A;  4C0A A;  2H7D A;  4GNK B;  5D3Y A;  3SO6 A;  2DHI A;  1QC6 A;  2Y8G A;  4EJN A;  1DDW A;  2R09 A;  5DHA B;  3VOQ A;  1XOD A;  1MIZ B;  2N0Y A;  3SYX A;  1T77 A;  2ELA A;  2RVB B;  1XKE A;  5D27 A;  3PVU A;  1UNP A;  1PMS A;  2KUP A;  1ZM0 A;  3OHM B;  4D0N B;  4TKN A;  1PLS A;  1P3R A;  2EJ8 A;  2LKO A;  2Z4D A;  4H8S A;  1X1G A;  1RRP B;  3A98 B;  3TVV A;  2GS0 A;  2ADZ A;  5HE3 A;  2EC1 A;  2BCJ A;  2YT2 A;  5HE0 A;  2QKL A;  2DA0 A;  5C16 A;  4KVG B;  5FI1 A;  1J19 A;  3VIA A;  4DX8 A;  5C6R A;  4GMV A;  4HB2 B;  3MPX A;  1GC7 A;  1I2H A;  4HDQ A;  3NWF A;  1AWE A;  4KHA A;  4IOY X;  1PFJ A;  2EMT A;  3D8F A;  1FAO A;  4A6F B;  5HE1 A;  4MT7 A;  1U2B A;  2D11 A;  2W2X D;  5CLL B;  1IRS A;  4KHB B;  3SNH A;  1U29 A;  2DYQ A;  2J59 M;  4XWX A;  2P8V A;  2FJU B;  1OMW A;  2CY5 A;  3U8Z A;  2JP2 A;  2ROZ B;  3F0W A;  3F5R A;  1KZG A;  4D6W A;  2CY4 A;  2UVM A;  1BTN A;  1TJ6 A;  2G35 A;  3MDB C;  2YVC A;  1DYN A;  4P7I A;  2VKI A;  4A6H A;  2HE7 A;  3ZDT A;  2MWN B;  1H4R A;  1WGQ A;  2J0M A;  4K81 A;  2X18 A;  3NWA A;  4HAU B;  2DX1 A;  4Z2M B;  1ZSQ A;  1H10 A;  3QBV B;  2RNR B;  1X11 A;  1Q67 A;  5D3W A;  1W1D A;  2RUK B;  4PNK A;  2VRW B;  4Y94 A;  3PSC A;  1K5G B;  4EKU A;  1DDM A;  1X86 A;  1Y19 B;  3FVC A;  5D3X A;  5DIF B;  2M38 A;  4KHO A;  4ZRJ A;  2KGX B;  2GCL A;  2J0K A;  2Z59 A;  4HDO A;  4YON A;  5LG4 B;  1UEF A;  5KQ1 A;  2ROV A;  1U27 A;  5C5B B;  3QIJ A;  2LUL A;  2DHK A;  3P6A A;  1GC6 A;  2N23 A;  3FEH A;  1ZYI A;  1TQZ A;  1P6S A;  4HAV B;  2UZS A;  1TXD A;  3ODO A;  1WJ1 A;  1WGU A;  1XR0 B;  3LJU X;  1SHC A;  4B6H A;  3OAN A;  4BBK A;  4WVF B;  2GUM A;  4OT1 A;  1DDV A;  3WYF B;  2YRY A;  2V76 A;  1MKE A;  2RSG A;  4IFS A;  1KI1 B;  4MY6 A;  3ODX A;  2DLW A;  2RGN B;  2DTC A;  1XCG A;  2ZKM X;  4ZRI A;  4CHM A;  1GG3 A;  5J3Y A;  4Z2N A;  1FHO A;  4EMO A;  1EAZ A;  4HAX B;  4HB0 B;  3CIK A;  1FB8 A;  5DHF B;  1NTY A;  1MPH A;  2Z0O A;  2DN6 A;  1RJ2 A;  3U7D A;  1MK9 B;  3A8P A;  5IRS A;  3ML4 A;  2CAY A;  2P0F A;  2LOX A;  3TW1 A;  2Z0P A;  2YSZ A;  5JP4 A;  2DYN A;  4GPT B;  1BAK A;  1Y5O A;  3DXC A;  4HHV A;  3AU5 A;  3UZT A;  4DXA B;  3HW2 B;  2ZPY A;  4GMX B;  4OSN A;  3T06 A;  2PZ1 A;  3NSU A;  4K2P A;  