1U5FA

Crystal structure of the ph domain of skap-hom with 8 vector-derived n-terminal residues
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
119
structure length
119
Chain Sequence
RASVGSPGIPAQDLPFVIKAGYLEKRRKDHSFLGFEWQKRWCALSKTVFYYYGSDKDKQQKGEFAIDGYDVRMNNTLRKDGKKDCCFEICAPDKRIYQFTAASPKDAEEWVQQLKFILQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for the Dimerization and Phosphoinositide Specificity of the Src Kinase-associated Phosphoproteins SKAP55 and SKAP-Hom
rcsb
source organism Mus musculus
molecule tags Signaling protein
molecule keywords Src-associated adaptor protein
total genus 22
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2004-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1u5fA01
4A6FB 1ISNA 1BAKA 1H4RA 2UZRA 1P6SA 4IOYX 1WG7A 3U8ZA 2R09A 5CLLB 1P3RA 2HE7A 2RGNB 5J3QA 3HK0A 1UPQA 2X18A 1DDMA 3CXBB 2D4QA 3FM8C 4K81A 5LOPB 4IFSA 3KY9A 4GXBA 4F7UP 1TXDA 3WA0A 3ZDTA 3X23A 1ZC4B 3PP2A 2YSZA 4DX8A 2EJ8A 3TO1A 2RUKB 2COCA 2D9WA 3ZVRA 2MWNB 2H7EA 5D3WA 2G35A 1V89A 1GG3A 2J0KA 1QQGA 2CRFA 2MFQA 4EJNA 5D3XA 3SYXA 2Y7BA 3KRXA 1Z87A 1FHOA 4MT7A 2L2IA 1FGZA 2D9YA 1RJ2A 3NSUA 5FI1A 2DX1A 2VKIA 3GYOA 3UZTA 4F7GA 1GC7A 4D0NB 1W1GA 2M14A 3BINA 2FJLA 1UNPA 2W2XC 2IFSA 3F0WA 4K2PA 5C6RA 4HDQA 1XR0B 4CHMA 2MKRA 2P0DA 2YF0A 4EMOA 2K2JA 2M38A 3A98B 2D9VA 4A6FA 1K5DB 2DKPA 2K00A 2I5FA 1V61A 1FHXA 4F7HA 1SGHA 1ZSQA 1XCGA 3PG7A 1RRPB 2ROZB 4CYEA 3P6AA 2RVBB 3AU5A 1I7AA 4HATB 4WVFB 1M7RA 2RLOA 3O96A 4EKUA 2I5CA 1XKEA 2DHJA 1B55A 2RSGA 4GMVA 3ODOA 4PQ0A 4GN1A 4A6HA 3BJIA 4BBKA 2AEHA 5HE1A 4CHJA 3SNHA 1SHCA 1DROA 1EGXA 1E5WA 1LB1A 3N7CA 1U29A 4GZUA 1OQNA 1XX0A 5GOWB 1X1GA 1Y19B 1AWEA 3KZ1A 2LOZA 2LKOA 3TFMA 2D9ZA 5KQ1A 4HB2B 2DTCA 1X1FA 1X86A 2CY4A 2ADZA 2GJYA 1PFJA 3V5WA 5FI0A 1TQZA 4GMXB 4WSFA 4YL8A 2QKLA 4A5KA 2VSZA 5HE3A 1EAZA 2EMTA 1W1HA 5C5BB 3AU4A 3DXCA 2GCLA 3SO6A 2LOXA 2OQBA 2Q13A 4YONA 1I2HA 3IVFA 2W2WA 1LW3A 2KCJA 2RNRB 3OANA 4HB0B 4IAPA 2KGXB 1WI1A 2UZSA 4H8SA 1MPHA 2ELAA 1DDVA 1DBHA 3ODXA 1DDWA 3PSCA 2ZPYA 3HQCA 1BWNA 2DHIA 5KQ4A 2V76A 4MY6A 2OTXA 2NZ8B 4P7IA 4WJ7A 2Z0QA 3AJ4A 5L81A 2QKMA 1V5UA 1PLSA 2L1CA 4C0AA 2DKQA 1J19A 4KHBB 3GYPA 4HAZB 3ODWA 2J0MA 1DYNA 2N0YA 2VRWB 2LULA 2GS0A 1X05A 2YT0A 2NMBA 5EFXA 2ROVA 2BCJA 2XQNM 5C79A 1WGQA 2H7DA 1H10A 5DH9B 1PMSA 1Q67A 2COAA 2GCJA 1WJMA 1FOEA 3PVWA 4PNKA 5KCVA 1MIXA 3FSSA 1M7EA 1U5GA 2CY5A 1U5DA 4HB4B 4TYZA 1FGYA 2P0FA 1EVHA 2DX5A 3DXEA 2YS5A 4KAXB 2E2XA 3VOQA 1ZM0A 3HW2B 1QC6A 3PVUA 4HAUB 2Y8GA 1MAIA 4DXAB 4K2OA 2LG1A 5D3VA 2YS1A 3MDBC 3M1IB 1V5MA 2ELBA 3QWMA 5JHHA 2DA0A 3D8EA 4GPTB 5DI9B 2DYQA 1EF1A 2UVMA 2COFA 4B6HA 5J3TA 3VIAA 2IYBA 1MIZB 1KZGA 2AL6A 1U5EA 1V5PA 3QBVB 5DHFB 4HDOA 1FHWA 4HB3B 3PZDA 1J0WA 1U2BA 4K17A 2EMSA 1N3HA 3RCPA 2JP2A 2I1KA 3TW1A 2PZ1A 1XD4A 4Y94A 4DX90 2Z0PA 5D3YA 1MK9B 3TVVA 2KUPA 1XODA 3ML4A 2YT1A 2D9XA 2J0JA 4Z2MB 3FEHA 1Y5OA 3T06A 1UPRA 1UEFA 2P8VA 1UNQA 