1U5FA

Crystal structure of the ph domain of skap-hom with 8 vector-derived n-terminal residues
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
119
structure length
119
Chain Sequence
RASVGSPGIPAQDLPFVIKAGYLEKRRKDHSFLGFEWQKRWCALSKTVFYYYGSDKDKQQKGEFAIDGYDVRMNNTLRKDGKKDCCFEICAPDKRIYQFTAASPKDAEEWVQQLKFILQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Src-associated adaptor protein
publication title Structural Basis for the Dimerization and Phosphoinositide Specificity of the Src Kinase-associated Phosphoproteins SKAP55 and SKAP-Hom
rcsb
source organism Mus musculus
molecule tags Signaling protein
total genus 22
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2004-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1u5fA01
2YT0A 3FM8C 4ZRKA 2D4QA 3WYFB 1BTKA 1U27A 1PLSA 3X23A 2CAYA 2DKQA 1TJ6A 3ML4A 1WGQA 2GCJA 1WG7A 2D2QA 2LKOA 2D9ZA 2W2XD 1EGXA 3WA0A 1WI1A 2MKRA 2I5CA 1FHOA 1J19A 2YVCA 2COCA 1DBHA 2DKPA 5HE1A 3SO6A 3ODOA 1NTYA 2AL6A 2Q13A 4K2PA 1ZC4B 4HAUB 3HW2B 4WJ7A 5LONB 3CIKA 2J0KA 2ELBA 1RJ2A 4DX8A 5D3YA 1FB8A 3FSSA 4C0AA 4L6EA 2N0YA 1IRSA 2D11A 1ZC3B 2ELAA 1MIXA 3T06A 3D8EA 4K2OA 2M38A 2PZ1A 3FEHA 4XWXA 1DDVA 3PVWA 4F7GA 2CRFA 2RSGA 4IAPA 2YS1A 5KCVA 2DX5A 1LW3A 4TYZA 4HAVB 1X1FA 1DDMA 1I7AA 1V5PA 2ROVA 2GJYA 5J3TA 1KZGA 4A6FA 2LYDA 3PG7A 4GN1A 1Y19B 3KRWA 3DXDA 1U5GA 2H7EA 1I2HA 4D0NB 2P0HA 2MWNB 2G35A 2I1KA 4CHMA 5KQ4A 3ZDTA 2D10A 1EF1A 2DA0A 5D27A 3PVUA 5C6RA 2GS0A 4CHJA 1N3HA 4GMXB 5HE0A 1QQGA 2P8VA 2EC1A 3PEGA 1QC6A 3SUZA 3A8PA 5GOWB 1NI2A 5LOPB 2IYBA 3CXBB 4HB0B 2DYQA 4DBBA 2RGNB 3ULBA 3HK0A 2IFSA 5HE3A 3PP2A 3G9WA 3TFMA 1BAKA 3LJUX 1UEFA 1ZVRA 1U29A 1DYNA 2D9YA 4F7HA 3MPXA 1V88A 4KAXB 2EJ8A 2Y7BA 3GYOA 2W2XC 3M1IB 2J59M 2ADZA 3P7ZA 2RLOA 4WSFA 4KHBB 1Z87A 1FGYA 2Z0PA 2BCJA 1U5DA 1GC6A 2H7DA 4MK0A 4A6HA 5FI0A 4HDQA 5EFXA 1MAIA 5KQ1A 1WJ1A 1FOEA 1GC7A 1PMSA 3MDBC 1OMWA 4GXBA 3KSYA 3BJIA 3AJ4A 3ODWA 2UZSA 2COAA 1KI1B 2AEHA 4KVGB 5DHFB 4PQ0A 1MK7B 5JLJB 4H8SA 5JHHA 5JHGA 4B6HA 2V76A 1RRPB 2YRYA 1J0WA 4NSWA 4HB3B 4YL8A 1UPRA 1V5UA 1DDWA 1U2BA 2FJLA 4HAZB 5C16A 3NSUA 2YT1A 2GCLA 1W1DA 4ZRJA 5D3VA 2DYNA 3D8FA 2E2XA 2YS5A 3DXCA 3KRXA 4KHOA 1NU2A 2X18A 3U8ZA 1ZSQA 4CYEA 2LOZA 2W2WA 3SNHA 5JP4A 4K17A 1WJMA 2QKLA 3TVVA 2HE7A 3TW1A 1XCGA 3QWMA 1K5DB 5J3QA 1BWNA 4GPTB 2K00A 2Y8GA 4EMOA 3DXEA 1P3RA 4A6KA 3F5RA 1OY2A 5DHAB 4HATB 3V5WA 5J3YA 4MY6A 3F0WA 2UZRA 3KZ1A 1Y5OA 3VIAA 1FAOA 4GZUA 3UZTA 4P7IA 1ISNA 2YSZA 3HQCA 3P6AA 2EMTA 1X05A 2DHKA 2K2JA 4YONA 4Y94A 4ZRIA 2K2UA 3SYXA 2MDXA 1OQNA 2I1JA 3IVFA 1ZM0A 2L2IA 1X86A 3ULCA 5L81A 5DH9B 1MIZB 2D9XA 5C5BB 2XQNM 4EKUA 2LULA 4HAWB 1BTNA 4Z2MB 2OTXA 2CY5A 3AU5A 2YS3A 1WVHA 2DHJA 3ODXA 1V89A 1TQZA 1H4RA 1SGHA 1XR0B 3OANA 1AWEA 2D9WA 1U5EA 4HB2B 2NZ8B 1X11A 4HHVA 4F7UP 3QIJA 3GYPA 2D9VA 4IFSA 3N7CA 1FGZA 2OQBA 2DHIA 3PVLA 5CLLB 2KUPA 3O96A 2J0MA 1UNQA 3AU4A 2DN6A 4TKNA 1MKEA 5D3WA 1H10A 2DFKA 1UNRA 5D3XA 