2I5F A;  2K00 A;  4KAX B;  2ELB A;  2MKR A;  3FSS A;  4TYZ A;  5FI0 A;  1WG7 A;  2YS5 A;  3KY9 A;  1V89 A;  2Y7B A;  1V61 A;  2D9Y A;  4A6F A;  1NI2 A;  1E5W A;  4L1R A;  1XD4 A;  1ZC4 B;  3ULB A;  1V5P A;  2MFQ A;  3TO1 A;  1UNR A;  4F7U P;  2EMS A;  3PVL A;  1MIX A;  3V5W A;  3TFM A;  3D8E A;  3PEG A;  2KCJ A;  1B55 A;  4YL8 A;  3BIN A;  5JHG A;  4HAT B;  2QKM A;  3A58 A;  3A8Q A;  2H7E A;  2I5C A;  1NU2 A;  3NW8 A;  5GOW B;  1BWN A;  3SV1 A;  2UZR A;  3NWD A;  2W2X C;  3QWM A;  2D2Q A;  3DXD A;  4F7G A;  2M14 A;  1DBH A;  3AU4 A;  3GYO A;  3KRX A;  3CXB B;  4GN1 A;  2COD A;  2NBV A;  3PVW A;  3ULC A;  2COC A;  2Z14 A;  4QJ5 B;  3D8D A;  2K2U A;  2YS3 A;  1MI1 A;  3O96 A;  5L81 A;  2FJL A;  1OY2 A;  1OQN A;  1SGH A;  2LG1 A;  2P0H A;  4CSQ A;  2Q13 A;  2L1C A;  5JLJ B;  2K2J A;  1ZVR A;  3HK0 A;  5DH9 B;  2IFS A;  1FHX A;  1WVH A;  1FOE A;  4NSW A;  1M7E A;  4WSF A;  1DRO A;  1WI1 A;  5I2M A;  2HTH B;  1EVH A;  3AJ4 A;  1V5U A;  4CYE A;  3FM8 C;  2AL6 A;  4HAY B;  5C5B A;  3U12 A;  2DHJ A;  2R2Y A;  1ZC3 B;  2P0D A;  2D4Q A;  2K49 A;  2Z0Q A;  5HE2 A;  3RCP A;  5KCV A;  5J3T A;  2K8E A;  2COA A;  1W1H A;  1UPR A;  2NZ8 B;  4NY0 A;  4F7H A;  1N3H A;  2YT0 A;  1UNQ A;  2OQB A;  1Z87 A;  5LOP B;  2KIG A;  1J0W A;  3HSA A;  3KZ1 A;  1X1F A;  3HQC A;  1P5T A;  2OTX A;  5LON B;  2D9Z A;  4IAP A;  2W2W A;  1LW3 A;  3GYP A;  4HSI A;  4HAW B;  3DCX A;  3N7C A;  2RLO A;  2YS1 A;  3TCA A;  4A5K A;  2D9W A;  2MDX A;  2KIE A;  4GZU A;  2E2X A;  2KUQ A;  2YT1 A;  2Y8F A;  2LOZ A;  3ZVR A;  1MK7 B;  1NTV A;  1U5F A;  2Z13 A;  2RRF A;  3IVF A;  1I7A A;  4CHJ A;  1FGY A;  4KHB A;  1W1G A;  2D9V A;  1U5E A;  2IYB A;  1LB1 A;  3HIE A;  4PQ0 A;  3P7Z A;  3KRW A;  2GCJ A;  2D10 A;  1FGZ A;  1EF1 A;  2CRF A;  4HAZ B;  3PP2 A;  4ZRK A;  1K5D B;  5CLQ B;  2L2I A;  5C79 A;  4L6E A;  5I2S A;  1V88 A;  4K17 A;  5J3Q A;  4QXA B;  3G9W A;  2YF0 A;  5EFX A;  1EGX A;  1WJM A;  2D9X A;  4QJ3 B;  2R0D A;  3PZD A;  2NMB A;  2GJY A;  3ODW A;  3KSY A;  4A6K A;  1QQG A;  1M7R A;  3WA0 A;  4GOU A;  5DI9 B;  5M4Y B;  4QJ4 B;  1MAI A;  4HB4 B;  3DXE A;  2XQN M;  4K2O A;  1BTK A;  2I1J A;  1X05 A;  2LYD A;  1U5G A;  2I1K A;  2DKQ A;  2DFK A;  1FHW A;  1KZ7 A;  1UPQ A;  5KQ4 A;  2AEH A;  2KR0 A;  4WJ7 A;  4DX9 0;  4DBB A;  4HB3 B;  1U5D A;  2COF A;  1ISN A;  5D3V A;  4GXB A;  2J0J A; 