3D8FA 2D11A 2LYDA 1BTKA 4Z2NA 4DBBA 5DIFB 1WGUA 3A8QA 3PEGA 5C16A 1ZC3B 2Y8FA 4ZRKA 1FAOA 3G9WA 5C5BA 1MKEA 5D27A 4NY0A 3CIKA 2DLWA 5HE2A 1ZVRA 2YS3A 1V88A 1AQCA 4HAYB 1P5TA 5JP4A 1KZ7A 3KSYA 1U27A 1FB8A 4KVGB 4HHVA 5J3YA 3U7DA 3SV1A 1TJ6A 1NU2A 1UNRA 2DHKA 1K5GB 3MPXA 2YVCA 4ZRJA 1W1DA 3D8DA 5LONB 2EC1A 4ZRIA 2P0HA 2DN6A 3LJUX 2K2UA 3SUZA 4MK0A 2MDXA 4KHOA 3P7ZA 4KHAA 4NSWA 5DHAB 5CLQB 1U5FA 1WVHA 2J59M 2R0DA 3F5RA 3QIJA 3PVLA 1GC6A 2D2QA 2N23A 2CAYA 3DXDA 4HAWB 5HE0A 2I1JA 2HTHB 2YRYA 1BTNA 2W2XD 2Z0OA 4HAVB 3A8PA 1KI1B 3ULBA 3TCAA 2D10A 5JLJB 2CODA 1NI2A 1WJ1A 3WYFB 1OMWA 3KRWA 4HAXB 4TKNA 4L6EA 5JHGA 1OY2A 4XWXA 2DFKA 1X11A 2DYNA 4A6KA 1NTVA 1NTYA 1MK7B 1IRSA 3ULCA
chains in the Genus database with same CATH superfamily
4A6FB 5I2MA 1ISNA 1BAKA 1H4RA 3HSAA 2UZRA 1P6SA 4IOYX 1WG7A 3U8ZA 2R09A 5CLLB 1P3RA 2HE7A 2RGNB 4GNKB 5J3QA 3HK0A 1UPQA 2X18A 1DDMA 3CXBB 2D4QA 3FM8C 4K81A 2K49A 5LOPB 4IFSA 3KY9A 4GXBA 4F7UP 1TXDA 3WA0A 3ZDTA 3X23A 1ZC4B 3PP2A 2YSZA 4KHBA 2GUMA 4DX8A 2EJ8A 3TO1A 2RUKB 2COCA 2D9WA 3ZVRA 2MWNB 2H7EA 5D3WA 2G35A 1V89A 3DCXA 1GG3A 2J0KA 1QQGA 2CRFA 2MFQA 4EJNA 5D3XA 4OT1A 3SYXA 2Y7BA 3KRXA 1Z87A 1FHOA 4MT7A 2L2IA 1FGZA 2D9YA 1RJ2A 3A58A 3NSUA 5FI1A 2DX1A 2VKIA 3GYOA 3UZTA 4F7GA 3NWAA 1GC7A 4D0NB 1W1GA 5I2SA 2M14A 3BINA 2FJLA 2KIEA 1UNPA 2W2XC 2IFSA 3F0WA 4K2PA 5C6RA 4HDQA 4QJ5B 1XR0B 4CHMA 2MKRA 2P0DA 2YF0A 4EMOA 2K2JA 4HSIA 2M38A 3A98B 2D9VA 4A6FA 1K5DB 2DKPA 2K00A 4QJ3B 2I5FA 1V61A 1FHXA 4F7HA 1SGHA 1ZSQA 1XCGA 3PG7A 1RRPB 2ROZB 4CYEA 3P6AA 2RVBB 3AU5A 1I7AA 4HATB 4WVFB 1M7RA 2RLOA 3O96A 4EKUA 2I5CA 1XKEA 2DHJA 1B55A 2RSGA 4GMVA 3ODOA 4PQ0A 4GN1A 4A6HA 3BJIA 4BBKA 2AEHA 3HIEA 5HE1A 4CHJA 3SNHA 1SHCA 1DROA 1EGXA 1E5WA 1LB1A 3N7CA 1U29A 4GZUA 1T77A 1OQNA 1XX0A 5GOWB 1X1GA 1Y19B 1AWEA 3KZ1A 2LOZA 2LKOA 3TFMA 2D9ZA 5KQ1A 4HB2B 2DTCA 1X1FA 1X86A 2CY4A 2KIGA 2ADZA 2GJYA 4QJ4B 1PFJA 3V5WA 5FI0A 1TQZA 4GMXB 4WSFA 4YL8A 2QKLA 4A5KA 2VSZA 5HE3A 1EAZA 2EMTA 1W1HA 5C5BB 4DIXA 3AU4A 3DXCA 2GCLA 3SO6A 2LOXA 2OQBA 2Q13A 4YONA 1I2HA 3IVFA 2W2WA 1LW3A 2KCJA 2RNRB 3OANA 4HB0B 4IAPA 2KGXB 1WI1A 2UZSA 4H8SA 1MPHA 2ELAA 1DDVA 1DBHA 3ODXA 1DDWA 3PSCA 2R2YA 5LG4B 2ZPYA 3HQCA 1BWNA 2DHIA 5KQ4A 2V76A 4MY6A 2OTXA 2NZ8B 4P7IA 4OSNA 4WJ7A 2Z0QA 3AJ4A 5L81A 2QKMA 1V5UA 1PLSA 2L1CA 4C0AA 2DKQA 1J19A 4KHBB 3GYPA 4HAZB 3ODWA 2J0MA 1DYNA 2N0YA 2VRWB 2LULA 2GS0A 1X05A 2YT0A 2NMBA 5EFXA 2ROVA 2Z13A 2BCJA 2XQNM 5C79A 1WGQA 2H7DA 1MI1A 1H10A 5DH9B 1PMSA 5IRSA 1Q67A 2COAA 2GCJA 1WJMA 1FOEA 3PVWA 4PNKA 5KCVA 1MIXA 3FSSA 4L1RA 1M7EA 1U5GA 2CY5A 1U5DA 4HB4B 4TYZA 3NW8A 1FGYA 3B77A 2P0FA 1EVHA 2DX5A 3DXEA 2YS5A 4KAXB 2E2XA 3VOQA 1ZM0A 3HW2B 1QC6A 3PVUA 4HAUB 2Y8GA 1MAIA 4DXAB 4K2OA 2LG1A 5D3VA 2YS1A 3MDBC 3M1IB 1V5MA 2ELBA 3QWMA 5JHHA 4QXAB 2DA0A 3D8EA 4GPTB 5DI9B 2DYQA 1EF1A 2UVMA 2COFA 4B6HA 5J3TA 3VIAA 2IYBA 5M4YB 1MIZB 1KZGA 2AL6A 1U5EA 1V5PA 2ZKMX 2YT2A 3QBVB 3U12A 2Z4DA 5DHFB 