1AQCA 5DIFB 2R09A 2M14A 2CY4A 4PNKA 4GMVA 2DLWA 1KZ7A 2CODA 1DROA 1LB1A 4MT7A 4HB4B 2J0JA 4HDOA 2NMBA 1M7RA 2Z0OA 1XX0A 2I5FA 1W1GA 2COFA 2ROZB 3QBVB 2VRWB 2VSZA 2DX1A 2HTHB 4WVFB 2Y8FA 2LOXA 3PSCA 2P0DA 1XD4A 1XKEA 3A98B 3A8QA 1TXDA 5C5BA 2JP2A 1FHWA 4K81A 1B55A 1V5MA 2QKMA 5DI9B 3RCPA 1UNPA 1XODA 3ZVRA 3PZDA 4BBKA 3VOQA 4A5KA 3TO1A 2RNRB 4HAXB 4KHAA 3BINA 1M7EA 2KCJA 2EMSA 3D8DA 1SHCA 2P0FA 1MK9B 5C79A 1V61A 4DX90 1FHXA 2UVMA 1X1GA 1MPHA 2RUKB 1NTVA 1UPQA 1P5TA 3SV1A 4IOYX 3TCAA 2R0DA 2RVBB 3U7DA 1Q67A 5FI1A 1W1HA 2LG1A 3KY9A 5HE2A 2Z0QA 2N23A 2KGXB 1U5FA 2VKIA 4HAYB 2L1CA 2MFQA 1GG3A 2DTCA 4A6FB 1E5WA 1K5GB 4EJNA 1WGUA 2ZPYA 5CLQB 1P6SA 2YF0A 1PFJA 1EVHA 4NY0A 4Z2NA 1EAZA 4DXAB
chains in the Genus database with same CATH superfamily
2Z14A 2YT0A 3FM8C 4ZRKA 2D4QA 3WYFB 1BTKA 1U27A 1PLSA 3X23A 2CAYA 2DKQA 5M4YB 1TJ6A 3ML4A 1WGQA 2GCJA 1WG7A 2D2QA 2LKOA 2D9ZA 2W2XD 1EGXA 4D6WA 3WA0A 1WI1A 2MKRA 2I5CA 2KIEA 1FHOA 1J19A 2YVCA 2COCA 1DBHA 2DKPA 5HE1A 2Z4DA 3SO6A 3ODOA 1NTYA 2AL6A 2Q13A 4K2PA 1ZC4B 5LG4B 4HAUB 3HW2B 4WJ7A 5LONB 3CIKA 2J0KA 2ELBA 1RJ2A 4DX8A 5D3YA 2KUQA 1FB8A 3FSSA 4C0AA 4L6EA 2N0YA 1IRSA 2D11A 1ZC3B 2ELAA 1MIXA 3T06A 3D8EA 4K2OA 2M38A 2PZ1A 3FEHA 4XWXA 1DDVA 3PVWA 4F7GA 2CRFA 2RSGA 4IAPA 2YS1A 5KCVA 2DX5A 1LW3A 4TYZA 4HAVB 1X1FA 1DDMA 1I7AA 1V5PA 2ROVA 2GJYA 5J3TA 1KZGA 4A6FA 2LYDA 3PG7A 4GN1A 1Y19B 3KRWA 3DXDA 1U5GA 2H7EA 1I2HA 4D0NB 1T77A 2P0HA 3OHMB 2MWNB 2G35A 2I1KA 4CHMA 5KQ4A 3ZDTA 2D10A 4HSIA 5IRSA 1EF1A 2DA0A 5D27A 2Z59A 3PVUA 5C6RA 2GS0A 4CHJA 1N3HA 4GMXB 3A58A 5HE0A 1QQGA 2P8VA 2EC1A 3PEGA 1QC6A 3SUZA 3A8PA 5GOWB 1NI2A 5LOPB 2IYBA 3CXBB 4HB0B 2DYQA 4DBBA 2RGNB 3ULBA 3HK0A 2IFSA 5HE3A 3PP2A 3G9WA 3TFMA 1BAKA 3LJUX 4DIXA 1UEFA 1ZVRA 1U29A 1DYNA 2D9YA 4F7HA 3MPXA 2YT2A 1V88A 2Z13A 4KAXB 2EJ8A 2Y7BA 3GYOA 2W2XC 3M1IB 2J59M 2ADZA 3P7ZA 2RLOA 4WSFA 4KHBB 1Z87A 1FGYA 4QJ5B 2Z0PA 2BCJA 1U5DA 1GC6A 2H7DA 4MK0A 4A6HA 5FI0A 4HDQA 5EFXA 1MAIA 5KQ1A 1WJ1A 1FOEA 1GC7A 1PMSA 3MDBC 1OMWA 4GXBA 2GUMA 2RRFA 3KSYA 3BJIA 3AJ4A 3ODWA 2UZSA 2COAA 1KI1B 2AEHA 4KVGB 5DHFB 4PQ0A 1MK7B 5JLJB 4H8SA 5JHHA 3NWFA 5JHGA 4B6HA 2V76A 1RRPB 2YRYA 1J0WA 4NSWA 4HB3B 4YL8A 1UPRA 1V5UA 3NWAA 1DDWA 4QJ3B 1U2BA 2FJLA 4HAZB 5C16A 3NSUA 2YT1A 2GCLA 2R2YA 1W1DA 4ZRJA 5D3VA 2DYNA 3D8FA 2E2XA 2YS5A 3DXCA 3KRXA 4KHOA 1NU2A 2X18A 3U8ZA 1ZSQA 4CYEA 2LOZA 2W2WA 3SNHA 5JP4A 4K17A 1WJMA 2QKLA 3TVVA 2HE7A 3TW1A 1XCGA 3QWMA 1K5DB 5J3QA 1BWNA 4GPTB 2K00A 2Y8GA 4EMOA 3DXEA 4OSNA 1P3RA 2KR0A 4A6KA 3F5RA 4KHBA 1OY2A 5DHAB 2K8EA 4HATB 3V5WA 5J3YA 4MY6A 3F0WA 2UZRA 3DCXA 3KZ1A 1Y5OA 3VIAA 1FAOA 1ZYIA 4GZUA 3UZTA 4P7IA 1ISNA 2YSZA 3HQCA 3P6AA 2EMTA 1X05A 2DHKA 2K2JA 4YONA 4Y94A 4ZRIA 2K2UA 3FVCA 3SYXA 2MDXA 1OQNA 2I1JA 3IVFA 1ZM0A 2L2IA 1X86A 3ULCA 5L81A 5DH9B 1MIZB 2D9XA 5C5BB 2XQNM 4EKUA 2LULA 4HAWB 1BTNA 4Z2MB 4GOUA 2OTXA 2CY5A 3AU5A 3NWDA 2YS3A 1WVHA 2DHJA 1MI1A 3ODXA 1V89A 1TQZA 1H4RA 1SGHA 