#chains in the Genus database with same CATH homology
 1V5M A;  2VSZ A;  2DKP A;  3PG7 A;  4MK0 A;  5JHH A;  1XX0 A;  2DX5 A;  3SUZ A;  1AQC A;  3X23 A;  3M1I B;  3BJI A;  4C0A A;  2H7D A;  3SO6 A;  5D3Y A;  2DHI A;  1QC6 A;  2Y8G A;  4EJN A;  1DDW A;  2R09 A;  5DHA B;  3VOQ A;  1XOD A;  1MIZ B;  2N0Y A;  3SYX A;  2ELA A;  2RVB B;  1XKE A;  5D27 A;  3PVU A;  1UNP A;  1PMS A;  2KUP A;  1ZM0 A;  4D0N B;  4TKN A;  1PLS A;  1P3R A;  2EJ8 A;  2LKO A;  4H8S A;  1X1G A;  1RRP B;  3A98 B;  3TVV A;  2GS0 A;  2ADZ A;  5HE3 A;  2EC1 A;  2BCJ A;  5HE0 A;  2QKL A;  2DA0 A;  5C16 A;  4KVG B;  5FI1 A;  1J19 A;  3VIA A;  4DX8 A;  5C6R A;  4GMV A;  4HB2 B;  3MPX A;  1GC7 A;  1I2H A;  4HDQ A;  1AWE A;  4KHA A;  4IOY X;  1PFJ A;  2EMT A;  3D8F A;  1FAO A;  4A6F B;  5HE1 A;  4MT7 A;  1U2B A;  2D11 A;  2W2X D;  5CLL B;  1IRS A;  4KHB B;  3SNH A;  1U29 A;  2DYQ A;  2J59 M;  4XWX A;  2P8V A;  1OMW A;  2CY5 A;  3U8Z A;  2JP2 A;  2ROZ B;  3F0W A;  3F5R A;  1KZG A;  2CY4 A;  2UVM A;  1BTN A;  1TJ6 A;  2G35 A;  3MDB C;  2YVC A;  1DYN A;  4P7I A;  2VKI A;  4A6H A;  2HE7 A;  3ZDT A;  2MWN B;  1H4R A;  1WGQ A;  2J0M A;  4K81 A;  2X18 A;  4HAU B;  2DX1 A;  4Z2M B;  1ZSQ A;  1H10 A;  3QBV B;  2RNR B;  1X11 A;  1Q67 A;  5D3W A;  1W1D A;  2RUK B;  4PNK A;  2VRW B;  4Y94 A;  3PSC A;  1K5G B;  4EKU A;  1DDM A;  1X86 A;  1Y19 B;  5D3X A;  5DIF B;  2M38 A;  4KHO A;  4ZRJ A;  2KGX B;  2GCL A;  2J0K A;  4HDO A;  4YON A;  1UEF A;  5KQ1 A;  2ROV A;  1U27 A;  5C5B B;  3QIJ A;  2LUL A;  2DHK A;  3P6A A;  1GC6 A;  2N23 A;  3FEH A;  1TQZ A;  1P6S A;  4HAV B;  2UZS A;  1TXD A;  3ODO A;  1WJ1 A;  1WGU A;  1XR0 B;  3LJU X;  1SHC A;  4B6H A;  3OAN A;  4BBK A;  4WVF B;  1DDV A;  3WYF B;  2YRY A;  2V76 A;  1MKE A;  2RSG A;  4IFS A;  1KI1 B;  4MY6 A;  3ODX A;  2DLW A;  2RGN B;  2DTC A;  1XCG A;  4ZRI A;  4CHM A;  1GG3 A;  5J3Y A;  4Z2N A;  1FHO A;  4EMO A;  1EAZ A;  4HAX B;  4HB0 B;  3CIK A;  1FB8 A;  5DHF B;  1NTY A;  1MPH A;  2Z0O A;  2DN6 A;  1RJ2 A;  3U7D A;  1MK9 B;  3A8P A;  3ML4 A;  2CAY A;  2P0F A;  2LOX A;  3TW1 A;  2Z0P A;  2YSZ A;  5JP4 A;  2DYN A;  4GPT B;  1BAK A;  