4HDOA 1FHWA 4HB3B 3PZDA 1J0WA 1U2BA 4K17A 2EMSA 1N3HA 3RCPA 2JP2A 2I1KA 3TW1A 2PZ1A 1XD4A 4Y94A 4DX90 2Z0PA 5D3YA 1MK9B 3TVVA 2KUPA 1XODA 3ML4A 2YT1A 2D9XA 2J0JA 4Z2MB 2Z59A 3FEHA 1Y5OA 3T06A 1UPRA 1UEFA 2P8VA 1UNQA 4D6WA 4GOUA 3D8FA 2D11A 2LYDA 1BTKA 4Z2NA 4DBBA 5DIFB 1WGUA 3A8QA 3PEGA 5C16A 1ZC3B 2Y8FA 4ZRKA 1FAOA 3G9WA 5C5BA 1MKEA 5D27A 4NY0A 3CIKA 2DLWA 4CSQA 5HE2A 1ZVRA 2YS3A 1V88A 1AQCA 4HAYB 1P5TA 5JP4A 1KZ7A 3KSYA 1U27A 1FB8A 4KVGB 4HHVA 5J3YA 3U7DA 3SV1A 1TJ6A 2K8EA 1NU2A 3NWFA 1UNRA 2DHKA 1K5GB 3MPXA 2YVCA 4ZRJA 1W1DA 3D8DA 5LONB 2EC1A 4ZRIA 2FJUB 2P0HA 2DN6A 3LJUX 2K2UA 3SUZA 1ZYIA 4MK0A 3NWDA 2MDXA 4KHOA 3P7ZA 4KHAA 4NSWA 5DHAB 5CLQB 1U5FA 1WVHA 2J59M 2R0DA 3F5RA 3FVCA 3QIJA 3PVLA 1GC6A 2D2QA 2N23A 2CAYA 3DXDA 4HAWB 5HE0A 2I1JA 2HTHB 2YRYA 1BTNA 2W2XD 2Z0OA 4HAVB 3A8PA 1KI1B 3ULBA 2Z14A 3TCAA 2D10A 5JLJB 2CODA 1NI2A 1WJ1A 3WYFB 1OMWA 3KRWA 4HAXB 4TKNA 4L6EA 5JHGA 1OY2A 2KR0A 4XWXA 2KUQA 2DFKA 1X11A 3OHMB 2DYNA 2RRFA 2NBVA 4A6KA 1NTVA 1NTYA 1MK7B 1IRSA 3ULCA
chains in the Genus database with same CATH topology
4A6FB 1ISNA 1BAKA 1H4RA 2UZRA 1P6SA 4IOYX 1WG7A 3U8ZA 2R09A 5CLLB 1P3RA 2HE7A 2RGNB 5J3QA 3HK0A 1UPQA 2X18A 1DDMA 3CXBB 2D4QA 3FM8C 4K81A 5LOPB 4IFSA 3KY9A 4GXBA 4F7UP 1TXDA 3WA0A 3ZDTA 3X23A 1ZC4B 3PP2A 2YSZA 4DX8A 2EJ8A 3TO1A 2RUKB 2COCA 2D9WA 3ZVRA 2MWNB 2H7EA 5D3WA 2G35A 1V89A 1GG3A 2J0KA 1QQGA 2CRFA 2MFQA 4EJNA 5D3XA 3SYXA 2Y7BA 3KRXA 1Z87A 1FHOA 4MT7A 2L2IA 1FGZA 2D9YA 1RJ2A 3NSUA 5FI1A 2DX1A 2VKIA 3GYOA 3UZTA 4F7GA 1GC7A 4D0NB 1W1GA 2M14A 3BINA 2FJLA 1UNPA 2W2XC 2IFSA 3F0WA 4K2PA 5C6RA 4HDQA 1XR0B 4CHMA 2MKRA 2P0DA 2YF0A 4EMOA 2K2JA 2M38A 3A98B 2D9VA 4A6FA 1K5DB 2DKPA 2K00A 2I5FA 1V61A 1FHXA 4F7HA 1SGHA 1ZSQA 1XCGA 3PG7A 1RRPB 2ROZB 4CYEA 3P6AA 2RVBB 3AU5A 1I7AA 4HATB 4WVFB 1M7RA 2RLOA 3O96A 4EKUA 2I5CA 1XKEA 2DHJA 1B55A 2RSGA 4GMVA 3ODOA 4PQ0A 4GN1A 4A6HA 3BJIA 4BBKA 2AEHA 5HE1A 4CHJA 3SNHA 1SHCA 1DROA 1EGXA 1E5WA 1LB1A 3N7CA 1U29A 4GZUA 1OQNA 1XX0A 5GOWB 1X1GA 1Y19B 1AWEA 3KZ1A 2LOZA 2LKOA 3TFMA 2D9ZA 5KQ1A 4HB2B 2DTCA 1X1FA 1X86A 2CY4A 2ADZA 2GJYA 1PFJA 3V5WA 5FI0A 1TQZA 4GMXB 4WSFA 4YL8A 2QKLA 4A5KA 2VSZA 5HE3A 1EAZA 2EMTA 1W1HA 5C5BB 3AU4A 3DXCA 2GCLA 3SO6A 2LOXA 2OQBA 2Q13A 4YONA 1I2HA 3IVFA 2W2WA 1LW3A 2KCJA 2RNRB 3OANA 4HB0B 4IAPA 2KGXB 1WI1A 2UZSA 4H8SA 1MPHA 2ELAA 1DDVA 1DBHA 3ODXA 1DDWA 3PSCA 2ZPYA 3HQCA 1BWNA 2DHIA 5KQ4A 2V76A 4MY6A 2OTXA 2NZ8B 4P7IA 4WJ7A 2Z0QA 3AJ4A 5L81A 2QKMA 1V5UA 1PLSA 2L1CA 4C0AA 2DKQA 1J19A 4KHBB 3GYPA 4HAZB 3ODWA 2J0MA 1DYNA 2N0YA 2VRWB 2LULA 2GS0A 1X05A 2YT0A 2NMBA 5EFXA 2ROVA 2BCJA 2XQNM 5C79A 1WGQA 2H7DA 1H10A 5DH9B 1PMSA 1Q67A 2COAA 2GCJA 1WJMA 1FOEA 3PVWA 4PNKA 5KCVA 1MIXA 3FSSA 1M7EA 1U5GA 2CY5A 1U5DA 4HB4B 4TYZA 1FGYA 2P0FA 1EVHA 2DX5A 3DXEA 2YS5A 4KAXB 2E2XA 3VOQA 1ZM0A 3HW2B 1QC6A 3PVUA 4HAUB 2Y8GA 1MAIA 4DXAB 4K2OA 2LG1A 5D3VA 2YS1A 3MDBC 3M1IB 1V5MA 2ELBA 3QWMA 5JHHA 2DA0A 3D8EA 4GPTB 5DI9B 