1XR0B 3OANA 1AWEA 2D9WA 2K49A 2KIGA 1U5EA 4HB2B 2NZ8B 1X11A 4HHVA 4F7UP 3QIJA 3GYPA 2D9VA 3HIEA 4IFSA 3N7CA 1FGZA 2OQBA 2DHIA 3PVLA 5CLLB 2KUPA 3O96A 2J0MA 1UNQA 3U12A 3AU4A 2DN6A 4TKNA 1MKEA 5D3WA 1H10A 2DFKA 1UNRA 5D3XA 1AQCA 5DIFB 2R09A 2M14A 2CY4A 4PNKA 5I2SA 4GMVA 2DLWA 1KZ7A 2CODA 1DROA 1LB1A 4MT7A 4HB4B 2J0JA 4HDOA 2NMBA 1M7RA 2Z0OA 1XX0A 2I5FA 4OT1A 1W1GA 2COFA 2ROZB 3QBVB 2VRWB 2VSZA 3HSAA 2DX1A 2HTHB 4CSQA 4WVFB 2Y8FA 2LOXA 3PSCA 2P0DA 1XD4A 1XKEA 3A98B 3A8QA 1TXDA 5C5BA 2JP2A 1FHWA 4K81A 2ZKMX 1B55A 1V5MA 2QKMA 5DI9B 3RCPA 1UNPA 1XODA 3ZVRA 3PZDA 4BBKA 3VOQA 4A5KA 3TO1A 2RNRB 4GNKB 4HAXB 4KHAA 3BINA 1M7EA 2KCJA 2EMSA 2FJUB 3D8DA 1SHCA 2P0FA 1MK9B 3B77A 5C79A 1V61A 4DX90 1FHXA 2UVMA 1X1GA 1MPHA 2RUKB 1NTVA 1UPQA 3NW8A 1P5TA 3SV1A 4IOYX 3TCAA 2R0DA 2RVBB 3U7DA 1Q67A 5FI1A 4QXAB 1W1HA 2LG1A 3KY9A 4QJ4B 5HE2A 2Z0QA 2N23A 2KGXB 1U5FA 2VKIA 4L1RA 4HAYB 2L1CA 2MFQA 1GG3A 2DTCA 4A6FB 1E5WA 1K5GB 4EJNA 1WGUA 2ZPYA 2NBVA 5CLQB 1P6SA 5I2MA 2YF0A 1PFJA 1EVHA 4NY0A 4Z2NA 1EAZA 4DXAB
chains in the Genus database with same CATH topology
2YT0A 3FM8C 4ZRKA 2D4QA 3WYFB 1BTKA 1U27A 1PLSA 3X23A 2CAYA 2DKQA 1TJ6A 3ML4A 1WGQA 2GCJA 1WG7A 2D2QA 2LKOA 2D9ZA 2W2XD 1EGXA 3WA0A 1WI1A 2MKRA 2I5CA 1FHOA 1J19A 2YVCA 2COCA 1DBHA 2DKPA 5HE1A 3SO6A 3ODOA 1NTYA 2AL6A 2Q13A 4K2PA 1ZC4B 4HAUB 3HW2B 4WJ7A 5LONB 3CIKA 2J0KA 2ELBA 1RJ2A 4DX8A 5D3YA 1FB8A 3FSSA 4C0AA 4L6EA 2N0YA 1IRSA 2D11A 1ZC3B 2ELAA 1MIXA 3T06A 3D8EA 4K2OA 2M38A 2PZ1A 3FEHA 4XWXA 1DDVA 3PVWA 4F7GA 2CRFA 2RSGA 4IAPA 2YS1A 5KCVA 2DX5A 1LW3A 4TYZA 4HAVB 1X1FA 1DDMA 1I7AA 1V5PA 2ROVA 2GJYA 5J3TA 1KZGA 4A6FA 2LYDA 3PG7A 4GN1A 1Y19B 3KRWA 3DXDA 1U5GA 2H7EA 1I2HA 4D0NB 2P0HA 2MWNB 2G35A 2I1KA 4CHMA 5KQ4A 3ZDTA 2D10A 1EF1A 2DA0A 5D27A 3PVUA 5C6RA 2GS0A 4CHJA 1N3HA 4GMXB 5HE0A 1QQGA 2P8VA 2EC1A 3PEGA 1QC6A 3SUZA 3A8PA 5GOWB 1NI2A 5LOPB 2IYBA 3CXBB 4HB0B 2DYQA 4DBBA 2RGNB 3ULBA 3HK0A 2IFSA 5HE3A 3PP2A 3G9WA 3TFMA 1BAKA 3LJUX 1UEFA 1ZVRA 1U29A 1DYNA 2D9YA 4F7HA 3MPXA 1V88A 4KAXB 2EJ8A 2Y7BA 3GYOA 2W2XC 3M1IB 2J59M 2ADZA 3P7ZA 2RLOA 4WSFA 4KHBB 1Z87A 1FGYA 2Z0PA 2BCJA 1U5DA 1GC6A 2H7DA 4MK0A 4A6HA 5FI0A 4HDQA 5EFXA 1MAIA 5KQ1A 1WJ1A 1FOEA 1GC7A 1PMSA 3MDBC 1OMWA 4GXBA 3KSYA 3BJIA 3AJ4A 3ODWA 2UZSA 2COAA 1KI1B 2AEHA 4KVGB 5DHFB 4PQ0A 1MK7B 5JLJB 4H8SA 5JHHA 5JHGA 4B6HA 2V76A 1RRPB 2YRYA 1J0WA 4NSWA 4HB3B 4YL8A 1UPRA 1V5UA 1DDWA 1U2BA 2FJLA 4HAZB 5C16A 3NSUA 2YT1A 2GCLA 1W1DA 4ZRJA 5D3VA 2DYNA 3D8FA 2E2XA 2YS5A 3DXCA 3KRXA 4KHOA 1NU2A 2X18A 3U8ZA 1ZSQA 4CYEA 2LOZA 2W2WA 3SNHA 5JP4A 4K17A 1WJMA 2QKLA 3TVVA 2HE7A 3TW1A 1XCGA 3QWMA 1K5DB 5J3QA 1BWNA 4GPTB 2K00A 2Y8GA 4EMOA 3DXEA 1P3RA 4A6KA 3F5RA 1OY2A 5DHAB 4HATB 3V5WA 5J3YA 4MY6A 3F0WA 2UZRA 3KZ1A 1Y5OA 3VIAA 1FAOA 4GZUA 3UZTA 4P7IA 1ISNA 2YSZA 3HQCA 3P6AA 2EMTA 1X05A 2DHKA 2K2JA 4YONA 4Y94A 4ZRIA 2K2UA 3SYXA 2MDXA 1OQNA 2I1JA 3IVFA 1ZM0A 2L2IA 1X86A 3ULCA 5L81A 5DH9B 1MIZB 2D9XA 5C5BB 