1Y5O A;  3DXC A;  4HHV A;  3AU5 A;  3UZT A;  4DXA B;  3HW2 B;  2ZPY A;  4GMX B;  3T06 A;  2PZ1 A;  3NSU A;  4K2P A;  2I5F A;  2K00 A;  4KAX B;  2ELB A;  2MKR A;  3FSS A;  4TYZ A;  5FI0 A;  1WG7 A;  2YS5 A;  3KY9 A;  1V89 A;  2Y7B A;  1V61 A;  2D9Y A;  4A6F A;  1NI2 A;  1E5W A;  1XD4 A;  1ZC4 B;  3ULB A;  1V5P A;  2MFQ A;  3TO1 A;  1UNR A;  4F7U P;  2EMS A;  3PVL A;  1MIX A;  3V5W A;  3TFM A;  3D8E A;  3PEG A;  2KCJ A;  1B55 A;  4YL8 A;  3BIN A;  5JHG A;  4HAT B;  2QKM A;  3A8Q A;  2H7E A;  2I5C A;  1NU2 A;  5GOW B;  1BWN A;  3SV1 A;  2UZR A;  2W2X C;  3QWM A;  2D2Q A;  3DXD A;  4F7G A;  2M14 A;  1DBH A;  3AU4 A;  3GYO A;  3KRX A;  3CXB B;  4GN1 A;  2COD A;  3PVW A;  3ULC A;  2COC A;  3D8D A;  2K2U A;  2YS3 A;  3O96 A;  5L81 A;  2FJL A;  1OY2 A;  1OQN A;  1SGH A;  2LG1 A;  2P0H A;  2Q13 A;  2L1C A;  5JLJ B;  2K2J A;  1ZVR A;  3HK0 A;  5DH9 B;  2IFS A;  1FHX A;  1WVH A;  1FOE A;  4NSW A;  1M7E A;  4WSF A;  1DRO A;  1WI1 A;  2HTH B;  1EVH A;  3AJ4 A;  1V5U A;  4CYE A;  3FM8 C;  2AL6 A;  4HAY B;  5C5B A;  2DHJ A;  1ZC3 B;  2P0D A;  2D4Q A;  2Z0Q A;  5HE2 A;  3RCP A;  5KCV A;  5J3T A;  2COA A;  1W1H A;  1UPR A;  2NZ8 B;  4NY0 A;  4F7H A;  1N3H A;  2YT0 A;  1UNQ A;  2OQB A;  1Z87 A;  5LOP B;  1J0W A;  3KZ1 A;  1X1F A;  3HQC A;  1P5T A;  2OTX A;  5LON B;  2D9Z A;  4IAP A;  2W2W A;  1LW3 A;  3GYP A;  4HAW B;  3N7C A;  2RLO A;  2YS1 A;  3TCA A;  4A5K A;  2D9W A;  2MDX A;  4GZU A;  2E2X A;  2YT1 A;  2Y8F A;  2LOZ A;  3ZVR A;  1MK7 B;  1NTV A;  1U5F A;  3IVF A;  1I7A A;  4CHJ A;  1FGY A;  1W1G A;  2D9V A;  1U5E A;  2IYB A;  1LB1 A;  4PQ0 A;  3P7Z A;  3KRW A;  2GCJ A;  2D10 A;  1FGZ A;  1EF1 A;  2CRF A;  4HAZ B;  3PP2 A;  4ZRK A;  1K5D B;  5CLQ B;  2L2I A;  5C79 A;  4L6E A;  1V88 A;  4K17 A;  5J3Q A;  3G9W A;  2YF0 A;  5EFX A;  1EGX A;  1WJM A;  2D9X A;  2R0D A;  3PZD A;  2NMB A;  2GJY A;  3ODW A;  3KSY A;  4A6K A;  1QQG A;  1M7R A;  3WA0 A;  5DI9 B;  1MAI A;  4HB4 B;  3DXE A;  2XQN M;  4K2O A;  1BTK A;  2I1J A;  1X05 A;  2LYD A;  1U5G A;  2I1K A;  2DKQ A;  2DFK A;  1FHW A;  1KZ7 A;  1UPQ A;  5KQ4 A;  2AEH A;  4WJ7 A;  4DX9 0;  4DBB A;  4HB3 B;  1U5D A;  2COF A;  1ISN A;  5D3V A;  4GXB A;  2J0J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...