2DYQA 1EF1A 2UVMA 2COFA 4B6HA 5J3TA 3VIAA 2IYBA 1MIZB 1KZGA 2AL6A 1U5EA 1V5PA 3QBVB 5DHFB 4HDOA 1FHWA 4HB3B 3PZDA 1J0WA 1U2BA 4K17A 2EMSA 1N3HA 3RCPA 2JP2A 2I1KA 3TW1A 2PZ1A 1XD4A 4Y94A 4DX90 2Z0PA 5D3YA 1MK9B 3TVVA 2KUPA 1XODA 3ML4A 2YT1A 2D9XA 2J0JA 4Z2MB 3FEHA 1Y5OA 3T06A 1UPRA 1UEFA 2P8VA 1UNQA 3D8FA 2D11A 2LYDA 1BTKA 4Z2NA 4DBBA 5DIFB 1WGUA 3A8QA 3PEGA 5C16A 1ZC3B 2Y8FA 4ZRKA 1FAOA 3G9WA 5C5BA 1MKEA 5D27A 4NY0A 3CIKA 2DLWA 5HE2A 1ZVRA 2YS3A 1V88A 1AQCA 4HAYB 1P5TA 5JP4A 1KZ7A 3KSYA 1U27A 1FB8A 4KVGB 4HHVA 5J3YA 3U7DA 3SV1A 1TJ6A 1NU2A 1UNRA 2DHKA 1K5GB 3MPXA 2YVCA 4ZRJA 1W1DA 3D8DA 5LONB 2EC1A 4ZRIA 2P0HA 2DN6A 3LJUX 2K2UA 3SUZA 4MK0A 2MDXA 4KHOA 3P7ZA 4KHAA 4NSWA 5DHAB 5CLQB 1U5FA 1WVHA 2J59M 2R0DA 3F5RA 3QIJA 3PVLA 1GC6A 2D2QA 2N23A 2CAYA 3DXDA 4HAWB 5HE0A 2I1JA 2HTHB 2YRYA 1BTNA 2W2XD 2Z0OA 4HAVB 3A8PA 1KI1B 3ULBA 3TCAA 2D10A 5JLJB 2CODA 1NI2A 1WJ1A 3WYFB 1OMWA 3KRWA 4HAXB 4TKNA 4L6EA 5JHGA 1OY2A 4XWXA 2DFKA 1X11A 2DYNA 4A6KA 1NTVA 1NTYA 1MK7B 1IRSA 3ULCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A6F B;  1ISN A;  1BAK A;  1H4R A;  2UZR A;  1P6S A;  4IOY X;  1WG7 A;  3U8Z A;  2R09 A;  5CLL B;  1P3R A;  2HE7 A;  2RGN B;  5J3Q A;  3HK0 A;  1UPQ A;  2X18 A;  1DDM A;  3CXB B;  2D4Q A;  3FM8 C;  4K81 A;  5LOP B;  4IFS A;  3KY9 A;  4GXB A;  4F7U P;  1TXD A;  3WA0 A;  3ZDT A;  3X23 A;  1ZC4 B;  3PP2 A;  2YSZ A;  4DX8 A;  2EJ8 A;  3TO1 A;  2RUK B;  2COC A;  2D9W A;  3ZVR A;  2MWN B;  2H7E A;  5D3W A;  2G35 A;  1V89 A;  1GG3 A;  2J0K A;  1QQG A;  2CRF A;  2MFQ A;  4EJN A;  5D3X A;  3SYX A;  2Y7B A;  3KRX A;  1Z87 A;  1FHO A;  4MT7 A;  2L2I A;  1FGZ A;  2D9Y A;  1RJ2 A;  3NSU A;  5FI1 A;  2DX1 A;  2VKI A;  3GYO A;  3UZT A;  4F7G A;  1GC7 A;  4D0N B;  1W1G A;  2M14 A;  3BIN A;  2FJL A;  1UNP A;  2W2X C;  2IFS A;  3F0W A;  4K2P A;  5C6R A;  4HDQ A;  1XR0 B;  4CHM A;  2MKR A;  2P0D A;  2YF0 A;  4EMO A;  2K2J A;  2M38 A;  3A98 B;  2D9V A;  4A6F A;  1K5D B;  2DKP A;  2K00 A;  2I5F A;  1V61 A;  1FHX A;  4F7H A;  1SGH A;  1ZSQ A;  1XCG A;  3PG7 A;  1RRP B;  2ROZ B;  4CYE A;  3P6A A;  2RVB B;  3AU5 A;  1I7A A;  4HAT B;  4WVF B;  1M7R A;  2RLO A;  3O96 A;  4EKU A;  2I5C A;  1XKE A;  2DHJ A;  1B55 A;  2RSG A;  4GMV A;  3ODO A;  4PQ0 A;  4GN1 A;  4A6H A;  3BJI A;  4BBK A;  2AEH A;  5HE1 A;  4CHJ A;  3SNH A;  1SHC A;  1DRO A;  1EGX A;  1E5W A;  1LB1 A;  3N7C A;  1U29 A;  4GZU A;  1OQN A;  1XX0 A;  5GOW B;  1X1G A;  1Y19 B;  1AWE A;  3KZ1 A;  2LOZ A;  2LKO A;  3TFM A;  2D9Z A;  5KQ1 A;  4HB2 B;  2DTC A;  1X1F A;  1X86 A;  2CY4 A;  2ADZ A;  2GJY A;  1PFJ A;  3V5W A;  5FI0 A;  1TQZ A;  4GMX B;  4WSF A;  4YL8 A;  2QKL A;  4A5K A;  2VSZ A;  5HE3 A;  1EAZ A;  2EMT A;  1W1H A;  5C5B B;  3AU4 A;  3DXC A;  2GCL A;  3SO6 A;  2LOX A;  2OQB A;  2Q13 A;  4YON A;  1I2H A;  3IVF A;  2W2W A;  1LW3 A;  2KCJ A;  2RNR B;  3OAN A;  4HB0 B;  4IAP A;  2KGX B;  1WI1 A;  2UZS A;  4H8S