2XQNM 4EKUA 2LULA 4HAWB 1BTNA 4Z2MB 2OTXA 2CY5A 3AU5A 2YS3A 1WVHA 2DHJA 3ODXA 1V89A 1TQZA 1H4RA 1SGHA 1XR0B 3OANA 1AWEA 2D9WA 1U5EA 4HB2B 2NZ8B 1X11A 4HHVA 4F7UP 3QIJA 3GYPA 2D9VA 4IFSA 3N7CA 1FGZA 2OQBA 2DHIA 3PVLA 5CLLB 2KUPA 3O96A 2J0MA 1UNQA 3AU4A 2DN6A 4TKNA 1MKEA 5D3WA 1H10A 2DFKA 1UNRA 5D3XA 1AQCA 5DIFB 2R09A 2M14A 2CY4A 4PNKA 4GMVA 2DLWA 1KZ7A 2CODA 1DROA 1LB1A 4MT7A 4HB4B 2J0JA 4HDOA 2NMBA 1M7RA 2Z0OA 1XX0A 2I5FA 1W1GA 2COFA 2ROZB 3QBVB 2VRWB 2VSZA 2DX1A 2HTHB 4WVFB 2Y8FA 2LOXA 3PSCA 2P0DA 1XD4A 1XKEA 3A98B 3A8QA 1TXDA 5C5BA 2JP2A 1FHWA 4K81A 1B55A 1V5MA 2QKMA 5DI9B 3RCPA 1UNPA 1XODA 3ZVRA 3PZDA 4BBKA 3VOQA 4A5KA 3TO1A 2RNRB 4HAXB 4KHAA 3BINA 1M7EA 2KCJA 2EMSA 3D8DA 1SHCA 2P0FA 1MK9B 5C79A 1V61A 4DX90 1FHXA 2UVMA 1X1GA 1MPHA 2RUKB 1NTVA 1UPQA 1P5TA 3SV1A 4IOYX 3TCAA 2R0DA 2RVBB 3U7DA 1Q67A 5FI1A 1W1HA 2LG1A 3KY9A 5HE2A 2Z0QA 2N23A 2KGXB 1U5FA 2VKIA 4HAYB 2L1CA 2MFQA 1GG3A 2DTCA 4A6FB 1E5WA 1K5GB 4EJNA 1WGUA 2ZPYA 5CLQB 1P6SA 2YF0A 1PFJA 1EVHA 4NY0A 4Z2NA 1EAZA 4DXAB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YT0 A;  3FM8 C;  4ZRK A;  2D4Q A;  3WYF B;  1BTK A;  1U27 A;  1PLS A;  3X23 A;  2CAY A;  2DKQ A;  1TJ6 A;  3ML4 A;  1WGQ A;  2GCJ A;  1WG7 A;  2D2Q A;  2LKO A;  2D9Z A;  2W2X D;  1EGX A;  3WA0 A;  1WI1 A;  2MKR A;  2I5C A;  1FHO A;  1J19 A;  2YVC A;  2COC A;  1DBH A;  2DKP A;  5HE1 A;  3SO6 A;  3ODO A;  1NTY A;  2AL6 A;  2Q13 A;  4K2P A;  1ZC4 B;  4HAU B;  3HW2 B;  4WJ7 A;  5LON B;  3CIK A;  2J0K A;  2ELB A;  1RJ2 A;  4DX8 A;  5D3Y A;  1FB8 A;  3FSS A;  4C0A A;  4L6E A;  2N0Y A;  1IRS A;  2D11 A;  1ZC3 B;  2ELA A;  1MIX A;  3T06 A;  3D8E A;  4K2O A;  2M38 A;  2PZ1 A;  3FEH A;  4XWX A;  1DDV A;  3PVW A;  4F7G A;  2CRF A;  2RSG A;  4IAP A;  2YS1 A;  5KCV A;  2DX5 A;  1LW3 A;  4TYZ A;  4HAV B;  1X1F A;  1DDM A;  1I7A A;  1V5P A;  2ROV A;  2GJY A;  5J3T A;  1KZG A;  4A6F A;  2LYD A;  3PG7 A;  4GN1 A;  1Y19 B;  3KRW A;  3DXD A;  1U5G A;  2H7E A;  1I2H A;  4D0N B;  2P0H A;  2MWN B;  2G35 A;  2I1K A;  4CHM A;  5KQ4 A;  3ZDT A;  2D10 A;  1EF1 A;  2DA0 A;  5D27 A;  3PVU A;  5C6R A;  2GS0 A;  4CHJ A;  1N3H A;  4GMX B;  5HE0 A;  1QQG A;  2P8V A;  2EC1 A;  3PEG A;  1QC6 A;  3SUZ A;  3A8P A;  5GOW B;  1NI2 A;  5LOP B;  2IYB A;  3CXB B;  4HB0 B;  2DYQ A;  4DBB A;  2RGN B;  3ULB A;  3HK0 A;  2IFS A;  5HE3 A;  3PP2 A;  3G9W A;  3TFM A;  1BAK A;  3LJU X;  1UEF A;  1ZVR A;  1U29 A;  1DYN A;  2D9Y A;  4F7H A;  3MPX A;  1V88 A;  4KAX B;  2EJ8 A;  2Y7B A;  3GYO A;  2W2X C;  3M1I B;  2J59 M;  2ADZ A;  3P7Z A;  2RLO A;  4WSF A;  4KHB B;  1Z87 A;  1FGY A;  2Z0P A;  2BCJ A;  1U5D A;  1GC6 A;  2H7D A;  4MK0 A;  4A6H A;  5FI0 A;  4HDQ A;  5EFX A;  1MAI A;  5KQ1 A;  1WJ1 A;  1FOE A;  1GC7 A;  1PMS A;  3MDB C;  1OMW A;  4GXB A;  3KSY A;  3BJI A;  3AJ4 A;  3ODW A;  2UZS A;  2COA A;  1KI1 B;  2AEH A;  4KVG B;  5DHF B;  4PQ0 A;  1MK7 B;  5JLJ B;  4H8S A;  5JHH A;  5JHG A;  4B6H A;  2V76 A;  1RRP B;  2YRY A;  1J0W A;  4NSW A;  4HB3 B;  4YL8 A;  1UPR A;  1V5U A;  1DDW A;  1U2B A;  2FJL A;  4HAZ B;  5C16 A;  3NSU A;  2YT1 A;  2GCL A;  1W1D A;  4ZRJ A;  5D3V A;  2DYN A;  3D8F A;  2E2X A;  2YS5 A;  3DXC A;  3KRX A;  4KHO A;  1NU2 A;  2X18 A;  3U8Z A;  1ZSQ A;  4CYE A;  2LOZ A;  2W2W A;  3SNH A;  5JP4 A;  4K17 A;  1WJM A;  2QKL A;  3TVV A;  2HE7 A;  3TW1 A;  1XCG A;  3QWM A;  1K5D B;  5J3Q A;  1BWN A;  4GPT B;  2K00 A;  2Y8G A;  4EMO A;  3DXE A;  1P3R A;  4A6K A;  3F5R A;  1OY2 A;  5DHA B;  4HAT B;  3V5W A;  5J3Y A;  4MY6 A;  3F0W A;  2UZR A;  3KZ1 A;  1Y5O A;  3VIA A;  1FAO A;  4GZU A;  3UZT A;  4P7I A;  1ISN A;  2YSZ A;  3HQC A;  3P6A A;  2EMT A;  1X05 A;  2DHK A;  2K2J A;  4YON A;  4Y94 A;  4ZRI A;  2K2U A;  3SYX A;  2MDX A;  1OQN A;  2I1J A;  3IVF A;  1ZM0 A;  2L2I A;  1X86 A;  3ULC A;  5L81 A;  5DH9 B;  1MIZ B;  2D9X A;  5C5B B;  2XQN M;  4EKU A;  2LUL A;  4HAW B;  1BTN A;  4Z2M B;  2OTX A;  2CY5 A;  3AU5 A;  2YS3 A;  1WVH A;  2DHJ A;  3ODX A;  1V89 A;  1TQZ A;  1H4R A;  1SGH A;  1XR0 B;  3OAN A;  1AWE A;  2D9W A;  1U5E A;  4HB2 B;  2NZ8 B;  1X11 A;  4HHV A;  4F7U P;  3QIJ A;  3GYP A;  2D9V A;  4IFS A;  3N7C A;  1FGZ A;  2OQB A;  2DHI A;  3PVL A;  5CLL B;  2KUP A;  3O96 A;  2J0M A;  1UNQ A;  3AU4 A;  2DN6 A;  4TKN A;  1MKE A;  5D3W A;  1H10 A;  2DFK A;  1UNR A;  5D3X A;  1AQC A;  5DIF B;  2R09 A;  2M14 A;  2CY4 A;  4PNK A;  4GMV A;  2DLW A;  1KZ7 A;  2COD A;  1DRO A;  1LB1 A;  4MT7 A;  4HB4 B;  2J0J A;  4HDO A;  2NMB A;  1M7R A;  2Z0O A;  1XX0 A;  2I5F A;  1W1G A;  2COF A;  2ROZ B;  3QBV B;  2VRW B;  2VSZ A;  2DX1 A;  2HTH B;  4WVF B;  2Y8F A;  2LOX A;  3PSC A;  2P0D A;  1XD4 A;  1XKE A;  3A98 B;  3A8Q A;  1TXD A;  5C5B A;  2JP2 A;  1FHW A;  4K81 A;  1B55 A;  1V5M A;  2QKM A;  5DI9 B;  3RCP A;  1UNP A;  1XOD A;  3ZVR A;  3PZD A;  4BBK A;  3VOQ A;  4A5K A;  3TO1 A;  2RNR B;  4HAX B;  4KHA A;  3BIN A;  1M7E A;  2KCJ A;  2EMS A;  3D8D A;  1SHC A;  2P0F A;  1MK9 B;  5C79 A;  1V61 A;  4DX9 0;  1FHX A;  2UVM A;  1X1G A;  1MPH A;  2RUK B;  1NTV A;  1UPQ A;  1P5T A;  3SV1 A;  4IOY X;  3TCA A;  2R0D A;  2RVB B;  3U7D A;  1Q67 A;  5FI1 A;  1W1H A;  2LG1 A;  3KY9 A;  5HE2 A;  2Z0Q A;  2N23 A;  2KGX B;  1U5F A;  2VKI A;  4HAY B;  2L1C A;  2MFQ A;  1GG3 A;  2DTC A;  4A6F B;  1E5W A;  1K5G B;  4EJN A;  1WGU A;  2ZPY A;  5CLQ B;  1P6S A;  2YF0 A;  1PFJ A;  1EVH A;  4NY0 A;  4Z2N A;  1EAZ A;  4DXA B; 
#chains in the Genus database with same CATH topology