A;  1MPH A;  2ELA A;  1DDV A;  1DBH A;  3ODX A;  1DDW A;  3PSC A;  2ZPY A;  3HQC A;  1BWN A;  2DHI A;  5KQ4 A;  2V76 A;  4MY6 A;  2OTX A;  2NZ8 B;  4P7I A;  4WJ7 A;  2Z0Q A;  3AJ4 A;  5L81 A;  2QKM A;  1V5U A;  1PLS A;  2L1C A;  4C0A A;  2DKQ A;  1J19 A;  4KHB B;  3GYP A;  4HAZ B;  3ODW A;  2J0M A;  1DYN A;  2N0Y A;  2VRW B;  2LUL A;  2GS0 A;  1X05 A;  2YT0 A;  2NMB A;  5EFX A;  2ROV A;  2BCJ A;  2XQN M;  5C79 A;  1WGQ A;  2H7D A;  1H10 A;  5DH9 B;  1PMS A;  1Q67 A;  2COA A;  2GCJ A;  1WJM A;  1FOE A;  3PVW A;  4PNK A;  5KCV A;  1MIX A;  3FSS A;  1M7E A;  1U5G A;  2CY5 A;  1U5D A;  4HB4 B;  4TYZ A;  1FGY A;  2P0F A;  1EVH A;  2DX5 A;  3DXE A;  2YS5 A;  4KAX B;  2E2X A;  3VOQ A;  1ZM0 A;  3HW2 B;  1QC6 A;  3PVU A;  4HAU B;  2Y8G A;  1MAI A;  4DXA B;  4K2O A;  2LG1 A;  5D3V A;  2YS1 A;  3MDB C;  3M1I B;  1V5M A;  2ELB A;  3QWM A;  5JHH A;  2DA0 A;  3D8E A;  4GPT B;  5DI9 B;  2DYQ A;  1EF1 A;  2UVM A;  2COF A;  4B6H A;  5J3T A;  3VIA A;  2IYB A;  1MIZ B;  1KZG A;  2AL6 A;  1U5E A;  1V5P A;  3QBV B;  5DHF B;  4HDO A;  1FHW A;  4HB3 B;  3PZD A;  1J0W A;  1U2B A;  4K17 A;  2EMS A;  1N3H A;  3RCP A;  2JP2 A;  2I1K A;  3TW1 A;  2PZ1 A;  1XD4 A;  4Y94 A;  4DX9 0;  2Z0P A;  5D3Y A;  1MK9 B;  3TVV A;  2KUP A;  1XOD A;  3ML4 A;  2YT1 A;  2D9X A;  2J0J A;  4Z2M B;  3FEH A;  1Y5O A;  3T06 A;  1UPR A;  1UEF A;  2P8V A;  1UNQ A;  3D8F A;  2D11 A;  2LYD A;  1BTK A;  4Z2N A;  4DBB A;  5DIF B;  1WGU A;  3A8Q A;  3PEG A;  5C16 A;  1ZC3 B;  2Y8F A;  4ZRK A;  1FAO A;  3G9W A;  5C5B A;  1MKE A;  5D27 A;  4NY0 A;  3CIK A;  2DLW A;  5HE2 A;  1ZVR A;  2YS3 A;  1V88 A;  1AQC A;  4HAY B;  1P5T A;  5JP4 A;  1KZ7 A;  3KSY A;  1U27 A;  1FB8 A;  4KVG B;  4HHV A;  5J3Y A;  3U7D A;  3SV1 A;  1TJ6 A;  1NU2 A;  1UNR A;  2DHK A;  1K5G B;  3MPX A;  2YVC A;  4ZRJ A;  1W1D A;  3D8D A;  5LON B;  2EC1 A;  4ZRI A;  2P0H A;  2DN6 A;  3LJU X;  2K2U A;  3SUZ A;  4MK0 A;  2MDX A;  4KHO A;  3P7Z A;  4KHA A;  4NSW A;  5DHA B;  5CLQ B;  1U5F A;  1WVH A;  2J59 M;  2R0D A;  3F5R A;  3QIJ A;  3PVL A;  1GC6 A;  2D2Q A;  2N23 A;  2CAY A;  3DXD A;  4HAW B;  5HE0 A;  2I1J A;  2HTH B;  2YRY A;  1BTN A;  2W2X D;  2Z0O A;  4HAV B;  3A8P A;  1KI1 B;  3ULB A;  3TCA A;  2D10 A;  5JLJ B;  2COD A;  1NI2 A;  1WJ1 A;  3WYF B;  1OMW A;  3KRW A;  4HAX B;  4TKN A;  4L6E A;  5JHG A;  1OY2 A;  4XWX A;  2DFK A;  1X11 A;  2DYN A;  4A6K A;  1NTV A;  1NTY A;  1MK7 B;  1IRS A;  3ULC A; 
#chains in the Genus database with same CATH topology