 2Z14 A;  2YT0 A;  3FM8 C;  4ZRK A;  2D4Q A;  3WYF B;  1BTK A;  1U27 A;  1PLS A;  3X23 A;  2CAY A;  2DKQ A;  5M4Y B;  1TJ6 A;  3ML4 A;  1WGQ A;  2GCJ A;  1WG7 A;  2D2Q A;  2LKO A;  2D9Z A;  2W2X D;  1EGX A;  4D6W A;  3WA0 A;  1WI1 A;  2MKR A;  2I5C A;  2KIE A;  1FHO A;  1J19 A;  2YVC A;  2COC A;  1DBH A;  2DKP A;  5HE1 A;  2Z4D A;  3SO6 A;  3ODO A;  1NTY A;  2AL6 A;  2Q13 A;  4K2P A;  1ZC4 B;  5LG4 B;  4HAU B;  3HW2 B;  4WJ7 A;  5LON B;  3CIK A;  2J0K A;  2ELB A;  1RJ2 A;  4DX8 A;  5D3Y A;  2KUQ A;  1FB8 A;  3FSS A;  4C0A A;  4L6E A;  2N0Y A;  1IRS A;  2D11 A;  1ZC3 B;  2ELA A;  1MIX A;  3T06 A;  3D8E A;  4K2O A;  2M38 A;  2PZ1 A;  3FEH A;  4XWX A;  1DDV A;  3PVW A;  4F7G A;  2CRF A;  2RSG A;  4IAP A;  2YS1 A;  5KCV A;  2DX5 A;  1LW3 A;  4TYZ A;  4HAV B;  1X1F A;  1DDM A;  1I7A A;  1V5P A;  2ROV A;  2GJY A;  5J3T A;  1KZG A;  4A6F A;  2LYD A;  3PG7 A;  4GN1 A;  1Y19 B;  3KRW A;  3DXD A;  1U5G A;  2H7E A;  1I2H A;  4D0N B;  1T77 A;  2P0H A;  3OHM B;  2MWN B;  2G35 A;  2I1K A;  4CHM A;  5KQ4 A;  3ZDT A;  2D10 A;  4HSI A;  5IRS A;  1EF1 A;  2DA0 A;  5D27 A;  2Z59 A;  3PVU A;  5C6R A;  2GS0 A;  4CHJ A;  1N3H A;  4GMX B;  3A58 A;  5HE0 A;  1QQG A;  2P8V A;  2EC1 A;  3PEG A;  1QC6 A;  3SUZ A;  3A8P A;  5GOW B;  1NI2 A;  5LOP B;  2IYB A;  3CXB B;  4HB0 B;  2DYQ A;  4DBB A;  2RGN B;  3ULB A;  3HK0 A;  2IFS A;  5HE3 A;  3PP2 A;  3G9W A;  3TFM A;  1BAK A;  3LJU X;  4DIX A;  1UEF A;  1ZVR A;  1U29 A;  1DYN A;  2D9Y A;  4F7H A;  3MPX A;  2YT2 A;  1V88 A;  2Z13 A;  4KAX B;  2EJ8 A;  2Y7B A;  3GYO A;  2W2X C;  3M1I B;  2J59 M;  2ADZ A;  3P7Z A;  2RLO A;  4WSF A;  4KHB B;  1Z87 A;  1FGY A;  4QJ5 B;  2Z0P A;  2BCJ A;  1U5D A;  1GC6 A;  2H7D A;  4MK0 A;  4A6H A;  5FI0 A;  4HDQ A;  5EFX A;  1MAI A;  5KQ1 A;  1WJ1 A;  1FOE A;  1GC7 A;  1PMS A;  3MDB C;  1OMW A;  4GXB A;  2GUM A;  2RRF A;  3KSY A;  3BJI A;  3AJ4 A;  3ODW A;  2UZS A;  2COA A;  1KI1 B;  2AEH A;  4KVG B;  5DHF B;  4PQ0 A;  1MK7 B;  5JLJ B;  4H8S A;  5JHH A;  3NWF A;  5JHG A;  4B6H A;  2V76 A;  1RRP B;  2YRY A;  1J0W A;  4NSW A;  4HB3 B;  4YL8 A;  1UPR A;  1V5U A;  3NWA A;  1DDW A;  4QJ3 B;  1U2B A;  2FJL A;  4HAZ B;  5C16 A;  3NSU A;  2YT1 A;  2GCL A;  2R2Y A;  1W1D A;  4ZRJ A;  5D3V A;  2DYN A;  3D8F A;  2E2X A;  2YS5 A;  3DXC A;  3KRX A;  4KHO A;  1NU2 A;  2X18 A;  3U8Z A;  1ZSQ A;  4CYE A;  2LOZ A;  2W2W A;  3SNH A;  5JP4 A;  4K17 A;  1WJM A;  2QKL A;  3TVV A;  2HE7 A;  3TW1 A;  1XCG A;  3QWM A;  1K5D B;  5J3Q A;  1BWN A;  4GPT B;  2K00 A;  2Y8G A;  4EMO A;  3DXE A;  4OSN A;  1P3R A;  2KR0 A;  4A6K A;  3F5R A;  4KHB A;  1OY2 A;  5DHA B;  2K8E A;  4HAT B;  3V5W A;  5J3Y A;  4MY6 A;  3F0W A;  2UZR A;  3DCX A;  3KZ1 A;  1Y5O A;  3VIA A;  1FAO A;  1ZYI A;  4GZU A;  3UZT A;  4P7I A;  1ISN A;  2YSZ A;  3HQC A;  3P6A A;  2EMT A;  1X05 A;  2DHK A;  2K2J A;  4YON A;  4Y94 A;  4ZRI A;  2K2U A;  3FVC A;  3SYX A;  2MDX A;  1OQN A;  2I1J A;  3IVF A;  1ZM0 A;  2L2I A;  1X86 A;  3ULC A;  5L81 A;  5DH9 B;  1MIZ B;  2D9X A;  5C5B B;  2XQN M;  4EKU A;  2LUL A;  4HAW B;  1BTN A;  4Z2M B;  4GOU A;  2OTX A;  2CY5 A;  3AU5 A;  3NWD A;  2YS3 A;  1WVH A;  2DHJ A;  1MI1 A;  3ODX A;  1V89 A;  1TQZ A;  1H4R A;  1SGH A;  1XR0 B;  3OAN A;  1AWE A;  2D9W A;  2K49 A;  2KIG A;  1U5E A;  4HB2 B;  2NZ8 B;  1X11 A;  4HHV A;  4F7U P;  