 4A6F B;  5I2M A;  1ISN A;  1BAK A;  1H4R A;  3HSA A;  2UZR A;  1P6S A;  4IOY X;  1WG7 A;  3U8Z A;  2R09 A;  5CLL B;  1P3R A;  2HE7 A;  2RGN B;  4GNK B;  5J3Q A;  3HK0 A;  1UPQ A;  2X18 A;  1DDM A;  3CXB B;  2D4Q A;  3FM8 C;  4K81 A;  2K49 A;  5LOP B;  4IFS A;  3KY9 A;  4GXB A;  4F7U P;  1TXD A;  3WA0 A;  3ZDT A;  3X23 A;  1ZC4 B;  3PP2 A;  2YSZ A;  4KHB A;  2GUM A;  4DX8 A;  2EJ8 A;  3TO1 A;  2RUK B;  2COC A;  2D9W A;  3ZVR A;  2MWN B;  2H7E A;  5D3W A;  2G35 A;  1V89 A;  3DCX A;  1GG3 A;  2J0K A;  1QQG A;  2CRF A;  2MFQ A;  4EJN A;  5D3X A;  4OT1 A;  3SYX A;  2Y7B A;  3KRX A;  1Z87 A;  1FHO A;  4MT7 A;  2L2I A;  1FGZ A;  2D9Y A;  1RJ2 A;  3A58 A;  3NSU A;  5FI1 A;  2DX1 A;  2VKI A;  3GYO A;  3UZT A;  4F7G A;  3NWA A;  1GC7 A;  4D0N B;  1W1G A;  5I2S A;  2M14 A;  3BIN A;  2FJL A;  2KIE A;  1UNP A;  2W2X C;  2IFS A;  3F0W A;  4K2P A;  5C6R A;  4HDQ A;  4QJ5 B;  1XR0 B;  4CHM A;  2MKR A;  2P0D A;  2YF0 A;  4EMO A;  2K2J A;  4HSI A;  2M38 A;  3A98 B;  2D9V A;  4A6F A;  1K5D B;  2DKP A;  2K00 A;  4QJ3 B;  2I5F A;  1V61 A;  1FHX A;  4F7H A;  1SGH A;  1ZSQ A;  1XCG A;  3PG7 A;  1RRP B;  2ROZ B;  4CYE A;  3P6A A;  2RVB B;  3AU5 A;  1I7A A;  4HAT B;  4WVF B;  1M7R A;  2RLO A;  3O96 A;  4EKU A;  2I5C A;  1XKE A;  2DHJ A;  1B55 A;  2RSG A;  4GMV A;  3ODO A;  4PQ0 A;  4GN1 A;  4A6H A;  3BJI A;  4BBK A;  2AEH A;  3HIE A;  5HE1 A;  4CHJ A;  3SNH A;  1SHC A;  1DRO A;  1EGX A;  1E5W A;  1LB1 A;  3N7C A;  1U29 A;  4GZU A;  1T77 A;  1OQN A;  1XX0 A;  5GOW B;  1X1G A;  1Y19 B;  1AWE A;  3KZ1 A;  2LOZ A;  2LKO A;  3TFM A;  2D9Z A;  5KQ1 A;  4HB2 B;  2DTC A;  1X1F A;  1X86 A;  2CY4 A;  2KIG A;  2ADZ A;  2GJY A;  4QJ4 B;  1PFJ A;  3V5W A;  5FI0 A;  1TQZ A;  4GMX B;  4WSF A;  4YL8 A;  2QKL A;  4A5K A;  2VSZ A;  5HE3 A;  1EAZ A;  2EMT A;  1W1H A;  5C5B B;  4DIX A;  3AU4 A;  3DXC A;  2GCL A;  3SO6 A;  2LOX A;  2OQB A;  2Q13 A;  4YON A;  1I2H A;  3IVF A;  2W2W A;  1LW3 A;  2KCJ A;  2RNR B;  3OAN A;  4HB0 B;  4IAP A;  2KGX B;  1WI1 A;  2UZS A;  4H8S A;  1MPH A;  2ELA A;  1DDV A;  1DBH A;  3ODX A;  1DDW A;  3PSC A;  2R2Y A;  5LG4 B;  2ZPY A;  3HQC A;  1BWN A;  2DHI A;  5KQ4 A;  2V76 A;  4MY6 A;  2OTX A;  2NZ8 B;  4P7I A;  4OSN A;  4WJ7 A;  2Z0Q A;  3AJ4 A;  5L81 A;  2QKM A;  1V5U A;  1PLS A;  2L1C A;  4C0A A;  2DKQ A;  1J19 A;  4KHB B;  3GYP A;  4HAZ B;  3ODW A;  2J0M A;  1DYN A;  2N0Y A;  2VRW B;  2LUL A;  2GS0 A;  1X05 A;  2YT0 A;  2NMB A;  5EFX A;  2ROV A;  2Z13 A;  2BCJ A;  2XQN M;  5C79 A;  1WGQ A;  2H7D A;  1MI1 A;  1H10 A;  5DH9 B;  1PMS A;  5IRS A;  1Q67 A;  2COA A;  2GCJ A;  1WJM A;  1FOE A;  3PVW A;  4PNK A;  5KCV A;  1MIX A;  3FSS A;  4L1R A;  1M7E A;  1U5G A;  2CY5 A;  1U5D A;  4HB4 B;  4TYZ A;  3NW8 A;  1FGY A;  3B77 A;  2P0F A;  1EVH A;  2DX5 A;  3DXE A;  2YS5 A;  4KAX B;  2E2X A;  3VOQ A;  1ZM0 A;  3HW2 B;  1QC6 A;  3PVU A;  4HAU B;  2Y8G A;  1MAI A;  4DXA B;  4K2O A;  2LG1 A;  5D3V A;  2YS1 A;  3MDB C;  3M1I B;  1V5M A;  2ELB A;  3QWM A;  5JHH A;  4QXA B;  2DA0 A;  3D8E A;  4GPT B;  5DI9 B;  2DYQ A;  1EF1 A;  2UVM A;  2COF A;  4B6H A;  5J3T A;  3VIA A;  2IYB A;  5M4Y B;  1MIZ B;  1KZG A;  2AL6 A;  1U5E A;  1V5P A;  2ZKM X;  2YT2 A;  3QBV B;  3U12 A;  2Z4D A;  5DHF B;  4HDO A;  1FHW A;  4HB3 B;  3PZD A;  1J0W A;  1U2B A;  4K17 A;  2EMS A;  1N3H A;  3RCP A;  2JP2 