3QIJ A;  3GYP A;  2D9V A;  3HIE A;  4IFS A;  3N7C A;  1FGZ A;  2OQB A;  2DHI A;  3PVL A;  5CLL B;  2KUP A;  3O96 A;  2J0M A;  1UNQ A;  3U12 A;  3AU4 A;  2DN6 A;  4TKN A;  1MKE A;  5D3W A;  1H10 A;  2DFK A;  1UNR A;  5D3X A;  1AQC A;  5DIF B;  2R09 A;  2M14 A;  2CY4 A;  4PNK A;  5I2S A;  4GMV A;  2DLW A;  1KZ7 A;  2COD A;  1DRO A;  1LB1 A;  4MT7 A;  4HB4 B;  2J0J A;  4HDO A;  2NMB A;  1M7R A;  2Z0O A;  1XX0 A;  2I5F A;  4OT1 A;  1W1G A;  2COF A;  2ROZ B;  3QBV B;  2VRW B;  2VSZ A;  3HSA A;  2DX1 A;  2HTH B;  4CSQ A;  4WVF B;  2Y8F A;  2LOX A;  3PSC A;  2P0D A;  1XD4 A;  1XKE A;  3A98 B;  3A8Q A;  1TXD A;  5C5B A;  2JP2 A;  1FHW A;  4K81 A;  2ZKM X;  1B55 A;  1V5M A;  2QKM A;  5DI9 B;  3RCP A;  1UNP A;  1XOD A;  3ZVR A;  3PZD A;  4BBK A;  3VOQ A;  4A5K A;  3TO1 A;  2RNR B;  4GNK B;  4HAX B;  4KHA A;  3BIN A;  1M7E A;  2KCJ A;  2EMS A;  2FJU B;  3D8D A;  1SHC A;  2P0F A;  1MK9 B;  3B77 A;  5C79 A;  1V61 A;  4DX9 0;  1FHX A;  2UVM A;  1X1G A;  1MPH A;  2RUK B;  1NTV A;  1UPQ A;  3NW8 A;  1P5T A;  3SV1 A;  4IOY X;  3TCA A;  2R0D A;  2RVB B;  3U7D A;  1Q67 A;  5FI1 A;  4QXA B;  1W1H A;  2LG1 A;  3KY9 A;  4QJ4 B;  5HE2 A;  2Z0Q A;  2N23 A;  2KGX B;  1U5F A;  2VKI A;  4L1R A;  4HAY B;  2L1C A;  2MFQ A;  1GG3 A;  2DTC A;  4A6F B;  1E5W A;  1K5G B;  4EJN A;  1WGU A;  2ZPY A;  2NBV A;  5CLQ B;  1P6S A;  5I2M A;  2YF0 A;  1PFJ A;  1EVH A;  4NY0 A;  4Z2N A;  1EAZ A;  4DXA B; 
#chains in the Genus database with same CATH homology
 2YT0 A;  3FM8 C;  4ZRK A;  2D4Q A;  3WYF B;  1BTK A;  1U27 A;  1PLS A;  3X23 A;  2CAY A;  2DKQ A;  1TJ6 A;  3ML4 A;  1WGQ A;  2GCJ A;  1WG7 A;  2D2Q A;  2LKO A;  2D9Z A;  2W2X D;  1EGX A;  3WA0 A;  1WI1 A;  2MKR A;  2I5C A;  1FHO A;  1J19 A;  2YVC A;  2COC A;  1DBH A;  2DKP A;  5HE1 A;  3SO6 A;  3ODO A;  1NTY A;  2AL6 A;  2Q13 A;  4K2P A;  1ZC4 B;  4HAU B;  3HW2 B;  4WJ7 A;  5LON B;  3CIK A;  2J0K A;  2ELB A;  1RJ2 A;  4DX8 A;  5D3Y A;  1FB8 A;  3FSS A;  4C0A A;  4L6E A;  2N0Y A;  1IRS A;  2D11 A;  1ZC3 B;  2ELA A;  1MIX A;  3T06 A;  3D8E A;  4K2O A;  2M38 A;  2PZ1 A;  3FEH A;  4XWX A;  1DDV A;  3PVW A;  4F7G A;  2CRF A;  2RSG A;  4IAP A;  2YS1 A;  5KCV A;  2DX5 A;  1LW3 A;  4TYZ A;  4HAV B;  1X1F A;  1DDM A;  1I7A A;  1V5P A;  2ROV A;  2GJY A;  5J3T A;  1KZG A;  4A6F A;  2LYD A;  3PG7 A;  4GN1 A;  1Y19 B;  3KRW A;  3DXD A;  1U5G A;  2H7E A;  1I2H A;  4D0N B;  2P0H A;  2MWN B;  2G35 A;  2I1K A;  4CHM A;  5KQ4 A;  3ZDT A;  2D10 A;  1EF1 A;  2DA0 A;  5D27 A;  3PVU A;  5C6R A;  2GS0 A;  4CHJ A;  1N3H A;  4GMX B;  5HE0 A;  1QQG A;  2P8V A;  2EC1 A;  3PEG A;  1QC6 A;  3SUZ A;  3A8P A;  5GOW B;  1NI2 A;  5LOP B;  2IYB A;  3CXB B;  4HB0 B;  2DYQ A;  4DBB A;  2RGN B;  3ULB A;  3HK0 A;  2IFS A;  5HE3 A;  3PP2 A;  3G9W A;  3TFM A;  1BAK A;  3LJU X;  1UEF A;  1ZVR A;  1U29 A;  1DYN A;  2D9Y A;  4F7H A;  3MPX A;  1V88 A;  4KAX B;  2EJ8 A;  2Y7B A;  3GYO A;  2W2X