A;  2I1K A;  3TW1 A;  2PZ1 A;  1XD4 A;  4Y94 A;  4DX9 0;  2Z0P A;  5D3Y A;  1MK9 B;  3TVV A;  2KUP A;  1XOD A;  3ML4 A;  2YT1 A;  2D9X A;  2J0J A;  4Z2M B;  2Z59 A;  3FEH A;  1Y5O A;  3T06 A;  1UPR A;  1UEF A;  2P8V A;  1UNQ A;  4D6W A;  4GOU A;  3D8F A;  2D11 A;  2LYD A;  1BTK A;  4Z2N A;  4DBB A;  5DIF B;  1WGU A;  3A8Q A;  3PEG A;  5C16 A;  1ZC3 B;  2Y8F A;  4ZRK A;  1FAO A;  3G9W A;  5C5B A;  1MKE A;  5D27 A;  4NY0 A;  3CIK A;  2DLW A;  4CSQ A;  5HE2 A;  1ZVR A;  2YS3 A;  1V88 A;  1AQC A;  4HAY B;  1P5T A;  5JP4 A;  1KZ7 A;  3KSY A;  1U27 A;  1FB8 A;  4KVG B;  4HHV A;  5J3Y A;  3U7D A;  3SV1 A;  1TJ6 A;  2K8E A;  1NU2 A;  3NWF A;  1UNR A;  2DHK A;  1K5G B;  3MPX A;  2YVC A;  4ZRJ A;  1W1D A;  3D8D A;  5LON B;  2EC1 A;  4ZRI A;  2FJU B;  2P0H A;  2DN6 A;  3LJU X;  2K2U A;  3SUZ A;  1ZYI A;  4MK0 A;  3NWD A;  2MDX A;  4KHO A;  3P7Z A;  4KHA A;  4NSW A;  5DHA B;  5CLQ B;  1U5F A;  1WVH A;  2J59 M;  2R0D A;  3F5R A;  3FVC A;  3QIJ A;  3PVL A;  1GC6 A;  2D2Q A;  2N23 A;  2CAY A;  3DXD A;  4HAW B;  5HE0 A;  2I1J A;  2HTH B;  2YRY A;  1BTN A;  2W2X D;  2Z0O A;  4HAV B;  3A8P A;  1KI1 B;  3ULB A;  2Z14 A;  3TCA A;  2D10 A;  5JLJ B;  2COD A;  1NI2 A;  1WJ1 A;  3WYF B;  1OMW A;  3KRW A;  4HAX B;  4TKN A;  4L6E A;  5JHG A;  1OY2 A;  2KR0 A;  4XWX A;  2KUQ A;  2DFK A;  1X11 A;  3OHM B;  2DYN A;  2RRF A;  2NBV A;  4A6K A;  1NTV A;  1NTY A;  1MK7 B;  1IRS A;  3ULC A; 
#chains in the Genus database with same CATH homology
 4A6F B;  1ISN A;  1BAK A;  1H4R A;  2UZR A;  1P6S A;  4IOY X;  1WG7 A;  3U8Z A;  2R09 A;  5CLL B;  1P3R A;  2HE7 A;  2RGN B;  5J3Q A;  3HK0 A;  1UPQ A;  2X18 A;  1DDM A;  3CXB B;  2D4Q A;  3FM8 C;  4K81 A;  5LOP B;  4IFS A;  3KY9 A;  4GXB A;  4F7U P;  1TXD A;  3WA0 A;  3ZDT A;  3X23 A;  1ZC4 B;  3PP2 A;  2YSZ A;  4DX8 A;  2EJ8 A;  3TO1 A;  2RUK B;  2COC A;  2D9W A;  3ZVR A;  2MWN B;  2H7E A;  5D3W A;  2G35 A;  1V89 A;  1GG3 A;  2J0K A;  1QQG A;  2CRF A;  2MFQ A;  4EJN A;  5D3X A;  3SYX A;  2Y7B A;  3KRX A;  1Z87 A;  1FHO A;  4MT7 A;  2L2I A;  1FGZ A;  2D9Y A;  1RJ2 A;  3NSU A;  5FI1 A;  2DX1 A;  2VKI A;  3GYO A;  3UZT A;  4F7G A;  1GC7 A;  4D0N B;  1W1G A;  2M14 A;  3BIN A;  2FJL A;  1UNP A;  2W2X C;  2IFS A;  3F0W A;  4K2P A;  5C6R A;  4HDQ A;  1XR0 B;  4CHM A;  2MKR A;  2P0D A;  2YF0 A;  4EMO A;  2K2J A;  2M38 A;  3A98 B;  2D9V A;  4A6F A;  1K5D B;  2DKP A;  2K00 A;  2I5F A;  1V61 A;  1FHX A;  4F7H A;  1SGH A;  1ZSQ A;  1XCG A;  3PG7 A;  1RRP B;  2ROZ B;  4CYE A;  3P6A A;  2RVB B;  3AU5 A;  1I7A A;  4HAT B;  4WVF B;  1M7R A;  2RLO A;  3O96 A;  4EKU A;  2I5C A;  1XKE A;  2DHJ A;  1B55 A;  2RSG A;  4GMV A;  3ODO A;  4PQ0 A;  4GN1 A;  4A6H A;  3BJI A;  4BBK A;  2AEH A;  5HE1 A;  4CHJ A;  3SNH A;  1SHC A;  1DRO A;  1EGX A;  1E5W A;  1LB1 A;  3N7C A;  1U29 A;  4GZU A;  1OQN A;  1XX0 A;  5GOW B;  1X1G A;  1Y19 B;  1AWE A;  3KZ1 A;  2LOZ A;  2LKO A;  3TFM