C;  3M1I B;  2J59 M;  2ADZ A;  3P7Z A;  2RLO A;  4WSF A;  4KHB B;  1Z87 A;  1FGY A;  2Z0P A;  2BCJ A;  1U5D A;  1GC6 A;  2H7D A;  4MK0 A;  4A6H A;  5FI0 A;  4HDQ A;  5EFX A;  1MAI A;  5KQ1 A;  1WJ1 A;  1FOE A;  1GC7 A;  1PMS A;  3MDB C;  1OMW A;  4GXB A;  3KSY A;  3BJI A;  3AJ4 A;  3ODW A;  2UZS A;  2COA A;  1KI1 B;  2AEH A;  4KVG B;  5DHF B;  4PQ0 A;  1MK7 B;  5JLJ B;  4H8S A;  5JHH A;  5JHG A;  4B6H A;  2V76 A;  1RRP B;  2YRY A;  1J0W A;  4NSW A;  4HB3 B;  4YL8 A;  1UPR A;  1V5U A;  1DDW A;  1U2B A;  2FJL A;  4HAZ B;  5C16 A;  3NSU A;  2YT1 A;  2GCL A;  1W1D A;  4ZRJ A;  5D3V A;  2DYN A;  3D8F A;  2E2X A;  2YS5 A;  3DXC A;  3KRX A;  4KHO A;  1NU2 A;  2X18 A;  3U8Z A;  1ZSQ A;  4CYE A;  2LOZ A;  2W2W A;  3SNH A;  5JP4 A;  4K17 A;  1WJM A;  2QKL A;  3TVV A;  2HE7 A;  3TW1 A;  1XCG A;  3QWM A;  1K5D B;  5J3Q A;  1BWN A;  4GPT B;  2K00 A;  2Y8G A;  4EMO A;  3DXE A;  1P3R A;  4A6K A;  3F5R A;  1OY2 A;  5DHA B;  4HAT B;  3V5W A;  5J3Y A;  4MY6 A;  3F0W A;  2UZR A;  3KZ1 A;  1Y5O A;  3VIA A;  1FAO A;  4GZU A;  3UZT A;  4P7I A;  1ISN A;  2YSZ A;  3HQC A;  3P6A A;  2EMT A;  1X05 A;  2DHK A;  2K2J A;  4YON A;  4Y94 A;  4ZRI A;  2K2U A;  3SYX A;  2MDX A;  1OQN A;  2I1J A;  3IVF A;  1ZM0 A;  2L2I A;  1X86 A;  3ULC A;  5L81 A;  5DH9 B;  1MIZ B;  2D9X A;  5C5B B;  2XQN M;  4EKU A;  2LUL A;  4HAW B;  1BTN A;  4Z2M B;  2OTX A;  2CY5 A;  3AU5 A;  2YS3 A;  1WVH A;  2DHJ A;  3ODX A;  1V89 A;  1TQZ A;  1H4R A;  1SGH A;  1XR0 B;  3OAN A;  1AWE A;  2D9W A;  1U5E A;  4HB2 B;  2NZ8 B;  1X11 A;  4HHV A;  4F7U P;  3QIJ A;  3GYP A;  2D9V A;  4IFS A;  3N7C A;  1FGZ A;  2OQB A;  2DHI A;  3PVL A;  5CLL B;  2KUP A;  3O96 A;  2J0M A;  1UNQ A;  3AU4 A;  2DN6 A;  4TKN A;  1MKE A;  5D3W A;  1H10 A;  2DFK A;  1UNR A;  5D3X A;  1AQC A;  5DIF B;  2R09 A;  2M14 A;  2CY4 A;  4PNK A;  4GMV A;  2DLW A;  1KZ7 A;  2COD A;  1DRO A;  1LB1 A;  4MT7 A;  4HB4 B;  2J0J A;  4HDO A;  2NMB A;  1M7R A;  2Z0O A;  1XX0 A;  2I5F A;  1W1G A;  2COF A;  2ROZ B;  3QBV B;  2VRW B;  2VSZ A;  2DX1 A;  2HTH B;  4WVF B;  2Y8F A;  2LOX A;  3PSC A;  2P0D A;  1XD4 A;  1XKE A;  3A98 B;  3A8Q A;  1TXD A;  5C5B A;  2JP2 A;  1FHW A;  4K81 A;  1B55 A;  1V5M A;  2QKM A;  5DI9 B;  3RCP A;  1UNP A;  1XOD A;  3ZVR A;  3PZD A;  4BBK A;  3VOQ A;  4A5K A;  3TO1 A;  2RNR B;  4HAX B;  4KHA A;  3BIN A;  1M7E A;  2KCJ A;  2EMS A;  3D8D A;  1SHC A;  2P0F A;  1MK9 B;  5C79 A;  1V61 A;  4DX9 0;  1FHX A;  2UVM A;  1X1G A;  1MPH A;  2RUK B;  1NTV A;  1UPQ A;  1P5T A;  3SV1 A;  4IOY X;  3TCA A;  2R0D A;  2RVB B;  3U7D A;  1Q67 A;  5FI1 A;  1W1H A;  2LG1 A;  3KY9 A;  5HE2 A;  2Z0Q A;  2N23 A;  2KGX B;  1U5F A;  2VKI A;  4HAY B;  2L1C A;  2MFQ A;  1GG3 A;  2DTC A;  4A6F B;  1E5W A;  1K5G B;  4EJN A;  1WGU A;  2ZPY A;  5CLQ B;  1P6S A;  2YF0 A;  1PFJ A;  1EVH A;  4NY0 A;  4Z2N A;  1EAZ A;  4DXA B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...