A;  2D9Z A;  5KQ1 A;  4HB2 B;  2DTC A;  1X1F A;  1X86 A;  2CY4 A;  2ADZ A;  2GJY A;  1PFJ A;  3V5W A;  5FI0 A;  1TQZ A;  4GMX B;  4WSF A;  4YL8 A;  2QKL A;  4A5K A;  2VSZ A;  5HE3 A;  1EAZ A;  2EMT A;  1W1H A;  5C5B B;  3AU4 A;  3DXC A;  2GCL A;  3SO6 A;  2LOX A;  2OQB A;  2Q13 A;  4YON A;  1I2H A;  3IVF A;  2W2W A;  1LW3 A;  2KCJ A;  2RNR B;  3OAN A;  4HB0 B;  4IAP A;  2KGX B;  1WI1 A;  2UZS A;  4H8S A;  1MPH A;  2ELA A;  1DDV A;  1DBH A;  3ODX A;  1DDW A;  3PSC A;  2ZPY A;  3HQC A;  1BWN A;  2DHI A;  5KQ4 A;  2V76 A;  4MY6 A;  2OTX A;  2NZ8 B;  4P7I A;  4WJ7 A;  2Z0Q A;  3AJ4 A;  5L81 A;  2QKM A;  1V5U A;  1PLS A;  2L1C A;  4C0A A;  2DKQ A;  1J19 A;  4KHB B;  3GYP A;  4HAZ B;  3ODW A;  2J0M A;  1DYN A;  2N0Y A;  2VRW B;  2LUL A;  2GS0 A;  1X05 A;  2YT0 A;  2NMB A;  5EFX A;  2ROV A;  2BCJ A;  2XQN M;  5C79 A;  1WGQ A;  2H7D A;  1H10 A;  5DH9 B;  1PMS A;  1Q67 A;  2COA A;  2GCJ A;  1WJM A;  1FOE A;  3PVW A;  4PNK A;  5KCV A;  1MIX A;  3FSS A;  1M7E A;  1U5G A;  2CY5 A;  1U5D A;  4HB4 B;  4TYZ A;  1FGY A;  2P0F A;  1EVH A;  2DX5 A;  3DXE A;  2YS5 A;  4KAX B;  2E2X A;  3VOQ A;  1ZM0 A;  3HW2 B;  1QC6 A;  3PVU A;  4HAU B;  2Y8G A;  1MAI A;  4DXA B;  4K2O A;  2LG1 A;  5D3V A;  2YS1 A;  3MDB C;  3M1I B;  1V5M A;  2ELB A;  3QWM A;  5JHH A;  2DA0 A;  3D8E A;  4GPT B;  5DI9 B;  2DYQ A;  1EF1 A;  2UVM A;  2COF A;  4B6H A;  5J3T A;  3VIA A;  2IYB A;  1MIZ B;  1KZG A;  2AL6 A;  1U5E A;  1V5P A;  3QBV B;  5DHF B;  4HDO A;  1FHW A;  4HB3 B;  3PZD A;  1J0W A;  1U2B A;  4K17 A;  2EMS A;  1N3H A;  3RCP A;  2JP2 A;  2I1K A;  3TW1 A;  2PZ1 A;  1XD4 A;  4Y94 A;  4DX9 0;  2Z0P A;  5D3Y A;  1MK9 B;  3TVV A;  2KUP A;  1XOD A;  3ML4 A;  2YT1 A;  2D9X A;  2J0J A;  4Z2M B;  3FEH A;  1Y5O A;  3T06 A;  1UPR A;  1UEF A;  2P8V A;  1UNQ A;  3D8F A;  2D11 A;  2LYD A;  1BTK A;  4Z2N A;  4DBB A;  5DIF B;  1WGU A;  3A8Q A;  3PEG A;  5C16 A;  1ZC3 B;  2Y8F A;  4ZRK A;  1FAO A;  3G9W A;  5C5B A;  1MKE A;  5D27 A;  4NY0 A;  3CIK A;  2DLW A;  5HE2 A;  1ZVR A;  2YS3 A;  1V88 A;  1AQC A;  4HAY B;  1P5T A;  5JP4 A;  1KZ7 A;  3KSY A;  1U27 A;  1FB8 A;  4KVG B;  4HHV A;  5J3Y A;  3U7D A;  3SV1 A;  1TJ6 A;  1NU2 A;  1UNR A;  2DHK A;  1K5G B;  3MPX A;  2YVC A;  4ZRJ A;  1W1D A;  3D8D A;  5LON B;  2EC1 A;  4ZRI A;  2P0H A;  2DN6 A;  3LJU X;  2K2U A;  3SUZ A;  4MK0 A;  2MDX A;  4KHO A;  3P7Z A;  4KHA A;  4NSW A;  5DHA B;  5CLQ B;  1U5F A;  1WVH A;  2J59 M;  2R0D A;  3F5R A;  3QIJ A;  3PVL A;  1GC6 A;  2D2Q A;  2N23 A;  2CAY A;  3DXD A;  4HAW B;  5HE0 A;  2I1J A;  2HTH B;  2YRY A;  1BTN A;  2W2X D;  2Z0O A;  4HAV B;  3A8P A;  1KI1 B;  3ULB A;  3TCA A;  2D10 A;  5JLJ B;  2COD A;  1NI2 A;  1WJ1 A;  3WYF B;  1OMW A;  3KRW A;  4HAX B;  4TKN A;  4L6E A;  5JHG A;  1OY2 A;  4XWX A;  2DFK A;  1X11 A;  2DYN A;  4A6K A;  1NTV A;  1NTY A;  1MK7 B;  1IRS A;  3ULC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...